Search Results

Search found 9132 results on 366 pages for 'convert'.

Page 360/366 | < Previous Page | 356 357 358 359 360 361 362 363 364 365 366  | Next Page >

  • How to add Category in DotClear blog with HttpWebRequest or MetaWeblog API

    - by Pitming
    I'm trying to create/modify dotclear blogs. For most of the options, i use XmlRpc API (DotClear.MetaWeblog). But didn't find any way to handle categories. So I start to look at the Http packet and try to do "the same as the browser". Here si the method I use to "Http POST" protected HttpStatusCode HttpPost(Uri url_, string data_, bool allowAutoRedirect_) { HttpWebRequest Request; HttpWebResponse Response = null; Stream ResponseStream = null; Request = (System.Net.HttpWebRequest)HttpWebRequest.Create(url_); Request.UserAgent = "Mozilla/5.0 (Windows; U; Windows NT 5.1; fr; rv:1.9.1.5) Gecko/20091102 Firefox/3.5.5 (.NET CLR 3.5.30729)"; Request.Accept = "text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8"; Request.AllowAutoRedirect = allowAutoRedirect_; // Add the network credentials to the request. Request.Credentials = new NetworkCredential(Username, Password); string authInfo = Username + ":" + Password; authInfo = Convert.ToBase64String(Encoding.Default.GetBytes(authInfo)); Request.Headers["Authorization"] = "Basic " + authInfo; Request.Method = "POST"; Request.CookieContainer = Cookies; if(ConnectionCookie!=null) Request.CookieContainer.Add(url_, ConnectionCookie); if (dcAdminCookie != null) Request.CookieContainer.Add(url_, dcAdminCookie); Request.PreAuthenticate = true; ASCIIEncoding encoding = new ASCIIEncoding(); string postData = data_; byte[] data = encoding.GetBytes(postData); //Encoding.UTF8.GetBytes(data_); //encoding.GetBytes(postData); Request.ContentLength = data.Length; Request.ContentType = "application/x-www-form-urlencoded"; Stream newStream = Request.GetRequestStream(); // Send the data. newStream.Write(data, 0, data.Length); newStream.Close(); try { // get the response from the server. Response = (HttpWebResponse)Request.GetResponse(); if (!allowAutoRedirect_) { foreach (Cookie c in Response.Cookies) { if (c.Name == "dcxd") ConnectionCookie = c; if (c.Name == "dc_admin") dcAdminCookie = c; } Cookies.Add(Response.Cookies); } // Get the response stream. ResponseStream = Response.GetResponseStream(); // Pipes the stream to a higher level stream reader with the required encoding format. StreamReader readStream = new StreamReader(ResponseStream, Encoding.UTF8); string result = readStream.ReadToEnd(); if (Request.RequestUri == Response.ResponseUri) { _log.InfoFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } else { _log.WarnFormat("RequestUri:{0}\r\nResponseUri:{1}\r\nstatus code:{2} Status descr:{3}", Request.RequestUri, Response.ResponseUri, Response.StatusCode, Response.StatusDescription); } } catch (WebException wex) { Response = wex.Response as HttpWebResponse; if (Response != null) { _log.ErrorFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } Request.Abort(); } finally { if (Response != null) { // Releases the resources of the response. Response.Close(); } } if(Response !=null) return Response.StatusCode; return HttpStatusCode.Ambiguous; } So the first thing to do is to Authenticate as admin. Here is the code: protected bool HttpAuthenticate() { Uri u = new Uri(this.Url); Uri url = new Uri(string.Format("{0}/admin/auth.php", u.GetLeftPart(UriPartial.Authority))); string data = string.Format("user_id={0}&user_pwd={1}&user_remember=1", Username, Password); var ret = HttpPost(url,data,false); return (ret == HttpStatusCode.OK || ret==HttpStatusCode.Found); } 3.Now that I'm authenticate, i need to get a xd_chek info (that i can find on the page so basically it's a GET on /admin/category.php + Regex("dotclear[.]nonce = '(.*)'")) 4.so I'm authenticate and have the xd_check info. The last thing to do seems to post the next category. But of course it does not work at all... here is the code: string postData = string.Format("cat_title={0}&new_cat_parent={1}&xd_check={2}", category_, 0, xdCheck); HttpPost(url, postData, true); If anyone can help me and explain were is it wrong ? thanks in advance.

    Read the article

  • asp.net - csharp - jquery - looking for a better and usage solution

    - by LostLord
    hi my dear friends i have a little problem about using jquery...(i reeally do not know jquery but i forced to use it) i am using vs 2008 - asp.net web app with c# also i am using telerik controls in my pages also i am using sqldatasources (Connecting to storedprocedures) in my pages my pages base on master and content pages and in content pages i have mutiviews ================================================================================= in one of the views(inside one of those multiviews)i had made two radcombo boxes for country and city requirement like cascading dropdowns as parent and child combo boxes. i used old way for doing that , i mean i used update panel and in the SelectedIndexChange Event of Parent RadComboBox(Country) i Wrote this code : protected void RadcomboboxCountry_SelectedIndexChanged(object o, RadComboBoxSelectedIndexChangedEventArgs e) { hfSelectedCo_ID.Value = RadcomboboxCountry.SelectedValue; RadcomboboxCity.Items.Clear(); RadcomboboxCity.Items.Add(new RadComboBoxItem(" ...", "5")); RadcomboboxCity.DataBind(); RadcomboboxCity.SelectedIndex = 0; } my child radcombo box can fill by upper code , let me tell you how : the child sqldatasource have a sp that has a parameter and i fill that parameter by this line - hfSelectedCo_ID.Value = RadcbCoNameInInsert.SelectedValue; RadcbCoNameInInsert.SelectedValue means country ID. after doing that SelectedIndexChange Event of Parent RadComboBox(Country) could not be fire therefore i forced to set the autopostback property to true. afetr doing that every thing was ok until some one told me can u control focus and keydown of your radcombo boxes (when u press enter key on the parent combobox[country] , so child combobox gets focus -- and when u press upperkey on child radcombobox [city], so parent combobox[country] gets focus) (For Users That Do Not Want To Use Mouse for Input Info And Choose items) i told him this is web app , not win form and we can not do that. i googled it and i found jquery the only way for doing that ... so i started using jquery . i wrote this code with jquery for both of them : <script src="../JQuery/jquery-1.4.1.js" language="javascript" type="text/javascript"></script> <script type="text/javascript"> $(function() { $('input[id$=RadcomboboxCountry_Input]').focus(); $('input[id$=RadcomboboxCountry_Input]').select(); $('input[id$=RadcomboboxCountry_Input]').bind('keyup', function(e) { var code = (e.keyCode ? e.keyCode : e.which); if (code == 13) { -----------> Enter Key $('input[id$=RadcomboboxCity_Input]').focus(); $('input[id$=RadcomboboxCity_Input]').select(); } }); $('input[id$=RadcomboboxCity_Input]').bind('keyup', function(e) { var code = (e.keyCode ? e.keyCode : e.which); if (code == 38) { -----------> Upper Key $('input[id$=RadcomboboxCountry_Input]').focus(); $('input[id$=RadcomboboxCountry_Input]').select(); } }); }); </script> this jquery code worked BBBBBBUUUUUUUTTTTTT autopostback=true of the Parent RadComboBox Became A Problem , Because when SelectedIndex Change Of ParentRadComboBox is fired after that Telerik Skins runs and after that i lost parent ComboBox Focus and we should use mouse but we don't want it.... for fix this problem i decided to set autopostback of perentCB to false and convert protected void RadcomboboxCountry_SelectedIndexChanged(object o, RadComboBoxSelectedIndexChangedEventArgs e) { hfSelectedCo_ID.Value = RadcomboboxCountry.SelectedValue; RadcomboboxCity.Items.Clear(); RadcomboboxCity.Items.Add(new RadComboBoxItem(" ...", "5")); RadcomboboxCity.DataBind(); RadcomboboxCity.SelectedIndex = 0; } to a public non static method without parameters and call it with jquey like this : (i used onclientchanged property of parentcombo box like onclientchanged = "MyMethodForParentCB_InJquery();" insread of selectedindexchange event) public void MyMethodForParentCB_InCodeBehind() { hfSelectedCo_ID.Value = RadcomboboxCountry.SelectedValue; RadcomboboxCity.Items.Clear(); RadcomboboxCity.Items.Add(new RadComboBoxItem(" ...", "5")); RadcomboboxCity.DataBind(); RadcomboboxCity.SelectedIndex = 0; } for doing that i read the blow manual and do that step by step : ======================================================================= http://www.ajaxprojects.com/ajax/tutorialdetails.php?itemid=732 ======================================================================= but this manual is about static methods and this is my new problem ... when i am using static method like : public static void MyMethodForParentCB_InCodeBehind() { hfSelectedCo_ID.Value = RadcomboboxCountry.SelectedValue; RadcomboboxCity.Items.Clear(); RadcomboboxCity.Items.Add(new RadComboBoxItem(" ...", "5")); RadcomboboxCity.DataBind(); RadcomboboxCity.SelectedIndex = 0; } so i recieved some errors and this method could not recognize my controls and hidden field... one of those errors like this : Error 2 An object reference is required for the non-static field, method, or property 'Darman.SuperAdmin.Users.hfSelectedCo_ID' C:\Javad\Copy of Darman 6\Darman\SuperAdmin\Users.aspx.cs 231 13 Darman any idea or is there any way to call non static methods with jquery (i know we can not do that but is there another way to solve my problem)???????????????

    Read the article

  • Mutating the expression tree of a predicate to target another type

    - by Jon
    Intro In the application I 'm currently working on, there are two kinds of each business object: the "ActiveRecord" type, and the "DataContract" type. So for example, we have: namespace ActiveRecord { class Widget { public int Id { get; set; } } } namespace DataContracts { class Widget { public int Id { get; set; } } } The database access layer takes care of "translating" between hierarchies: you can tell it to update a DataContracts.Widget, and it will magically create an ActiveRecord.Widget with the same property values and save that. The problem I have surfaced when attempting to refactor this database access layer. The Problem I want to add methods like the following to the database access layer: // Widget is DataContract.Widget interface DbAccessLayer { IEnumerable<Widget> GetMany(Expression<Func<Widget, bool>> predicate); } The above is a simple general-use "get" method with custom predicate. The only point of interest is that I 'm not passing in an anonymous function but rather an expression tree. This is done because inside DbAccessLayer we have to query ActiveRecord.Widget efficiently (LINQ to SQL) and not have the database return all ActiveRecord.Widget instances and then filter the enumerable collection. We need to pass in an expression tree, so we ask for one as the parameter for GetMany. The snag: the parameter we have needs to be magically transformed from an Expression<Func<DataContract.Widget, bool>> to an Expression<Func<ActiveRecord.Widget, bool>>. This is where I haven't managed to pull it off... Attempted Solution What we 'd like to do inside GetMany is: IEnumerable<DataContract.Widget> GetMany( Expression<Func<DataContract.Widget, bool>> predicate) { var lambda = Expression.Lambda<Func<ActiveRecord.Widget, bool>>( predicate.Body, predicate.Parameters); // use lambda to query ActiveRecord.Widget and return some value } This won't work because in a typical scenario, for example if: predicate == w => w.Id == 0; ...the expression tree contains a MemberAccessExpression instance which has a MemberInfo property (named Member) that point to members of DataContract.Widget. There are also ParameterExpression instances both in the expression tree and in its parameter expression collection (predicate.Parameters); After searching a bit, I found System.Linq.Expressions.ExpressionVisitor (its source can be found here in the context of a how-to, very helpful) which is a convenient way to modify an expression tree. Armed with this, I implemented a visitor. This simple visitor only takes care of changing the types in member access and parameter expressions. It may not be complete, but it's fine for the expression w => w.Id == 0. internal class Visitor : ExpressionVisitor { private readonly Func<Type, Type> dataContractToActiveRecordTypeConverter; public Visitor(Func<Type, Type> dataContractToActiveRecordTypeConverter) { this.dataContractToActiveRecordTypeConverter = dataContractToActiveRecordTypeConverter; } protected override Expression VisitMember(MemberExpression node) { var dataContractType = node.Member.ReflectedType; var activeRecordType = this.dataContractToActiveRecordTypeConverter(dataContractType); var converted = Expression.MakeMemberAccess( base.Visit(node.Expression), activeRecordType.GetProperty(node.Member.Name)); return converted; } protected override Expression VisitParameter(ParameterExpression node) { var dataContractType = node.Type; var activeRecordType = this.dataContractToActiveRecordTypeConverter(dataContractType); return Expression.Parameter(activeRecordType, node.Name); } } With this visitor, GetMany becomes: IEnumerable<DataContract.Widget> GetMany( Expression<Func<DataContract.Widget, bool>> predicate) { var visitor = new Visitor(...); var lambda = Expression.Lambda<Func<ActiveRecord.Widget, bool>>( visitor.Visit(predicate.Body), predicate.Parameters.Select(p => visitor.Visit(p)); var widgets = ActiveRecord.Widget.Repository().Where(lambda); // This is just for reference, see below Expression<Func<ActiveRecord.Widget, bool>> referenceLambda = w => w.Id == 0; // Here we 'd convert the widgets to instances of DataContract.Widget and // return them -- this has nothing to do with the question though. } Results The good news is that lambda is constructed just fine. The bad news is that it isn't working; it's blowing up on me when I try to use it (the exception messages are really not helpful at all). I have examined the lambda my code produces and a hardcoded lambda with the same expression; they look exactly the same. I spent hours in the debugger trying to find some difference, but I can't. When predicate is w => w.Id == 0, lambda looks exactly like referenceLambda. But the latter works with e.g. IQueryable<T>.Where, while the former does not (I have tried this in the immediate window of the debugger). I should also mention that when predicate is w => true, it all works just fine. Therefore I am assuming that I 'm not doing enough work in Visitor, but I can't find any more leads to follow on. Can someone point me in the right direction? Thanks in advance for your help!

    Read the article

  • Hibernate Lazy initialization exception problem with Gilead in GWT 2.0 integration

    - by sylsau
    Hello, I use GWT 2.0 as UI layer on my project. On server side, I use Hibernate. For example, this is 2 domains entities that I have : public class User { private Collection<Role> roles; @ManyToMany(cascade = CascadeType.ALL, fetch = FetchType.LAZY, mappedBy = "users", targetEntity = Role.class) public Collection<Role> getRoles() { return roles; } ... } public class Role { private Collection<User> users; @ManyToMany(cascade = CascadeType.ALL, fetch = FetchType.LAZY, targetEntity = User.class) public Collection<User> getUsers() { return users; } ... } On my DAO layer, I use UserDAO that extends HibernateDAOSupport from Spring. UserDAO has getAll method to return all of Users. And on my DAO service, I use UserService that uses userDAO to getAll of Users. So, when I get all of Users from UsersService, Users entities returned are detached from Hibernate session. For that reason, I don't want to use getRoles() method on Users instance that I get from my service. What I want is just to transfer my list of Users thanks to a RPC Service to be able to use others informations of Users in client side with GWT. Thus, my main problem is to be able to convert PersistentBag in Users.roles in simple List to be able to transfer via RPC the Users. To do that, I have seen that Gilead Framework could be a solution. In order to use Gilead, I have changed my domains entities. Now, they extend net.sf.gilead.pojo.gwt.LightEntity and they respect JavaBean specification. On server, I expose my services via RPC thanks to GwtRpcSpring framework (http://code.google.com/p/gwtrpc-spring/). This framework has an advice that makes easier Gilead integration. My applicationContext contains the following configuration for Gilead : <bean id="gileadAdapterAdvisor" class="org.gwtrpcspring.gilead.GileadAdapterAdvice" /> <aop:config> <aop:aspect id="gileadAdapterAspect" ref="gileadAdapterAdvisor"> <aop:pointcut id="gileadPointcut" expression="execution(public * com.google.gwt.user.client.rpc.RemoteService.*(..))" /> <aop:around method="doBasicProfiling" pointcut-ref="gileadPointcut" /> </aop:aspect> </aop:config> <bean id="proxySerializer" class="net.sf.gilead.core.serialization.GwtProxySerialization" /> <bean id="proxyStore" class="net.sf.gilead.core.store.stateless.StatelessProxyStore"> <property name="proxySerializer" ref="proxySerializer" /> </bean> <bean id="persistenceUtil" class="net.sf.gilead.core.hibernate.HibernateUtil"> <property name="sessionFactory" ref="sessionFactory" /> </bean> <bean class="net.sf.gilead.core.PersistentBeanManager"> <property name="proxyStore" ref="proxyStore" /> <property name="persistenceUtil" ref="persistenceUtil" /> </bean> The code of the the method doBasicProfiling is the following : @Around("within(com.google.gwt.user.client.rpc.RemoteService..*)") public Object doBasicProfiling(ProceedingJoinPoint pjp) throws Throwable { if (log.isDebugEnabled()) { String className = pjp.getSignature().getDeclaringTypeName(); String methodName = className .substring(className.lastIndexOf(".") + 1) + "." + pjp.getSignature().getName(); log.debug("Wrapping call to " + methodName + " for PersistentBeanManager"); } GileadHelper.parseInputParameters(pjp.getArgs(), beanManager, RemoteServiceUtil.getThreadLocalSession()); Object retVal = pjp.proceed(); retVal = GileadHelper.parseReturnValue(retVal, beanManager); return retVal; } With that configuration, when I run my application and I use my RPC Service that gets all of Users, I obtain a lazy initialization exception from Hibernate from Users.roles. I am disappointed because I thought that Gilead would let me to serialize my domain entities even if these entities contained PersistentBag. It's not one of the goals of Gilead ? So, someone would know how to configure Gilead (with GwtRpcSpring or other solution) to be able to transfer domain entities without Lazy exception ? Thanks by advance for your help. Sylvain

    Read the article

  • ffmpeg-php permission denied on localhost

    - by user572271
    Hello, I am very new to php. I recently setup php on my mac and I am trying to setup ffmpeg-php to convert various videos to flv or other formats as desired. I used this tutorial FFmpeg Mac Installation and I got ffmpeg to work using the terminal, however, when I try to encode a movie using php I get an error. In my apache error_log file it says permission denied next to the flv file (shown below). FFmpeg version 0.6, Copyright (c) 2000-2010 the FFmpeg developers built on Dec 30 2010 08:36:24 with gcc 4.2.1 (Apple Inc. build 5646) (dot 1) configuration: --prefix=/usr/local --enable-shared --disable-mmx --enable-libmp3lame --enable-gpl --enable-libfaad --enable-zlib --enable-libvorbis --enable-libfaac --enable-nonfree libavutil 50.15. 1 / 50.15. 1 libavcodec 52.72. 2 / 52.72. 2 libavformat 52.64. 2 / 52.64. 2 libavdevice 52. 2. 0 / 52. 2. 0 libswscale 0.11. 0 / 0.11. 0 Seems stream 1 codec frame rate differs from container frame rate: 1200.00 (1200/1) - 30.00 (30/1) Input #0, mov,mp4,m4a,3gp,3g2,mj2, from '/Users/myApple/Sites/AdHere/test.mov': Metadata: major_brand : qt minor_version : 537199360 compatible_brands: qt Duration: 00:00:02.04, start: 0.000000, bitrate: 1109 kb/s Stream #0.0(eng): Audio: aac, 44100 Hz, stereo, s16, 97 kb/s Stream #0.1(eng): Video: h264, yuv420p, 640x480, 1027 kb/s, 30.15 fps, 30 tbr, 600 tbn, 1200 tbc /Users/myApple/Sites/AdHere/movteststuff.flv: Permission denied I have no idea what the problem is. I am using the following php code: <?php extension_loaded('ffmpeg') or die('Error in loading ffmpeg'); $ffmpegInstance = new ffmpeg_movie('test.AVI'); echo "getDuration: " . $ffmpegInstance->getDuration() . "<br>getFrameCount: " . $ffmpegInstance->getFrameCount() . "<br>getFrameRate: " . $ffmpegInstance->getFrameRate() . "<br>getFilename: " . $ffmpegInstance->getFilename() . "<br>getComment: " . $ffmpegInstance->getComment() . "<br>getTitle: " . $ffmpegInstance->getTitle() . "<br>getAuthor: " . $ffmpegInstance->getAuthor() . "<br>getCopyright: " . $ffmpegInstance->getCopyright() . "<br>getArtist: " . $ffmpegInstance->getArtist() . "<br>getGenre: " . $ffmpegInstance->getGenre() . "<br>getTrackNumber: " . $ffmpegInstance->getTrackNumber() . "<br>getYear: " . $ffmpegInstance->getYear() . "<br>getFrameHeight: " . $ffmpegInstance->getFrameHeight() . "<br>getFrameWidth: " . $ffmpegInstance->getFrameWidth() . "<br>getPixelFormat: " . $ffmpegInstance->getPixelFormat() . "<br>getBitRate: " . $ffmpegInstance->getBitRate() . "<br>getVideoBitRate: " . $ffmpegInstance->getVideoBitRate() . "<br>getAudioBitRate: " . $ffmpegInstance->getAudioBitRate() . "<br>getAudioSampleRate: " . $ffmpegInstance->getAudioSampleRate() . "<br>getVideoCodec: " . $ffmpegInstance->getVideoCodec() . "<br>getAudioCodec: " . $ffmpegInstance->getAudioCodec() . "<br>getAudioChannels: " . $ffmpegInstance->getAudioChannels() . "<br>hasAudio: " . $ffmpegInstance->hasAudio(); exec('ffmpeg -i /Users/myApple/Sites/AdHere/test.mov /Users/myApple/Sites/AdHere/movteststuff.flv'); ?> I am able to see various parameters like filename, frameheight, framewidth, which leads me to believe that ffmpeg-php is kind of working, but maybe I am just doing something wrong in the exec() command. Anyone have any ideas. I have been struggling with setting up ffmpeg for quite some time now. Thanks! -Jon

    Read the article

  • Trouble updating my datagrid in WPF

    - by wrigley06
    As the title indicates, I'm having trouble updating a datagrid in WPF. Basically what I'm trying to accomplish is a datagrid, that is connected to a SQL Server database, that updates automatically once a user enters information into a few textboxes and clicks a submit button. You'll notice that I have a command that joins two tables. The data from the Quote_Data table will be inserted by a different user at a later time. For now my only concern is getting the information from the textboxes and into the General_Info table, and from there into my datagrid. The code, which I'll include below compiles fine, but when I hit the submit button, nothing happens. This is the first application I've ever built working with a SQL Database so many of these concepts are new to me, which is why you'll probably look at my code and wonder what is he thinking. public partial class MainWindow : Window { public MainWindow() { InitializeComponent(); } public DataSet mds; // main data set (mds) private void Window_Loaded_1(object sender, RoutedEventArgs e) { try { string connectionString = Sqtm.Properties.Settings.Default.SqtmDbConnectionString; using (SqlConnection connection = new SqlConnection(connectionString)) { connection.Open(); //Merging tables General_Info and Quote_Data SqlCommand cmd = new SqlCommand("SELECT General_Info.Quote_ID, General_Info.Open_Quote, General_Info.Customer_Name," + "General_Info.OEM_Name, General_Info.Qty, General_Info.Quote_Num, General_Info.Fab_Drawing_Num, " + "General_Info.Rfq_Num, General_Info.Rev_Num, Quote_Data.MOA, Quote_Data.MOQ, " + "Quote_Data.Markup, Quote_Data.FOB, Quote_Data.Shipping_Method, Quote_Data.Freight, " + "Quote_Data.Vendor_Price, Unit_Price, Quote_Data.Difference, Quote_Data.Vendor_NRE_ET, " + "Quote_Data.NRE, Quote_Data.ET, Quote_Data.STI_NET, Quote_Data.Mfg_Time, Quote_Data.Delivery_Time, " + "Quote_Data.Mfg_Name, Quote_Data.Mfg_Location " + "FROM General_Info INNER JOIN dbo.Quote_Data ON General_Info.Quote_ID = Quote_Data.Quote_ID", connection); SqlDataAdapter da = new SqlDataAdapter(cmd); DataTable dt = new DataTable(); da.Fill(dt); MainGrid.ItemsSource = dt.DefaultView; mds = new DataSet(); da.Fill(mds, "General_Info"); MainGrid.DataContext = mds.Tables["General_Info"]; } } catch (Exception ex) { MessageBox.Show(ex.Message); } // renaming column names from the database so they are easier to read in the datagrid MainGrid.Columns[0].Header = "#"; MainGrid.Columns[1].Header = "Date"; MainGrid.Columns[2].Header = "Customer"; MainGrid.Columns[3].Header = "OEM"; MainGrid.Columns[4].Header = "Qty"; MainGrid.Columns[5].Header = "Quote Number"; MainGrid.Columns[6].Header = "Fab Drawing Num"; MainGrid.Columns[7].Header = "RFQ Number"; MainGrid.Columns[8].Header = "Rev Number"; MainGrid.Columns[9].Header = "MOA"; MainGrid.Columns[10].Header = "MOQ"; MainGrid.Columns[11].Header = "Markup"; MainGrid.Columns[12].Header = "FOB"; MainGrid.Columns[13].Header = "Shipping"; MainGrid.Columns[14].Header = "Freight"; MainGrid.Columns[15].Header = "Vendor Price"; MainGrid.Columns[16].Header = "Unit Price"; MainGrid.Columns[17].Header = "Difference"; MainGrid.Columns[18].Header = "Vendor NRE/ET"; MainGrid.Columns[19].Header = "NRE"; MainGrid.Columns[20].Header = "ET"; MainGrid.Columns[21].Header = "STINET"; MainGrid.Columns[22].Header = "Mfg. Time"; MainGrid.Columns[23].Header = "Delivery Time"; MainGrid.Columns[24].Header = "Manufacturer"; MainGrid.Columns[25].Header = "Mfg. Location"; } private void submitQuotebtn_Click(object sender, RoutedEventArgs e) { CustomerData newQuote = new CustomerData(); int quantity; quantity = Convert.ToInt32(quantityTxt.Text); string theDate = System.DateTime.Today.Date.ToString("d"); newQuote.OpenQuote = theDate; newQuote.CustomerName = customerNameTxt.Text; newQuote.OEMName = oemNameTxt.Text; newQuote.Qty = quantity; newQuote.QuoteNumber = quoteNumberTxt.Text; newQuote.FdNumber = fabDrawingNumberTxt.Text; newQuote.RfqNumber = rfqNumberTxt.Text; newQuote.RevNumber = revNumberTxt.Text; try { string insertConString = Sqtm.Properties.Settings.Default.SqtmDbConnectionString; using (SqlConnection insertConnection = new SqlConnection(insertConString)) { insertConnection.Open(); SqlDataAdapter adapter = new SqlDataAdapter(Sqtm.Properties.Settings.Default.SqtmDbConnectionString, insertConnection); SqlCommand updateCmd = new SqlCommand("UPDATE General_Info " + "Quote_ID = @Quote_ID, " + "Open_Quote = @Open_Quote, " + "OEM_Name = @OEM_Name, " + "Qty = @Qty, " + "Quote_Num = @Quote_Num, " + "Fab_Drawing_Num = @Fab_Drawing_Num, " + "Rfq_Num = @Rfq_Num, " + "Rev_Num = @Rev_Num " + "WHERE Quote_ID = @Quote_ID"); updateCmd.Connection = insertConnection; System.Data.SqlClient.SqlParameterCollection param = updateCmd.Parameters; // // Add new SqlParameters to the command. // param.AddWithValue("Open_Quote", newQuote.OpenQuote); param.AddWithValue("Customer_Name", newQuote.CustomerName); param.AddWithValue("OEM_Name", newQuote.OEMName); param.AddWithValue("Qty", newQuote.Qty); param.AddWithValue("Quote_Num", newQuote.QuoteNumber); param.AddWithValue("Fab_Drawing_Num", newQuote.FdNumber); param.AddWithValue("Rfq_Num", newQuote.RfqNumber); param.AddWithValue("Rev_Num", newQuote.RevNumber); adapter.UpdateCommand = updateCmd; adapter.Update(mds.Tables[0]); mds.AcceptChanges(); } } catch (Exception ex) { MessageBox.Show(ex.Message); } } Thanks in advance to anyone who can help, I really appreciate it, Andrew

    Read the article

  • problems in trying ieee 802.15.4 working from msk

    - by asel
    Hi, i took a msk code from dsplog.com and tried to modify it to test the ieee 802.15.4. There are several links on that site for ieee 802.15.4. Currently I am getting simulated ber results all approximately same for all the cases of Eb_No values. Can you help me to find why? thanks in advance! clear PN = [ 1 1 0 1 1 0 0 1 1 1 0 0 0 0 1 1 0 1 0 1 0 0 1 0 0 0 1 0 1 1 1 0; 1 1 1 0 1 1 0 1 1 0 0 1 1 1 0 0 0 0 1 1 0 1 0 1 0 0 1 0 0 0 1 0; 0 0 1 0 1 1 1 0 1 1 0 1 1 0 0 1 1 1 0 0 0 0 1 1 0 1 0 1 0 0 1 0; 0 0 1 0 0 0 1 0 1 1 1 0 1 1 0 1 1 0 0 1 1 1 0 0 0 0 1 1 0 1 0 1; 0 1 0 1 0 0 1 0 0 0 1 0 1 1 1 0 1 1 0 1 1 0 0 1 1 1 0 0 0 0 1 1; 0 0 1 1 0 1 0 1 0 0 1 0 0 0 1 0 1 1 1 0 1 1 0 1 1 0 0 1 1 1 0 0; 1 1 0 0 0 0 1 1 0 1 0 1 0 0 1 0 0 0 1 0 1 1 1 0 1 1 0 1 1 0 0 1; 1 0 0 1 1 1 0 0 0 0 1 1 0 1 0 1 0 0 1 0 0 0 1 0 1 1 1 0 1 1 0 1; 1 0 0 0 1 1 0 0 1 0 0 1 0 1 1 0 0 0 0 0 0 1 1 1 0 1 1 1 1 0 1 1; 1 0 1 1 1 0 0 0 1 1 0 0 1 0 0 1 0 1 1 0 0 0 0 0 0 1 1 1 0 1 1 1; 0 1 1 1 1 0 1 1 1 0 0 0 1 1 0 0 1 0 0 1 0 1 1 0 0 0 0 0 0 1 1 1; 0 1 1 1 0 1 1 1 1 0 1 1 1 0 0 0 1 1 0 0 1 0 0 1 0 1 1 0 0 0 0 0; 0 0 0 0 0 1 1 1 0 1 1 1 1 0 1 1 1 0 0 0 1 1 0 0 1 0 0 1 0 1 1 0; 0 1 1 0 0 0 0 0 0 1 1 1 0 1 1 1 1 0 1 1 1 0 0 0 1 1 0 0 1 0 0 1; 1 0 0 1 0 1 1 0 0 0 0 0 0 1 1 1 0 1 1 1 1 0 1 1 1 0 0 0 1 1 0 0; 1 1 0 0 1 0 0 1 0 1 1 0 0 0 0 0 0 1 1 1 0 1 1 1 1 0 1 1 1 0 0 0; ]; N = 5*10^5; % number of bits or symbols fsHz = 1; % sampling period T = 4; % symbol duration Eb_N0_dB = [0:10]; % multiple Eb/N0 values ct = cos(pi*[-T:N*T-1]/(2*T)); st = sin(pi*[-T:N*T-1]/(2*T)); for ii = 1:length(Eb_N0_dB) tx = []; % MSK Transmitter ipBit = round(rand(1,N/32)*15); for k=1:length(ipBit) sym = ipBit(k); tx = [tx PN((sym+1),1:end)]; end ipMod = 2*tx - 1; % BPSK modulation 0 -> -1, 1 -> 1 ai = kron(ipMod(1:2:end),ones(1,2*T)); % even bits aq = kron(ipMod(2:2:end),ones(1,2*T)); % odd bits ai = [ai zeros(1,T) ]; % padding with zero to make the matrix dimension match aq = [zeros(1,T) aq ]; % adding delay of T for Q-arm % MSK transmit waveform xt = 1/sqrt(T)*[ai.*ct + j*aq.*st]; % Additive White Gaussian Noise nt = 1/sqrt(2)*[randn(1,N*T+T) + j*randn(1,N*T+T)]; % white gaussian noise, 0dB variance % Noise addition yt = xt + 10^(-Eb_N0_dB(ii)/20)*nt; % additive white gaussian noise % MSK receiver % multiplying with cosine and sine waveforms xE = conv(real(yt).*ct,ones(1,2*T)); xO = conv(imag(yt).*st,ones(1,2*T)); bHat = zeros(1,N); bHat(1:2:end) = xE(2*T+1:2*T:end-2*T); % even bits bHat(2:2:end) = xO(3*T+1:2*T:end-T); % odd bits result=zeros(16,1); chiplen=32; seqstart=1; recovered = []; while(seqstart<length(bHat)) A = bHat(seqstart:seqstart+(chiplen-1)); for j=1:16 B = PN(j,1:end); result(j)=sum(A.*B); end [value,index] = max(result); recovered = [recovered (index-1)]; seqstart = seqstart+chiplen; end; %# create binary string - the 4 forces at least 4 bits bstr1 = dec2bin(ipBit,4); bstr2 = dec2bin(recovered,4); %# convert back to numbers (reshape so that zeros are preserved) out1 = str2num(reshape(bstr1',[],1))'; out2 = str2num(reshape(bstr2',[],1))'; % counting the errors nErr(ii) = size(find([out1 - out2]),2); end nErr/(length(ipBit)*4) % simulated ber theoryBer = 0.5*erfc(sqrt(10.^(Eb_N0_dB/10))) % theoretical ber

    Read the article

  • create new inbox folder and save emails

    - by kasunmit
    i am trying http://www.c-sharpcorner.com/uploadfile/rambab/outlookintegration10282006032802am/outlookintegration.aspx[^] this code for create inbox personal folder and save same mails at the datagrid view (outlook 2007 and vsto 2008) i am able to create inbox folder according to above example but couldn't wire code for save e-mails at that example to save contect they r using following code if (chkVerify.Checked) { OutLook._Application outlookObj = new OutLook.Application(); MyContact cntact = new MyContact(); cntact.CustomProperty = txtProp1.Text.Trim().ToString(); //CREATING CONTACT ITEM OBJECT AND FINDING THE CONTACT ITEM OutLook.ContactItem newContact = (OutLook.ContactItem)FindContactItem(cntact, CustomFolder); //THE VALUES WE CAN GET FROM WEB SERVICES OR DATA BASE OR CLASS. WE HAVE TO ASSIGN THE VALUES //TO OUTLOOK CONTACT ITEM OBJECT . if (newContact != null) { newContact.FirstName = txtFirstName.Text.Trim().ToString(); newContact.LastName = txtLastName.Text.Trim().ToString(); newContact.Email1Address = txtEmail.Text.Trim().ToString(); newContact.Business2TelephoneNumber = txtPhone.Text.Trim().ToString(); newContact.BusinessAddress = txtAddress.Text.Trim().ToString(); if (chkAdd.Checked) { //HERE WE CAN CREATE OUR OWN CUSTOM PROPERTY TO IDENTIFY OUR APPLICATION. if(string.IsNullOrEmpty(txtProp1.Text.Trim().ToString())) { MessageBox.Show("please add value to Your Custom Property"); return; } newContact.UserProperties.Add("myPetName", OutLook.OlUserPropertyType.olText, true, OutLook.OlUserPropertyType.olText); newContact.UserProperties["myPetName"].Value = txtProp1.Text.Trim().ToString(); } newContact.Save(); this.Close(); } else { //IF THE CONTACT DOES NOT EXIST WITH SAME CUSTOM PROPERTY CREATES THE CONTACT. newContact = (OutLook.ContactItem)CustomFolder.Items.Add(OutLook.OlItemType.olContactItem); newContact.FirstName = txtFirstName.Text.Trim().ToString(); newContact.LastName = txtLastName.Text.Trim().ToString(); newContact.Email1Address = txtEmail.Text.Trim().ToString(); newContact.Business2TelephoneNumber = txtPhone.Text.Trim().ToString(); newContact.BusinessAddress = txtAddress.Text.Trim().ToString(); if (chkAdd.Checked) { //HERE WE CAN CREATE OUR OWN CUSTOM PROPERTY TO IDENTIFY OUR APPLICATION. if (string.IsNullOrEmpty(txtProp1.Text.Trim().ToString())) { MessageBox.Show("please add value to Your Custom Property"); return; } newContact.UserProperties.Add("myPetName", OutLook.OlUserPropertyType.olText, true, OutLook.OlUserPropertyType.olText); newContact.UserProperties["myPetName"].Value = txtProp1.Text.Trim().ToString(); } newContact.Save(); this.Close(); } } else { OutLook._Application outlookObj = new OutLook.Application(); OutLook.ContactItem newContact = (OutLook.ContactItem)CustomFolder.Items.Add(OutLook.OlItemType.olContactItem); newContact.FirstName = txtFirstName.Text.Trim().ToString(); newContact.LastName = txtLastName.Text.Trim().ToString(); newContact.Email1Address = txtEmail.Text.Trim().ToString(); newContact.Business2TelephoneNumber = txtPhone.Text.Trim().ToString(); newContact.BusinessAddress = txtAddress.Text.Trim().ToString(); if (chkAdd.Checked) { //HERE WE CAN CREATE OUR OWN CUSTOM PROPERTY TO IDENTIFY OUR APPLICATION. if (string.IsNullOrEmpty(txtProp1.Text.Trim().ToString())) { MessageBox.Show("please add value to Your Custom Property"); return; } newContact.UserProperties.Add("myPetName", OutLook.OlUserPropertyType.olText, true, OutLook.OlUserPropertyType.olText); newContact.UserProperties["myPetName"].Value = txtProp1.Text.Trim().ToString(); } newContact.Save(); this.Close(); } } else { //CREATES THE OUTLOOK CONTACT IN DEFAULT CONTACTS FOLDER. OutLook._Application outlookObj = new OutLook.Application(); OutLook.MAPIFolder fldContacts = (OutLook.MAPIFolder)outlookObj.Session.GetDefaultFolder(OutLook.OlDefaultFolders.olFolderContacts); OutLook.ContactItem newContact = (OutLook.ContactItem)fldContacts.Items.Add(OutLook.OlItemType.olContactItem); //THE VALUES WE CAN GET FROM WEB SERVICES OR DATA BASE OR CLASS. WE HAVE TO ASSIGN THE VALUES //TO OUTLOOK CONTACT ITEM OBJECT . newContact.FirstName = txtFirstName.Text.Trim().ToString(); newContact.LastName = txtLastName.Text.Trim().ToString(); newContact.Email1Address = txtEmail.Text.Trim().ToString(); newContact.Business2TelephoneNumber = txtPhone.Text.Trim().ToString(); newContact.BusinessAddress = txtAddress.Text.Trim().ToString(); newContact.Save(); this.Close(); } } /// /// ENABLING AND DISABLING THE CUSTOM FOLDER AND PROPERY OPTIONS. /// /// /// private void rdoCustom_CheckedChanged(object sender, EventArgs e) { if (rdoCustom.Checked) { txFolder.Enabled = true; chkAdd.Enabled = true; chkVerify.Enabled = true; txtProp1.Enabled = true; } else { txFolder.Enabled = false; chkAdd.Enabled = false; chkVerify.Enabled = false; txtProp1.Enabled = false; } } i don t have idea to convert it to save e-mails in the datagrid view the data gride view i am mentioning here is containing details (sender address, subject etc.) of unread mails and the i i am did was perform some filter for that mails as follows string senderMailAddress = txtMailAddress.Text.ToLower(); List list = (List)dgvUnreadMails.DataSource; List myUnreadMailList; List filteredList = (List)(from ci in list where ci.SenderAddress.StartsWith(senderMailAddress) select ci).ToList(); dgvUnreadMails.DataSource = filteredList; it was done successfully then i need to save those filtered e-mails to that personal inbox folder i created already for that pls give me some help my issue is that how can i assign outlook object just like they assign it to contacts (name, address, e-mail etc.) because in the e-mails we couldn't find it ..

    Read the article

  • LevelToVisibilityConverter in silverligt 4

    - by prince23
    <UserControl x:Class="SLGridImage.MainPage" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:d="http://schemas.microsoft.com/expression/blend/2008" xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006" mc:Ignorable="d" d:DesignHeight="300" d:DesignWidth="400" xmlns:sdk="http://schemas.microsoft.com/winfx/2006/xaml/presentation/sdk"> <UserControl.Resources> <local:LevelToVisibilityConverter x:Key="LevelToVisibility" /> </UserControl.Resources> <Grid x:Name="LayoutRoot" Background="White"> <sdk:DataGrid x:Name="dgMarks" CanUserResizeColumns="False" SelectionMode="Single" AutoGenerateColumns="False" VerticalAlignment="Top" ItemsSource="{Binding MarkCollection}" IsReadOnly="True" Margin="13,44,0,0" RowDetailsVisibilityMode="Collapsed" Height="391" HorizontalAlignment="Left" Width="965" VerticalScrollBarVisibility="Visible" > <sdk:DataGrid.Columns> <sdk:DataGridTemplateColumn> <sdk:DataGridTemplateColumn.CellTemplate> <DataTemplate> <Button x:Name="myButton" Click="myButton_Click"> <StackPanel Orientation="Horizontal"> <Image Margin="2, 2, 2, 2" x:Name="imgMarks" Stretch="Fill" Width="12" Height="12" Source="Images/test.png" VerticalAlignment="Center" HorizontalAlignment="Center" Visibility="{Binding Level, Converter={StaticResource LevelToVisibility}}" /> <TextBlock Text="{Binding Level}" TextWrapping="NoWrap" ></TextBlock> </StackPanel> </Button> </DataTemplate> </sdk:DataGridTemplateColumn.CellTemplate> </sdk:DataGridTemplateColumn> <sdk:DataGridTemplateColumn Header="Name" > <sdk:DataGridTemplateColumn.CellTemplate> <DataTemplate > <Border> <TextBlock Text="{Binding Name}" /> </Border> </DataTemplate> </sdk:DataGridTemplateColumn.CellTemplate> </sdk:DataGridTemplateColumn> <sdk:DataGridTemplateColumn Header="Marks" Width="80"> <sdk:DataGridTemplateColumn.CellTemplate> <DataTemplate> <Border> <TextBlock Text="{Binding Marks}" /> </Border> </DataTemplate> </sdk:DataGridTemplateColumn.CellTemplate> </sdk:DataGridTemplateColumn> </sdk:DataGrid.Columns> </sdk:DataGrid> </Grid> </UserControl> in .cs using System; using System.Collections.Generic; using System.Linq; using System.Net; using System.Windows; using System.Windows.Controls; using System.Windows.Documents; using System.Windows.Input; using System.Windows.Media; using System.Windows.Media.Animation; using System.Windows.Shapes; using System.Collections.ObjectModel; using System.ComponentModel; namespace SLGridImage { public partial class MainPage : UserControl { private MarksViewModel model = new MarksViewModel(); public MainPage() { InitializeComponent(); this.DataContext = model; } private void myButton_Click(object sender, RoutedEventArgs e) { } } public class MarksViewModel : INotifyPropertyChanged { public MarksViewModel() { markCollection.Add(new Mark() { Name = "ABC", Marks = 23, Level = 0 }); markCollection.Add(new Mark() { Name = "XYZ", Marks = 67, Level = 1 }); markCollection.Add(new Mark() { Name = "YU", Marks = 56, Level = 0 }); markCollection.Add(new Mark() { Name = "AAA", Marks = 89, Level = 1 }); } private ObservableCollection<Mark> markCollection = new ObservableCollection<Mark>(); public ObservableCollection<Mark> MarkCollection { get { return this.markCollection; } set { this.markCollection = value; OnPropertyChanged("MarkCollection"); } } public event PropertyChangedEventHandler PropertyChanged; public void OnPropertyChanged(string propName) { if (PropertyChanged != null) this.PropertyChanged(this, new PropertyChangedEventArgs(propName)); } } public class Mark { public string Name { get; set; } public int Marks { get; set; } public int Level { get; set; } } public class LevelToVisibilityConverter : System.Windows.Data.IValueConverter { #region IValueConverter Members public object Convert(object value, Type targetType, object parameter, System.Globalization.CultureInfo culture) { Visibility isVisible = Visibility.Collapsed; if ((value == null)) return isVisible; int condition = (int)value; isVisible = condition == 1 ? Visibility.Visible : Visibility.Collapsed; return isVisible; } public object ConvertBack(object value, Type targetType, object parameter, System.Globalization.CultureInfo culture) { throw new NotImplementedException(); } #endregion } } when i run getting error The type 'local:LevelToVisibilityConverter' was not found. Verify that you are not missing an assembly reference and that all referenced assemblies have been built. what i am i missing here looking forward for an solution thank you

    Read the article

  • wcf rest service 400 error : There might be a typing error in the address

    - by Lokesh Kondapalli
    I am trying to invoke wcf rest service from url but its showing error like this Error : Most likely causes: •There might be a typing error in the address. •If you clicked on a link, it may be out of date. ** I need JSON responce Here my code : Iservice.cs using System; using System.Collections.Generic; using System.Linq; using System.Runtime.Serialization; using System.ServiceModel; using System.ServiceModel.Web; using System.Text; namespace SampleRestSample { interface name "IService1" in both code and config file together. [ServiceContract] public interface IService1 { [OperationContract] [WebInvoke(Method = "GET", UriTemplate = "Book/{id}", BodyStyle = WebMessageBodyStyle.Wrapped, ResponseFormat = WebMessageFormat.Json)] List<Prasad> GetBookById(string id); } [DataContract] public class Prasad { [DataMember] public string Name { get; set; } [DataMember] public string Age { get; set; } } } Service1.svc.cs using System; using System.Collections.Generic; using System.Linq; using System.Runtime.Serialization; using System.ServiceModel; using System.ServiceModel.Web; using System.Text; namespace LoginRestSample { // NOTE: You can use the "Rename" command on the "Refactor" menu to change the class name "Service1" in code, svc and config file together. public class Service1 : SampleRestSample { List<Prasad> list = new List<Prasad>(); public List<Prasad> GetBookById(string id) { try { Prasad cls = new Prasad(); cls.Age = "24"; cls.Name = "prasad"; list.Add(cls); //int bookId = Convert.ToInt32(id); //using (SampleDbEntities entities = new SampleDbEntities()) //{ // return entities.Books.SingleOrDefault(book => book.ID == bookId); //} } catch { throw new FaultException("Something went wrong"); } return list; } } } web.config <?xml version="1.0" encoding="utf-8"?> <configuration> <system.web> <compilation debug="true" targetFramework="4.0"> <assemblies> <add assembly="System.Data.Entity, Version=4.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089" /> </assemblies> </compilation> </system.web> <system.serviceModel> <services> <service name="WcfRestSample.SampleRestSample"> <endpoint address="" behaviorConfiguration="restfulBehavior" binding="webHttpBinding" bindingConfiguration="" contract="WcfRestSample.ISampleRestSample" /> <host> <baseAddresses> <add baseAddress="http://localhost/SampleRestSample" /> </baseAddresses> </host> </service> </services> <behaviors> <endpointBehaviors> <behavior name="restfulBehavior"> <webHttp automaticFormatSelectionEnabled="true" /> </behavior> </endpointBehaviors> <serviceBehaviors> <behavior name=""> <serviceMetadata httpGetEnabled="true" /> <serviceDebug includeExceptionDetailInFaults="false" /> </behavior> </serviceBehaviors> </behaviors> <serviceHostingEnvironment multipleSiteBindingsEnabled="true" /> </system.serviceModel> <system.webServer> <modules runAllManagedModulesForAllRequests="true" /> </system.webServer> </configuration> Any solutions? Thank you in advance.

    Read the article

  • Sorting/Paginating/Filtering Complex Multi-AR Object Tables in Rails

    - by Matt Rogish
    I have a complex table pulled from a multi-ActiveRecord object array. This listing is a combined display of all of a particular user's "favorite" items (songs, messages, blog postings, whatever). Each of these items is a full-fledged AR object. My goal is to present the user with a simplified search, sort, and pagination interface. The user need not know that the Song has a singer, and that the Message has an author -- to the end user both entries in the table will be displayed as "User". Thus, the search box will simply be a dropdown list asking them which to search on (User name, created at, etc.). Internally, I would need to convert that to the appropriate object search, combine the results, and display. I can, separately, do pagination (mislav will_paginate), sorting, and filtering, but together I'm having some problems combining them. For example, if I paginate the combined list of items, the pagination plugin handles it just fine. It is not efficient since the pagination is happening in the app vs. the DB, but let's assume the intended use-case would indicate the vast majority of the users will have less than 30 favorited items and all other behavior, server capabilities, etc. indicates this will not be a bottleneck. However, if I wish to sort the list I cannot sort it via the pagination plugin because it relies on the assumption that the result set is derived from a single SQL query, and also that the field name is consistent throughout. Thus, I must sort the merged array via ruby, e.g. @items.sort_by{ |i| i.whatever } But, since the items do not share common names, I must first interrogate the object and then call the correct sort by. For example, if the user wishes to sort by user name, if the sorted object is a message, I sort by author but if the object is a song, I sort by singer. This is all very gross and feels quite un-ruby-like. This same problem comes into play with the filter. If the user filters on the "parent item" (the message's thread, the song's album), I must translate that to the appropriate collection object method. Also gross. This is not the exact set-up but is close enough. Note that this is a legacy app so changing it is quite difficult, although not impossible. Also, yes there is some DRY that can be done, but don't focus on the style or elegance of the following code. Style/elegance of the SOLUTION is important, however! :D models: class User < ActiveRecord::Base ... has_and_belongs_to_many :favorite_messages, :class_name => "Message" has_and_belongs_to_many :favorite_songs, :class_name => "Song" has_many :authored_messages, :class_name => "Message" has_many :sung_songs, :class_name => "Song" end class Message < ActiveRecord::Base has_and_belongs_to_many :favorite_messages belongs_to :author, :class_name => "User" belongs_to :thread end class Song < ActiveRecord::Base has_and_belongs_to_many :favorite_songs belongs_to :singer, :class_name => "User" belongs_to :album end controller: def show u = User.find 123 @items = Array.new @items << u.favorite_messages @items << u.favorite_songs # etc. etc. @items.flatten! @items = @items.sort_by{ |i| i.created_at } @items = @items.paginate :page => params[:page], :per_page => 20 end def search # Assume user is searching for username like 'Bob' u = User.find 123 @items = Array.new @items << u.favorite_messages.find( :all, :conditions => "LOWER( author ) LIKE LOWER('%bob%')" ) @items << u.favorite_songs.find( :all, :conditions => "LOWER( singer ) LIKE ... " ) # etc. etc. @items.flatten! @items = @items.sort_by{ |i| determine appropriate sorting based on user selection } @items = @items.paginate :page => params[:page], :per_page => 20 end view: #index.html.erb ... <table> <tr> <th>Title (sort ASC/DESC links)</th> <th>Created By (sort ASC/DESC links))</th> <th>Collection Title (sort ASC/DESC links)</th> <th>Created At (sort ASC/DESC links)</th> </tr> <% @items.each |item| do %> <%= render { :partial => "message", :locals => item } if item.is_a? Message %> <%= render { :partial => "song", :locals => item } if item.is_a? Song %> <%end%> ... </table> #message.html.erb # shorthand, not real ruby print out message title, author name, thread title, message created at #song.html.erb # shorthand print out song title, singer name, album title, song created at

    Read the article

  • Getting a NullPointerException at seemingly random intervals, not sure why

    - by Miles
    I'm running an example from a Kinect library for Processing (http://www.shiffman.net/2010/11/14/kinect-and-processing/) and sometimes get a NullPointerException pointing to this line: int rawDepth = depth[offset]; The depth array is created in this line: int[] depth = kinect.getRawDepth(); I'm not exactly sure what a NullPointerException is, and much googling hasn't really helped. It seems odd to me that the code compiles 70% of the time and returns the error unpredictably. Could the hardware itself be affecting it? Here's the whole example if it helps: // Daniel Shiffman // Kinect Point Cloud example // http://www.shiffman.net // https://github.com/shiffman/libfreenect/tree/master/wrappers/java/processing import org.openkinect.*; import org.openkinect.processing.*; // Kinect Library object Kinect kinect; float a = 0; // Size of kinect image int w = 640; int h = 480; // We'll use a lookup table so that we don't have to repeat the math over and over float[] depthLookUp = new float[2048]; void setup() { size(800,600,P3D); kinect = new Kinect(this); kinect.start(); kinect.enableDepth(true); // We don't need the grayscale image in this example // so this makes it more efficient kinect.processDepthImage(false); // Lookup table for all possible depth values (0 - 2047) for (int i = 0; i < depthLookUp.length; i++) { depthLookUp[i] = rawDepthToMeters(i); } } void draw() { background(0); fill(255); textMode(SCREEN); text("Kinect FR: " + (int)kinect.getDepthFPS() + "\nProcessing FR: " + (int)frameRate,10,16); // Get the raw depth as array of integers int[] depth = kinect.getRawDepth(); // We're just going to calculate and draw every 4th pixel (equivalent of 160x120) int skip = 4; // Translate and rotate translate(width/2,height/2,-50); rotateY(a); for(int x=0; x<w; x+=skip) { for(int y=0; y<h; y+=skip) { int offset = x+y*w; // Convert kinect data to world xyz coordinate int rawDepth = depth[offset]; PVector v = depthToWorld(x,y,rawDepth); stroke(255); pushMatrix(); // Scale up by 200 float factor = 200; translate(v.x*factor,v.y*factor,factor-v.z*factor); // Draw a point point(0,0); popMatrix(); } } // Rotate a += 0.015f; } // These functions come from: http://graphics.stanford.edu/~mdfisher/Kinect.html float rawDepthToMeters(int depthValue) { if (depthValue < 2047) { return (float)(1.0 / ((double)(depthValue) * -0.0030711016 + 3.3309495161)); } return 0.0f; } PVector depthToWorld(int x, int y, int depthValue) { final double fx_d = 1.0 / 5.9421434211923247e+02; final double fy_d = 1.0 / 5.9104053696870778e+02; final double cx_d = 3.3930780975300314e+02; final double cy_d = 2.4273913761751615e+02; PVector result = new PVector(); double depth = depthLookUp[depthValue];//rawDepthToMeters(depthValue); result.x = (float)((x - cx_d) * depth * fx_d); result.y = (float)((y - cy_d) * depth * fy_d); result.z = (float)(depth); return result; } void stop() { kinect.quit(); super.stop(); } And here are the errors: processing.app.debug.RunnerException: NullPointerException at processing.app.Sketch.placeException(Sketch.java:1543) at processing.app.debug.Runner.findException(Runner.java:583) at processing.app.debug.Runner.reportException(Runner.java:558) at processing.app.debug.Runner.exception(Runner.java:498) at processing.app.debug.EventThread.exceptionEvent(EventThread.java:367) at processing.app.debug.EventThread.handleEvent(EventThread.java:255) at processing.app.debug.EventThread.run(EventThread.java:89) Exception in thread "Animation Thread" java.lang.NullPointerException at org.openkinect.processing.Kinect.enableDepth(Kinect.java:70) at PointCloud.setup(PointCloud.java:48) at processing.core.PApplet.handleDraw(PApplet.java:1583) at processing.core.PApplet.run(PApplet.java:1503) at java.lang.Thread.run(Thread.java:637)

    Read the article

  • Passing a comparator syntax help in Java

    - by Crystal
    I've tried this a couple ways, the first is have a class that implements comparator at the bottom of the following code. When I try to pass the comparat in sortListByLastName, I get a constructor not found error and I am not sure why import java.util.*; public class OrganizeThis implements WhoDoneIt { /** Add a person to the organizer @param p A person object */ public void add(Person p) { staff.put(p.getEmail(), p); //System.out.println("Person " + p + "added"); } /** * Remove a Person from the organizer. * * @param email The email of the person to be removed. */ public void remove(String email) { staff.remove(email); } /** * Remove all contacts from the organizer. * */ public void empty() { staff.clear(); } /** * Find the person stored in the organizer with the email address. * Note, each person will have a unique email address. * * @param email The person email address you are looking for. * */ public Person findByEmail(String email) { Person aPerson = staff.get(email); return aPerson; } /** * Find all persons stored in the organizer with the same last name. * Note, there can be multiple persons with the same last name. * * @param lastName The last name of the persons your are looking for. * */ public Person[] find(String lastName) { ArrayList<Person> names = new ArrayList<Person>(); for (Person s : staff.values()) { if (s.getLastName() == lastName) { names.add(s); } } // Convert ArrayList back to Array Person nameArray[] = new Person[names.size()]; names.toArray(nameArray); return nameArray; } /** * Return all the contact from the orgnizer in * an array sorted by last name. * * @return An array of Person objects. * */ public Person[] getSortedListByLastName() { PersonLastNameComparator comp = new PersonLastNameComparator(); Map<String, Person> sorted = new TreeMap<String, Person>(comp); ArrayList<Person> sortedArrayList = new ArrayList<Person>(); for (Person s: sorted.values()) { sortedArrayList.add(s); } Person sortedArray[] = new Person[sortedArrayList.size()]; sortedArrayList.toArray(sortedArray); return sortedArray; } private Map<String, Person> staff = new HashMap<String, Person>(); public static void main(String[] args) { OrganizeThis testObj = new OrganizeThis(); Person person1 = new Person("J", "W", "111-222-3333", "[email protected]"); Person person2 = new Person("K", "W", "345-678-9999", "[email protected]"); Person person3 = new Person("Phoebe", "Wang", "322-111-3333", "[email protected]"); Person person4 = new Person("Nermal", "Johnson", "322-342-5555", "[email protected]"); Person person5 = new Person("Apple", "Banana", "123-456-1111", "[email protected]"); testObj.add(person1); testObj.add(person2); testObj.add(person3); testObj.add(person4); testObj.add(person5); System.out.println(testObj.findByEmail("[email protected]")); System.out.println("------------" + '\n'); Person a[] = testObj.find("W"); for (Person p : a) System.out.println(p); System.out.println("------------" + '\n'); a = testObj.find("W"); for (Person p : a) System.out.println(p); System.out.println("SORTED" + '\n'); a = testObj.getSortedListByLastName(); for (Person b : a) { System.out.println(b); } System.out.println(testObj.getAuthor()); } } class PersonLastNameComparator implements Comparator<Person> { public int compare(Person a, Person b) { return a.getLastName().compareTo(b.getLastName()); } } And then when I tried doing it by creating an anonymous inner class, I also get a constructor TreeMap cannot find symbol error. Any thoughts? inner class method: public Person[] getSortedListByLastName() { //PersonLastNameComparator comp = new PersonLastNameComparator(); Map<String, Person> sorted = new TreeMap<String, Person>(new Comparator<Person>() { public int compare(Person a, Person b) { return a.getLastName().compareTo(b.getLastName()); } }); ArrayList<Person> sortedArrayList = new ArrayList<Person>(); for (Person s: sorted.values()) { sortedArrayList.add(s); } Person sortedArray[] = new Person[sortedArrayList.size()]; sortedArrayList.toArray(sortedArray); return sortedArray; }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • DotNetNuke + XPath = Custom navigation menu DNNMenu HTML render

    - by Rui Santos
    I'm developing a skin for DotNetNuke 5 using the Component DNN Done Right menu by Mark Alan which uses XSL-T to convert the XML sitemap into an HTML navigation. The XML sitemap outputs the following structure: <Root > <root > <node id="40" text="Home" url="http://localhost/dnn/Home.aspx" enabled="1" selected="0" breadcrumb="0" first="1" last="0" only="0" depth="0" > <node id="58" text="Child1" url="http://localhost/dnn/Home/Child1.aspx" enabled="1" selected="0" breadcrumb="0" first="1" last="0" only="0" depth="1" > <keywords >Child1</keywords> <description >Child1</description> <node id="59" text="Child1 SubItem1" url="http://localhost/dnn/Home/Child1/Child1SubItem1.aspx" enabled="1" selected="0" breadcrumb="0" first="1" last="0" only="0" depth="2" > <keywords >Child1 SubItem1</keywords> <description >Child1 SubItem1</description> </node> <node id="60" text="Child1 SubItem2" url="http://localhost/dnn/Home/Child1/Child1SubItem2.aspx" enabled="1" selected="0" breadcrumb="0" first="0" last="0" only="0" depth="2" > <keywords >Child1 SubItem2</keywords> <description >Child1 SubItem2</description> </node> <node id="61" text="Child1 SubItem3" url="http://localhost/dnn/Home/Child1/Child1SubItem3.aspx" enabled="1" selected="0" breadcrumb="0" first="0" last="1" only="0" depth="2" > <keywords >Child1 SubItem3</keywords> <description >Child1 SubItem3</description> </node> </node> <node id="65" text="Child2" url="http://localhost/dnn/Home/Child2.aspx" enabled="1" selected="0" breadcrumb="0" first="0" last="1" only="0" depth="1" > <keywords >Child2</keywords> <description >Child2</description> <node id="66" text="Child2 SubItem1" url="http://localhost/dnn/Home/Child2/Child2SubItem1.aspx" enabled="1" selected="0" breadcrumb="0" first="1" last="0" only="0" depth="2" > <keywords >Child2 SubItem1</keywords> <description >Child2 SubItem1</description> </node> <node id="67" text="Child2 SubItem2" url="http://localhost/dnn/Home/Child2/Child2SubItem2.aspx" enabled="1" selected="0" breadcrumb="0" first="0" last="1" only="0" depth="2" > <keywords >Child2 SubItem2</keywords> <description >Child2 SubItem2</description> </node> </node> </node> </root> </Root> My Goal is to render this XML block into this HTML Navigation structure only using UL's LI's, etc.. <ul id="topnav"> <li> <a href="#" class="home">Home</a> <!-- Parent Node - Depth0 --> <div class="sub"> <ul> <li><h2><a href="#">Child1</a></h2></li> <!-- Parent Node 1 - Depth1 --> <li><a href="#">Child1 SubItem1</a></li> <!-- ChildNode - Depth2 --> <li><a href="#">Child1 SubItem2</a></li> <!-- ChildNode - Depth2 --> <li><a href="#">Child1 SubItem3</a></li ><!-- ChildNode - Depth2 --> </ul> <ul> <li><h2><a href="#">Child2</a></h2></li> <!-- Parent Node 2 - Depth1 --> <li><a href="#">Child2 SubItem1</a></li> <!-- ChildNode - Depth2 --> <li><a href="#">Child2 SubItem2</a></li> <!-- ChildNode - Depth2 --> </ul> </div> </li> </ul> Can anyone help with the XSL coding? I'm just starting now with XSL..

    Read the article

  • Fastest way to parse XML files in C#?

    - by LifeH2O
    I have to load many XML files from internet. But for testing with better speed i downloaded all of them (more than 500 files) of the following format. <player-profile> <personal-information> <id>36</id> <fullname>Adam Gilchrist</fullname> <majorteam>Australia</majorteam> <nickname>Gilchrist</nickname> <shortName>A Gilchrist</shortName> <dateofbirth>Nov 14, 1971</dateofbirth> <battingstyle>Left-hand bat</battingstyle> <bowlingstyle>Right-arm offbreak</bowlingstyle> <role>Wicket-Keeper</role> <teams-played-for>Western Australia, New South Wales, ICC World XI, Deccan Chargers, Australia</teams-played-for> <iplteam>Deccan Chargers</iplteam> </personal-information> <batting-statistics> <odi-stats> <matchtype>ODI</matchtype> <matches>287</matches> <innings>279</innings> <notouts>11</notouts> <runsscored>9619</runsscored> <highestscore>172</highestscore> <ballstaken>9922</ballstaken> <sixes>149</sixes> <fours>1000+</fours> <ducks>0</ducks> <fifties>55</fifties> <catches>417</catches> <stumpings>55</stumpings> <hundreds>16</hundreds> <strikerate>96.95</strikerate> <average>35.89</average> </odi-stats> <test-stats> . . . </test-stats> <t20-stats> . . . </t20-stats> <ipl-stats> . . . </ipl-stats> </batting-statistics> <bowling-statistics> <odi-stats> . . . </odi-stats> <test-stats> . . . </test-stats> <t20-stats> . . . </t20-stats> <ipl-stats> . . . </ipl-stats> </bowling-statistics> </player-profile> I am using XmlNodeList list = _document.SelectNodes("/player-profile/batting-statistics/odi-stats"); And then loop this list with foreach as foreach (XmlNode stats in list) { _btMatchType = GetInnerString(stats, "matchtype"); //it returns null string if node not availible . . . . _btAvg = Convert.ToDouble(stats["average"].InnerText); } Even i am loading all files offline, parsing is very slow Is there any good faster way to parse them? Or is it problem with SQL? I am saving all extracted data from XML to database using DataSets, TableAdapters with insert command. I

    Read the article

  • Converting LDAP from Tomcat to GlassFish

    - by Jon
    Hi, I have a simple web-app that is developed in Netbeans(6.8) and works fine in Tomcat(6) using LDAP(Active Directory). I need to convert this to an EE (JSF2), so I am moving from Tomcat to GlassFish(v3). I have changed the web files to xhtml and configured the xml files. However, I cannot get the GlassFish LDAP configuration to authenticate. I am attaching my old web.xml and server.xml (from Tomcat) snippets and the portions of the new web.xml, sun-web.xml, and the GlassFish configuration. If anyone can help me figure out where I am missing the piece that will allow a user to be authenticated, I would appreciate it. (btw, I am not using roles, just authenticating against the LDAP db is good enought.) As it is right now, my app will prompt me to enter a user when I try to access a file in the 'protected' area and the GlassFish server throws an exception when it fails to authenticate. Because it works under Tomcat, I know I have the right information, I just don't know how to format it to get GlassFish to pass it along. Thanks. TOMCAT FILES: - Tomcat server.xml: web.xml: <web-resource-collection> <web-resource-name>Protected Area</web-resource-name> <description>Authentication Required</description> <url-pattern>/faces/protected/*</url-pattern> </web-resource-collection> <auth-constraint> <role-name>*</role-name> </auth-constraint> * BASIC Please enter your user name and password: GLASSFISH FILES: (I enabled the Security Manager on the Security panel, set the Default Realm to 'LDAPRealm', and added "-Djava.naming.referral=follow" JVM options.) - domain.xml: <auth-realm name="certificate" classname="com.sun.enterprise.security.auth.realm.certificate.CertificateRealm" /> <auth-realm classname="com.sun.enterprise.security.auth.realm.ldap.LDAPRealm" name="LdapRealm"> <property description="()" name="search-bind-password" value="xxxxxxxx" /> <property description="()" name="search-bind-dn" value="cn=xxxxxxxx,ou=Administrators,ou=Information Technology,ou=ITTS,ou=Administrative,ou=xxx,dc=xxxxxx,dc=xxx" /> <property name="jaas-context" value="ldapRealm" /> <property name="base-dn" value="ou=xxx,dc=xxxxxx,dc=xxx" /> <property name="directory" value="ldap://xxxx.xxxxxx.xxx:389" /> <property name="search-filter" value="(&amp;(objectClass=user)(sAMAccountName=%s))" /> </auth-realm> -web.xml: <security-constraint> <display-name>protected</display-name> <web-resource-collection> <web-resource-name>ProtectedArea</web-resource-name> <description/> <url-pattern>/faces/protected/*</url-pattern> </web-resource-collection> <auth-constraint> <description/> <role-name>*</role-name> </auth-constraint> </security-constraint> <security-role> <description/> <role-name>*</role-name> </security-role> <login-config> <auth-method>FORM</auth-method> <realm-name>LDAPRealm</realm-name> <form-login-config> <form-login-page>/faces/login.xhtml</form-login-page> <form-error-page>/faces/loginError.xhtml</form-error-page> </form-login-config> </login-config> sun-web.xml: Here is the exception that it throws: SEVERE: SEC1113: Exception in LdapRealm when trying to authenticate user. javax.security.auth.login.LoginException: javax.security.auth.login.LoginException: User yyyyyyy not found. at com.sun.enterprise.security.auth.realm.ldap.LDAPRealm.findAndBind(LDAPRealm.java:450)

    Read the article

  • Linux C: "Interactive session" with separate read and write named pipes?

    - by ~sd-imi
    Hi all, I am trying to work with "Introduction to Interprocess Communication Using Named Pipes - Full-Duplex Communication Using Named Pipes", http://developers.sun.com/solaris/articles/named_pipes.html#5 ; in particular fd_server.c (included below for reference) Here is my info and compile line: :~$ cat /etc/issue Ubuntu 10.04 LTS \n \l :~$ gcc --version gcc (Ubuntu 4.4.3-4ubuntu5) 4.4.3 :~$ gcc fd_server.c -o fd_server fd_server.c creates two named pipes, one for reading and one for writing. What one can do, is: in one terminal, run the server and read (through cat) its write pipe: :~$ ./fd_server & 2/dev/null [1] 11354 :~$ cat /tmp/np2 and in another, write (using echo) to server's read pipe: :~$ echo "heeellloooo" /tmp/np1 going back to first terminal, one can see: :~$ cat /tmp/np2 HEEELLLOOOO 0[1]+ Exit 13 ./fd_server 2 /dev/null What I would like to do, is make sort of a "interactive" (or "shell"-like) session; that is, the server is run as usual, but instead of running "cat" and "echo", I'd like to use something akin to screen. What I mean by that, is that screen can be called like screen /dev/ttyS0 38400, and then it makes a sort of a interactive session, where what is typed in terminal is passed to /dev/ttyS0, and its response is written to terminal. Now, of course, I cannot use screen, because in my case the program has two separate nodes, and as far as I can tell, screen can refer to only one. How would one go about to achieve this sort of "interactive" session in this context (with two separate read/write pipes)? Thanks, Cheers! Code below: #include <stdio.h> #include <errno.h> #include <ctype.h> #include <sys/types.h> #include <sys/stat.h> #include <fcntl.h> //#include <fullduplex.h> /* For name of the named-pipe */ #define NP1 "/tmp/np1" #define NP2 "/tmp/np2" #define MAX_BUF_SIZE 255 #include <stdlib.h> //exit #include <string.h> //strlen int main(int argc, char *argv[]) { int rdfd, wrfd, ret_val, count, numread; char buf[MAX_BUF_SIZE]; /* Create the first named - pipe */ ret_val = mkfifo(NP1, 0666); if ((ret_val == -1) && (errno != EEXIST)) { perror("Error creating the named pipe"); exit (1); } ret_val = mkfifo(NP2, 0666); if ((ret_val == -1) && (errno != EEXIST)) { perror("Error creating the named pipe"); exit (1); } /* Open the first named pipe for reading */ rdfd = open(NP1, O_RDONLY); /* Open the second named pipe for writing */ wrfd = open(NP2, O_WRONLY); /* Read from the first pipe */ numread = read(rdfd, buf, MAX_BUF_SIZE); buf[numread] = '0'; fprintf(stderr, "Full Duplex Server : Read From the pipe : %sn", buf); /* Convert to the string to upper case */ count = 0; while (count < numread) { buf[count] = toupper(buf[count]); count++; } /* * Write the converted string back to the second * pipe */ write(wrfd, buf, strlen(buf)); } Edit: Right, just to clarify - it seems I found a document discussing something very similar, it is http://en.wikibooks.org/wiki/Serial_Programming/Serial_Linux#Configuration_with_stty - a modification of the script there ("For example, the following script configures the device and starts a background process for copying all received data from the serial device to standard output...") for the above program is below: # stty raw # ( ./fd_server 2>/dev/null; )& bgPidS=$! ( cat < /tmp/np2 ; )& bgPid=$! # Read commands from user, send them to device echo $(kill -0 $bgPidS 2>/dev/null ; echo $?) while [ "$(kill -0 $bgPidS 2>/dev/null ; echo $?)" -eq "0" ] && read cmd; do # redirect debug msgs to stderr, as here we're redirected to /tmp/np1 echo "$? - $bgPidS - $bgPid" >&2 echo "$cmd" echo -e "\nproc: $(kill -0 $bgPidS 2>/dev/null ; echo $?)" >&2 done >/tmp/np1 echo OUT # Terminate background read process - if they still exist if [ "$(kill -0 $bgPid 2>/dev/null ; echo $?)" -eq "0" ] ; then kill $bgPid fi if [ "$(kill -0 $bgPidS 2>/dev/null ; echo $?)" -eq "0" ] ; then kill $bgPidS fi # stty cooked So, saving the script as say starter.sh and calling it, results with the following session: $ ./starter.sh 0 i'm typing here and pressing [enter] at end 0 - 13496 - 13497 I'M TYPING HERE AND PRESSING [ENTER] AT END 0~?.N=?(?~? ?????}????@??????~? [garble] proc: 0 OUT which is what I'd call for "interactive session" (ignoring the debug statements) - server waits for me to enter a command; it gives its output after it receives a command (and as in this case it exits after first command, so does the starter script as well). Except that, I'd like to not have buffered input, but sent character by character (meaning the above session should exit after first key press, and print out a single letter only - which is what I expected stty raw would help with, but it doesn't: it just kills reaction to both Enter and Ctrl-C :) ) I was just wandering if there already is an existing command (akin to screen in respect to serial devices, I guess) that would accept two such named pipes as arguments, and establish a "terminal" or "shell" like session through them; or would I have to use scripts as above and/or program own 'client' that will behave as a terminal..

    Read the article

  • Optimizing python code performance when importing zipped csv to a mongo collection

    - by mark
    I need to import a zipped csv into a mongo collection, but there is a catch - every record contains a timestamp in Pacific Time, which must be converted to the local time corresponding to the (longitude,latitude) pair found in the same record. The code looks like so: def read_csv_zip(path, timezones): with ZipFile(path) as z, z.open(z.namelist()[0]) as input: csv_rows = csv.reader(input) header = csv_rows.next() check,converters = get_aux_stuff(header) for csv_row in csv_rows: if check(csv_row): row = { converter[0]:converter[1](value) for converter, value in zip(converters, csv_row) if allow_field(converter) } ts = row['ts'] lng, lat = row['loc'] found_tz_entry = timezones.find_one(SON({'loc': {'$within': {'$box': [[lng-tz_lookup_radius, lat-tz_lookup_radius],[lng+tz_lookup_radius, lat+tz_lookup_radius]]}}})) if found_tz_entry: tz_name = found_tz_entry['tz'] local_ts = ts.astimezone(timezone(tz_name)).replace(tzinfo=None) row['tz'] = tz_name else: local_ts = (ts.astimezone(utc) + timedelta(hours = int(lng/15))).replace(tzinfo = None) row['local_ts'] = local_ts yield row def insert_documents(collection, source, batch_size): while True: items = list(itertools.islice(source, batch_size)) if len(items) == 0: break; try: collection.insert(items) except: for item in items: try: collection.insert(item) except Exception as exc: print("Failed to insert record {0} - {1}".format(item['_id'], exc)) def main(zip_path): with Connection() as connection: data = connection.mydb.data timezones = connection.timezones.data insert_documents(data, read_csv_zip(zip_path, timezones), 1000) The code proceeds as follows: Every record read from the csv is checked and converted to a dictionary, where some fields may be skipped, some titles be renamed (from those appearing in the csv header), some values may be converted (to datetime, to integers, to floats. etc ...) For each record read from the csv, a lookup is made into the timezones collection to map the record location to the respective time zone. If the mapping is successful - that timezone is used to convert the record timestamp (pacific time) to the respective local timestamp. If no mapping is found - a rough approximation is calculated. The timezones collection is appropriately indexed, of course - calling explain() confirms it. The process is slow. Naturally, having to query the timezones collection for every record kills the performance. I am looking for advises on how to improve it. Thanks. EDIT The timezones collection contains 8176040 records, each containing four values: > db.data.findOne() { "_id" : 3038814, "loc" : [ 1.48333, 42.5 ], "tz" : "Europe/Andorra" } EDIT2 OK, I have compiled a release build of http://toblerity.github.com/rtree/ and configured the rtree package. Then I have created an rtree dat/idx pair of files corresponding to my timezones collection. So, instead of calling collection.find_one I call index.intersection. Surprisingly, not only there is no improvement, but it works even more slowly now! May be rtree could be fine tuned to load the entire dat/idx pair into RAM (704M), but I do not know how to do it. Until then, it is not an alternative. In general, I think the solution should involve parallelization of the task. EDIT3 Profile output when using collection.find_one: >>> p.sort_stats('cumulative').print_stats(10) Tue Apr 10 14:28:39 2012 ImportDataIntoMongo.profile 64549590 function calls (64549180 primitive calls) in 1231.257 seconds Ordered by: cumulative time List reduced from 730 to 10 due to restriction <10> ncalls tottime percall cumtime percall filename:lineno(function) 1 0.012 0.012 1231.257 1231.257 ImportDataIntoMongo.py:1(<module>) 1 0.001 0.001 1230.959 1230.959 ImportDataIntoMongo.py:187(main) 1 853.558 853.558 853.558 853.558 {raw_input} 1 0.598 0.598 370.510 370.510 ImportDataIntoMongo.py:165(insert_documents) 343407 9.965 0.000 359.034 0.001 ImportDataIntoMongo.py:137(read_csv_zip) 343408 2.927 0.000 287.035 0.001 c:\python27\lib\site-packages\pymongo\collection.py:489(find_one) 343408 1.842 0.000 274.803 0.001 c:\python27\lib\site-packages\pymongo\cursor.py:699(next) 343408 2.542 0.000 271.212 0.001 c:\python27\lib\site-packages\pymongo\cursor.py:644(_refresh) 343408 4.512 0.000 253.673 0.001 c:\python27\lib\site-packages\pymongo\cursor.py:605(__send_message) 343408 0.971 0.000 242.078 0.001 c:\python27\lib\site-packages\pymongo\connection.py:871(_send_message_with_response) Profile output when using index.intersection: >>> p.sort_stats('cumulative').print_stats(10) Wed Apr 11 16:21:31 2012 ImportDataIntoMongo.profile 41542960 function calls (41542536 primitive calls) in 2889.164 seconds Ordered by: cumulative time List reduced from 778 to 10 due to restriction <10> ncalls tottime percall cumtime percall filename:lineno(function) 1 0.028 0.028 2889.164 2889.164 ImportDataIntoMongo.py:1(<module>) 1 0.017 0.017 2888.679 2888.679 ImportDataIntoMongo.py:202(main) 1 2365.526 2365.526 2365.526 2365.526 {raw_input} 1 0.766 0.766 502.817 502.817 ImportDataIntoMongo.py:180(insert_documents) 343407 9.147 0.000 491.433 0.001 ImportDataIntoMongo.py:152(read_csv_zip) 343406 0.571 0.000 391.394 0.001 c:\python27\lib\site-packages\rtree-0.7.0-py2.7.egg\rtree\index.py:384(intersection) 343406 379.957 0.001 390.824 0.001 c:\python27\lib\site-packages\rtree-0.7.0-py2.7.egg\rtree\index.py:435(_intersection_obj) 686513 22.616 0.000 38.705 0.000 c:\python27\lib\site-packages\rtree-0.7.0-py2.7.egg\rtree\index.py:451(_get_objects) 343406 6.134 0.000 33.326 0.000 ImportDataIntoMongo.py:162(<dictcomp>) 346 0.396 0.001 30.665 0.089 c:\python27\lib\site-packages\pymongo\collection.py:240(insert) EDIT4 I have parallelized the code, but the results are still not very encouraging. I am convinced it could be done better. See my own answer to this question for details.

    Read the article

  • java code for capture the image by webcam

    - by Navneet
    I am using windows7 64 bit operating system. The source code is for capturing the image by webcam: import javax.swing.*; import javax.swing.event.*; import java.io.*; import javax.media.*; import javax.media.format.*; import javax.media.util.*; import javax.media.control.*; import javax.media.protocol.*; import java.util.*; import java.awt.*; import java.awt.image.*; import java.awt.event.*; import com.sun.image.codec.jpeg.*; public class SwingCapture extends Panel implements ActionListener { public static Player player = null; public CaptureDeviceInfo di = null; public MediaLocator ml = null; public JButton capture = null; public Buffer buf = null; public Image img = null; public VideoFormat vf = null; public BufferToImage btoi = null; public ImagePanel imgpanel = null; public SwingCapture() { setLayout(new BorderLayout()); setSize(320,550); imgpanel = new ImagePanel(); capture = new JButton("Capture"); capture.addActionListener(this); String str1 = "vfw:Logitech USB Video Camera:0"; String str2 = "vfw:Microsoft WDM Image Capture (Win32):0"; di = CaptureDeviceManager.getDevice(str2); ml = di.getLocator(); try { player = Manager.createRealizedPlayer(ml); player.start(); Component comp; if ((comp = player.getVisualComponent()) != null) { add(comp,BorderLayout.NORTH); } add(capture,BorderLayout.CENTER); add(imgpanel,BorderLayout.SOUTH); } catch (Exception e) { e.printStackTrace(); } } public static void main(String[] args) { Frame f = new Frame("SwingCapture"); SwingCapture cf = new SwingCapture(); f.addWindowListener(new WindowAdapter() { public void windowClosing(WindowEvent e) { playerclose(); System.exit(0);}}); f.add("Center",cf); f.pack(); f.setSize(new Dimension(320,550)); f.setVisible(true); } public static void playerclose() { player.close(); player.deallocate(); } public void actionPerformed(ActionEvent e) { JComponent c = (JComponent) e.getSource(); if (c == capture) { // Grab a frame FrameGrabbingControl fgc = (FrameGrabbingControl) player.getControl("javax.media.control.FrameGrabbingControl"); buf = fgc.grabFrame(); // Convert it to an image btoi = new BufferToImage((VideoFormat)buf.getFormat()); img = btoi.createImage(buf); // show the image imgpanel.setImage(img); // save image saveJPG(img,"c:\\test.jpg"); } } class ImagePanel extends Panel { public Image myimg = null; public ImagePanel() { setLayout(null); setSize(320,240); } public void setImage(Image img) { this.myimg = img; repaint(); } public void paint(Graphics g) { if (myimg != null) { g.drawImage(myimg, 0, 0, this); } } } public static void saveJPG(Image img, String s) { BufferedImage bi = new BufferedImage(img.getWidth(null), img.getHeight(null), BufferedImage.TYPE_INT_RGB); Graphics2D g2 = bi.createGraphics(); g2.drawImage(img, null, null); FileOutputStream out = null; try { out = new FileOutputStream(s); } catch (java.io.FileNotFoundException io) { System.out.println("File Not Found"); } JPEGImageEncoder encoder = JPEGCodec.createJPEGEncoder(out); JPEGEncodeParam param = encoder.getDefaultJPEGEncodeParam(bi); param.setQuality(0.5f,false); encoder.setJPEGEncodeParam(param); try { encoder.encode(bi); out.close(); } catch (java.io.IOException io) { System.out.println("IOException"); } } } This code is sucessfully compiled. On running the code, the following runtime error occurs: Exception in thread "VFW Request Thread" java.lang.UnsatisfiedLinkError:JMFSecurityManager: java.lang.UnsatisfiedLinkError:no jmvfw in java.library.path at com.sun.media.JMFSecurityManager.loadLibrary(JMFSecurityManager.java:206) at com.sun.media.protocol.vfw.VFWCapture.<clinit><VFWCapture.java:19> at com.sun.media.protocol.vfw.VFWSourceStream.doConnect(VFWSourceStream.java:241) at com.sun.media.protocol.vfw.VFWSourceStream.run(VFWSourceStream.java:763) at java.cdlang.Thread.run(Thread.java:619) Please send me solution of this problem/

    Read the article

  • Using C# to detect whether a filename character is considered international

    - by Morten Mertner
    I've written a small console application (source below) to locate and optionally rename files containing international characters, as they are a source of constant pain with most source control systems (some background on this below). The code I'm using has a simple dictionary with characters to look for and replace (and nukes every other character that uses more than one byte of storage), but it feels very hackish. What's the right way to (a) find out whether a character is international? and (b) what the best ASCII substitution character would be? Let me provide some background information on why this is needed. It so happens that the danish Å character has two different encodings in UTF-8, both representing the same symbol. These are known as NFC and NFD encodings. Windows and Linux will create NFC encoding by default but respect whatever encoding it is given. Mac will convert all names (when saving to a HFS+ partition) to NFD and therefore returns a different byte stream for the name of a file created on Windows. This effectively breaks Subversion, Git and lots of other utilities that don't care to properly handle this scenario. I'm currently evaluating Mercurial, which turns out to be even worse at handling international characters.. being fairly tired of these problems, either source control or the international character would have to go, and so here we are. My current implementation: public class Checker { private Dictionary<char, string> internationals = new Dictionary<char, string>(); private List<char> keep = new List<char>(); private List<char> seen = new List<char>(); public Checker() { internationals.Add( 'æ', "ae" ); internationals.Add( 'ø', "oe" ); internationals.Add( 'å', "aa" ); internationals.Add( 'Æ', "Ae" ); internationals.Add( 'Ø', "Oe" ); internationals.Add( 'Å', "Aa" ); internationals.Add( 'ö', "o" ); internationals.Add( 'ü', "u" ); internationals.Add( 'ä', "a" ); internationals.Add( 'é', "e" ); internationals.Add( 'è', "e" ); internationals.Add( 'ê', "e" ); internationals.Add( '¦', "" ); internationals.Add( 'Ã', "" ); internationals.Add( '©', "" ); internationals.Add( ' ', "" ); internationals.Add( '§', "" ); internationals.Add( '¡', "" ); internationals.Add( '³', "" ); internationals.Add( '­', "" ); internationals.Add( 'º', "" ); internationals.Add( '«', "-" ); internationals.Add( '»', "-" ); internationals.Add( '´', "'" ); internationals.Add( '`', "'" ); internationals.Add( '"', "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 147 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 148 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 153 } )[ 0 ], "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 166 } )[ 0 ], "." ); keep.Add( '-' ); keep.Add( '=' ); keep.Add( '\'' ); keep.Add( '.' ); } public bool IsInternationalCharacter( char c ) { var s = c.ToString(); byte[] bytes = Encoding.UTF8.GetBytes( s ); if( bytes.Length > 1 && ! internationals.ContainsKey( c ) && ! seen.Contains( c ) ) { Console.WriteLine( "X '{0}' ({1})", c, string.Join( ",", bytes ) ); seen.Add( c ); if( ! keep.Contains( c ) ) { internationals[ c ] = ""; } } return internationals.ContainsKey( c ); } public bool HasInternationalCharactersInName( string name, out string safeName ) { StringBuilder sb = new StringBuilder(); Array.ForEach( name.ToCharArray(), c => sb.Append( IsInternationalCharacter( c ) ? internationals[ c ] : c.ToString() ) ); int length = sb.Length; sb.Replace( " ", " " ); while( sb.Length != length ) { sb.Replace( " ", " " ); } safeName = sb.ToString().Trim(); string namePart = Path.GetFileNameWithoutExtension( safeName ); if( namePart.EndsWith( "." ) ) safeName = namePart.Substring( 0, namePart.Length - 1 ) + Path.GetExtension( safeName ); return name != safeName; } } And this would be invoked like this: FileInfo file = new File( "Århus.txt" ); string safeName; if( checker.HasInternationalCharactersInName( file.Name, out safeName ) ) { // rename file }

    Read the article

  • c++ to vb.net , problem with callback function

    - by johan
    I'm having a hard time here trying to find a solution for my problem. I'm trying to convert a client API funktion from C++ to VB.NET, and i think have some problems with the callback function. parts of the C++ code: typedef struct{ BYTE m_bRemoteChannel; BYTE m_bSendMode; BYTE m_nImgFormat; // =0 cif ; = 1 qcif char *m_sIPAddress; char *m_sUserName; char *m_sUserPassword; BOOL m_bUserCheck; HWND m_hShowVideo; }CLIENT_VIDEOINFO, *PCLIENT_VIDEOINFO; CPLAYER_API LONG __stdcall MP4_ClientStart(PCLIENT_VIDEOINFO pClientinfo,void(CALLBACK *ReadDataCallBack)(DWORD nPort,UCHAR *pPacketBuffer,DWORD nPacketSize)); void CALLBACK ReadDataCallBack(DWORD nPort,UCHAR *pPacketBuffer,DWORD nPacketSize) { TRACE("%d\n",nPacketSize); } ..... aa5.m_sUserName = "123"; aa5.m_sUserPassword="w"; aa5.m_bUserCheck = TRUE; MP4_ClientSetTTL(64); nn1 = MP4_ClientStart(&aa5,ReadDataCallBack); if (nn1 == -1) { MessageBox("error"); return; } SDK description: MP4_ClientStart This function starts a connection. The format of the call is: LONG __stdcall MP4_ClientStart(PCLIENT_VIDEOINFO pClientinfo, void(*ReadDataCallBack)(DWORD nChannel,UCHAR *pPacketBuffer,DWORD nPacketSize)) Parameters pClientinfo holds the information. of this connection. nChannel holds the channel of card. pPacketBuffer holds the pointer to the receive buffer. nPacketSize holds the length of the receive buffer. Return Values If the function succeeds the return value is the context of this connection. If the function fails the return value is -1. Remarks typedef struct{ BYTE m_bRemoteChannel; BYTE m_bSendMode; BYTE m_bImgFormat; char *m_sIPAddress; char *m_sUserName; char *m_sUserPassword; BOOL m_bUserCheck; HWND m_hShowVideo; } CLIENT_VIDEOINFO, * PCLIENT_VIDEOINFO; m_bRemoteChannel holds the channel which the client wants to connect to. m_bSendMode holds the network mode of the connection. m_bImgFormat : Image format, 0 is main channel video, 1 is sub channel video m_sIPAddress holds the IP address of the server. m_sUserName holds the user’s name. m_sUserPassword holds the user’s password. m_bUserCheck holds the value whether sends the user’s name and password or not. m_hShowVideo holds Handle for this video window. If m_hShowVideo holds NULL, the client can be record only without decoder. If m_bUserCheck is FALSE, we will send m_sUserName and m_sUserPassword as NULL, else we will send each 50 bytes. The length of m_sIPAddress and m_sUserName must be more than 50 bytes. ReadDataCallBack: When the library receives a packet from a server, this callback is called. My VB.Net code: Imports System.Runtime.InteropServices Public Class Form1 Const WM_USER = &H400 Public Structure CLIENT_VIDEOINFO Public m_bRemoteChannel As Byte Public m_bSendMode As Byte Public m_bImgFormat As Byte Public m_sIPAddress As String Public m_sUserName As String Public m_sUserPassword As String Public m_bUserCheck As Boolean Public m_hShowVideo As Long 'hWnd End Structure Public Declare Function MP4_ClientSetNetPort Lib "hikclient.dll" (ByVal dServerPort As Integer, ByVal dClientPort As Integer) As Boolean Public Declare Function MP4_ClientStartup Lib "hikclient.dll" (ByVal nMessage As UInteger, ByVal hWnd As System.IntPtr) As Boolean <DllImport("hikclient.dll")> Public Shared Function MP4_ClientStart(ByVal Clientinfo As CLIENT_VIDEOINFO, ByRef ReadDataCallBack As CALLBACKdel) As Long End Function Public Delegate Sub CALLBACKdel(ByVal nPort As Long, <MarshalAs(UnmanagedType.LPArray)> ByRef pPacketBuffer As Byte(), ByVal nPacketSize As Long) Public Sub CALLBACK(ByVal nPort As Long, <MarshalAs(UnmanagedType.LPArray)> ByRef pPacketBuffer As Byte(), ByVal nPacketSize As Long) End Sub Public mydel As New CALLBACKdel(AddressOf CALLBACK) Private Sub Form1_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load Dim Clientinfo As New CLIENT_VIDEOINFO() Clientinfo.m_bRemoteChannel = 0 Clientinfo.m_bSendMode = 0 Clientinfo.m_bImgFormat = 0 Clientinfo.m_sIPAddress = "193.168.1.100" Clientinfo.m_sUserName = "1" Clientinfo.m_sUserPassword = "a" Clientinfo.m_bUserCheck = False Clientinfo.m_hShowVideo = Me.Handle 'Nothing MP4_ClientSetNetPort(850, 850) MP4_ClientStartup(WM_USER + 1, Me.Handle) MP4_ClientStart(Clientinfo, mydel) End Sub End Class here is some other examples of the code in: C# http://blog.csdn.net/nenith1981/archive/2007/09/17/1787692.aspx VB ://read.pudn.com/downloads70/sourcecode/graph/250633/MD%E5%AE%A2%E6%88%B7%E7%AB%AF%28VB%29/hikclient.bas__.htm ://read.pudn.com/downloads70/sourcecode/graph/250633/MD%E5%AE%A2%E6%88%B7%E7%AB%AF%28VB%29/Form1.frm__.htm Delphi ://read.pudn.com/downloads91/sourcecode/multimedia/streaming/349759/Delphi_client/Unit1.pas__.htm

    Read the article

  • What is the MVC version of this code?

    - by Ian Boyd
    i'm trying to wrap my head around how to enterprise up my code: taking a simple routine and splitting it up into 5 or 6 methods in 3 or 4 classes. i quickly came up three simple examples of code how i currently write it. Could someone please convert these into an MVC/MVP obfuscated version? Example 1: The last name is mandatory. Color the text box red if nothing is entered. Color it green if stuff is entered: private void txtLastname_TextChanged(object sender, EventArgs e) { //Lastname mandatory. //Color pinkish if nothing entered. Greenish if entered. if (txtLastname.Text.Trim() == "") { //Lastname is required, color pinkish txtLastname.BackColor = ControlBad; } else { //Lastname entered, remove the coloring txtLastname.BackColor = ControlGood; } } Example 2: The first name is optional, but try to get it. We'll add a bluish tint to this "try to get" field: private void txtFirstname_TextChanged(object sender, EventArgs e) { //Firstname can be blank. //Hint them that they should *try* to get it with a bluish color. //If they do enter stuff: it better be not all spaces. if (txtFirstname.Text == "") { //Nothing there, hint it blue txtFirstname.BackColor = ControlRequired; } else if (txtFirstname.Text.Trim() == "") { //They entered spaces - bad user! txtFirstname.BackColor = ControlBad; } else { //Entered stuff, remove coloring txtFirstname.BackColor = SystemColors.Window; } } Example 3 The age is totally optional. If an age is entered, it better be valid: private void txtAge_TextChanged(object sender, EventArgs e) { //Age is optional, but if entered it better be valid int nAge = 0; if (Int32.TryParse(txtAge.Text, out nAge)) { //Valid integer entered if (nAge < 0) { //Negative age? i don't think so txtAge.BackColor = ControlBad; } else { //Valid age entered, remove coloring txtAge.BackColor = SystemColors.Window; } } else { //Whatever is in there: it's *not* a valid integer, if (txtAge.Text == "") { //Blank is okay txtAge.BackColor = SystemColors.Window; } else { //Not a valid age, bad user txtAge.BackColor = ControlBad; } } } Every time i see MVC code, it looks almost like random splitting of code into different methods, classes, and files. i've not been able to determine a reason or pattern to their madness. Without any understanding of they why it's being one some way, it makes no sense. And using the words model, view, controller and presenter, like i'm supposed to know what that means, doesn't help. The model is your data. The view shows data on screen. The controller is used to carry out the users actions And oranges taste orangy. Here's my attempt at splitting things up in order to make the code more difficult to follow. Is this anywhere close to MVC? private void txtFirstname_TextChanged(object sender, EventArgs e) { FirstnameTextChangedHandler(sender, e); } private void FirstnameTextChangedHandler(sender, e) { string firstname = GetFirstname(); Color firstnameTextBoxColor = GetFirstnameTextBoxColor(firstname); SetFirstNameTextBoxColor(firstnameTextBoxColor); } private string GetFirstname() { return txtFirstname.Text; } private Color GetFirstnameTextBoxColor(string firstname) { //Firstname can be blank. //Hint them that they should *try* to get it with a bluish color. //If they do enter stuff: it better be not all spaces. if (firstname == "") { //Nothing there, hint it blue return GetControlRequiredColor(); } else if (firstname.Trim() == "") { //They entered spaces - bad user! return GetControlBadColor(); } else { //Entered stuff, remove coloring return GetControlDefaultColor(); } } private Color GetControlRequiredColor() { return ControlRequired; } private Color GetControlBadColor() { return ControlBad; } private Color GetControlGoodColor() { return ControlGood; } //am i doin it rite i've obfuscated the code, but it's still altogether. The next step in the MVC obfuscation, i gather, is to hide the code in 3 or 4 different files. It's that next step that i don't understand. What is the logical separation of which functions are moved into what other classes? Can someone translate my 3 simple examples above into full fledged MVC obfuscation? Edit: Not ASP/ASP.NET/Online. Pretend it's on a desktop, handheld, surface, kiosk. And pretend it's language agnostic.

    Read the article

  • Screen capture code produces black bitmap

    - by wadetandy
    I need to add the ability to take a screenshot of the entire screen, not just the current window. The following code produces a bmp file with the correct dimensions, but the image is completely black. What am I doing wrong? void CaptureScreen(LPCTSTR lpszFilePathName) { BITMAPFILEHEADER bmfHeader; BITMAPINFO *pbminfo; HBITMAP hBmp; FILE *oFile; HDC screen; HDC memDC; int sHeight; int sWidth; LPBYTE pBuff; BITMAP bmp; WORD cClrBits; RECT rcClient; screen = GetDC(0); memDC = CreateCompatibleDC(screen); sHeight = GetDeviceCaps(screen, VERTRES); sWidth = GetDeviceCaps(screen, HORZRES); //GetObject(screen, sizeof(BITMAP), &bmp); hBmp = CreateCompatibleBitmap ( screen, sWidth, sHeight ); // Retrieve the bitmap color format, width, and height. GetObject(hBmp, sizeof(BITMAP), (LPSTR)&bmp) ; // Convert the color format to a count of bits. cClrBits = (WORD)(bmp.bmPlanes * bmp.bmBitsPixel); if (cClrBits == 1) cClrBits = 1; else if (cClrBits bmiHeader.biSize = sizeof(BITMAPINFOHEADER); pbminfo-bmiHeader.biWidth = bmp.bmWidth; pbminfo-bmiHeader.biHeight = bmp.bmHeight; pbminfo-bmiHeader.biPlanes = bmp.bmPlanes; pbminfo-bmiHeader.biBitCount = bmp.bmBitsPixel; if (cClrBits bmiHeader.biClrUsed = (1bmiHeader.biCompression = BI_RGB; // Compute the number of bytes in the array of color // indices and store the result in biSizeImage. // The width must be DWORD aligned unless the bitmap is RLE // compressed. pbminfo-bmiHeader.biSizeImage = ((pbminfo-bmiHeader.biWidth * cClrBits +31) & ~31) /8 * pbminfo-bmiHeader.biHeight; // Set biClrImportant to 0, indicating that all of the // device colors are important. pbminfo-bmiHeader.biClrImportant = 0; CreateBMPFile(lpszFilePathName, pbminfo, hBmp, memDC); } void CreateBMPFile(LPTSTR pszFile, PBITMAPINFO pbi, HBITMAP hBMP, HDC hDC) { HANDLE hf; // file handle BITMAPFILEHEADER hdr; // bitmap file-header PBITMAPINFOHEADER pbih; // bitmap info-header LPBYTE lpBits; // memory pointer DWORD dwTotal; // total count of bytes DWORD cb; // incremental count of bytes BYTE *hp; // byte pointer DWORD dwTmp; int lines; pbih = (PBITMAPINFOHEADER) pbi; lpBits = (LPBYTE) GlobalAlloc(GMEM_FIXED, pbih-biSizeImage); // Retrieve the color table (RGBQUAD array) and the bits // (array of palette indices) from the DIB. lines = GetDIBits(hDC, hBMP, 0, (WORD) pbih-biHeight, lpBits, pbi, DIB_RGB_COLORS); // Create the .BMP file. hf = CreateFile(pszFile, GENERIC_READ | GENERIC_WRITE, (DWORD) 0, NULL, CREATE_ALWAYS, FILE_ATTRIBUTE_NORMAL, (HANDLE) NULL); hdr.bfType = 0x4d42; // 0x42 = "B" 0x4d = "M" // Compute the size of the entire file. hdr.bfSize = (DWORD) (sizeof(BITMAPFILEHEADER) + pbih-biSize + pbih-biClrUsed * sizeof(RGBQUAD) + pbih-biSizeImage); hdr.bfReserved1 = 0; hdr.bfReserved2 = 0; // Compute the offset to the array of color indices. hdr.bfOffBits = (DWORD) sizeof(BITMAPFILEHEADER) + pbih-biSize + pbih-biClrUsed * sizeof (RGBQUAD); // Copy the BITMAPFILEHEADER into the .BMP file. WriteFile(hf, (LPVOID) &hdr, sizeof(BITMAPFILEHEADER), (LPDWORD) &dwTmp, NULL); // Copy the BITMAPINFOHEADER and RGBQUAD array into the file. WriteFile(hf, (LPVOID) pbih, sizeof(BITMAPINFOHEADER) + pbih-biClrUsed * sizeof (RGBQUAD), (LPDWORD) &dwTmp, ( NULL)); // Copy the array of color indices into the .BMP file. dwTotal = cb = pbih-biSizeImage; hp = lpBits; WriteFile(hf, (LPSTR) hp, (int) cb, (LPDWORD) &dwTmp,NULL); // Close the .BMP file. CloseHandle(hf); // Free memory. GlobalFree((HGLOBAL)lpBits); }

    Read the article

  • spoof mac address

    - by Cold-Blooded
    // macaddress.cpp : Defines the entry point for the console application. // #include "stdafx.h" #include <windows.h> #include <iostream> using namespace std; void readregistry(); void spoofmac(); void main(int argc, char* argv[]) { readregistry(); spoofmac(); } void spoofmac() { ////////////////////// ////////Write to Registry char buffer[60]; unsigned long size = sizeof(buffer); HKEY software; LPCTSTR location; char adapternum[10]=""; char numbers[11]="0123456789"; char editlocation[]="System\\CurrentControlSet\\Control\\Class\\{4D36E972-E325-11CE-BFC1-08002bE10318}\\0000"; char macaddress[60]; cout << "\n//////////////////////////////////////////////////////////////////\nPlease Enter Number of Network Adapter to Spoof or type 'E' to Exit.\nE.g. 18\n\nNumber: "; cin >> adapternum; if (adapternum[0]=='E') { exit(0); } if (strlen(adapternum)==2) { editlocation[strlen(editlocation)-2]=adapternum[0]; editlocation[strlen(editlocation)-1]=adapternum[1]; } if (strlen(adapternum)==1) { editlocation[strlen(editlocation)-1]=adapternum[0]; } if (strlen(adapternum)!=1 && strlen(adapternum)!=2) { cout << "Invaild Network Adapter Chosen\n\n"; exit(0); } cout << "Please Enter the Desired Spoofed Mac Address Without Dashes\nE.g. 00123F0F6D7F\n\nNew Mac: "; cin >> macaddress; location = editlocation; //error line strcpy(buffer,macaddress); size=sizeof(buffer); RegCreateKey(HKEY_LOCAL_MACHINE,location,&software); //RegSetValueEx(software,"NetworkAddress",NULL,REG_SZ,(LPBYTE)buffer,size); RegCloseKey(software); cout << "\nMac Address Successfully Spoofed.\n\nWritten by Lyth0s\n\n"; } void readregistry () { //////////////////////////////////// // Read From Registry char driver[60]=""; char mac[60]=""; char numbers[11]="0123456789"; char editlocation[]="System\\CurrentControlSet\\Control\\Class\\{4D36E972-E325-11CE-BFC1-08002bE10318}\\0000"; unsigned long driversize = sizeof(driver); unsigned long macsize = sizeof(mac); DWORD type; HKEY software; LPCTSTR location; int tenscount=0; int onescount=0; for (int x =0;x<=19; x+=1) { strcpy(driver,""); driversize=sizeof(driver); strcpy(mac,""); macsize=sizeof(mac); if (editlocation[strlen(editlocation)-1]=='9') { tenscount+=1; onescount=0; editlocation[strlen(editlocation)-2]=numbers[tenscount]; } editlocation[strlen(editlocation)-1]=numbers[onescount]; location=editlocation; //error line // cout << location << "\n"; // cout << "Checking 00" << location[strlen(location)-2] << location[strlen(location)-1] << "\n\n"; RegCreateKey(HKEY_LOCAL_MACHINE,location,&software); RegQueryValueEx(software,"DriverDesc",NULL,&type,(LPBYTE)driver,&driversize); //RegCloseKey(software); //RegCreateKey(HKEY_LOCAL_MACHINE,location,&software); RegQueryValueEx(software,"NetworkAddress",NULL,&type,(LPBYTE)mac,&macsize); RegCloseKey(software); cout << x << ": " << driver << "| Mac: " << mac << "\n"; onescount+=1; } } this program gives error as follows error C2440: '=' : cannot convert from 'char [83]' to 'LPCTSTR' why this error coming please explain

    Read the article

< Previous Page | 356 357 358 359 360 361 362 363 364 365 366  | Next Page >