Search Results

Search found 9338 results on 374 pages for 'fedora 15'.

Page 360/374 | < Previous Page | 356 357 358 359 360 361 362 363 364 365 366 367  | Next Page >

  • NOOB Memory Problem - EXC_BAD_ACCESS

    - by Michael Bordelon
    I have been banging my head against the wall for a couple days and need some help. I have a feeling that I am doing something really silly here, but I cannot find the issue. This is the controller for a table view. I put the SQL in line to simplify it as part of the troubleshooting of this error. Normally, it would be in an accessor method in a model class. It gets through the SQL read just fine. Finds the two objects, loads them into the todaysWorkout array and then builds the cells for the table view. The table view actually comes up on the scree and then it throws the EXC_BAD_ACCESS. I ran instruments and it shows the following: 0 CFString Malloc 1 00:03.765 0x3946470 176 Foundation -[NSPlaceholderString initWithFormat:locale:arguments:] 1 CFString Autorelease 00:03.765 0x3946470 0 Foundation NSRecordAllocationEvent 2 CFString CFRelease 0 00:03.767 0x3946470 0 Bring It -[WorkoutViewController viewDidLoad] 3 CFString Zombie -1 00:03.917 0x3946470 0 Foundation NSPopAutoreleasePool Here is the source code for the controller. I left it all in there just in case there is something extraneous causing the problem. I sincerely appreciate any help I can get: #import "WorkoutViewController.h" #import "MoveListViewController.h" #import "Profile.h" static sqlite3 *database = nil; @implementation WorkoutViewController @synthesize todaysWorkouts; @synthesize woNoteCell; @synthesize bi; //@synthesize woSwitchCell; - (void)viewDidLoad { [super viewDidLoad]; bi = [[BIUtility alloc] init]; todaysWorkouts = [[NSMutableArray alloc] init]; NSString *query; sqlite3_stmt *statement; //open the database if (sqlite3_open([[BIUtility getDBPath] UTF8String], &database) != SQLITE_OK) { sqlite3_close(database); NSAssert(0, @"Failed to opendatabase"); } query = [NSString stringWithFormat:@"SELECT IWORKOUT.WOINSTANCEID, IWORKOUT.WORKOUTID, CWORKOUTS.WORKOUTNAME FROM CWORKOUTS JOIN IWORKOUT ON IWORKOUT.WORKOUTID = CWORKOUTS.WORKOUTID AND DATE = '%@'", [BIUtility todayDateString]]; if (sqlite3_prepare_v2(database, [query UTF8String], -1, &statement, nil) == SQLITE_OK) { while (sqlite3_step(statement) == SQLITE_ROW) { Workout *wo = [[Workout alloc] init]; wo.woInstanceID = sqlite3_column_int(statement, 0); wo.workoutID = sqlite3_column_int(statement, 1); wo.workoutName = [NSString stringWithUTF8String:(char *)sqlite3_column_text(statement, 2)]; [todaysWorkouts addObject:wo]; [wo release]; } sqlite3_finalize(statement); } if(database) sqlite3_close(database); [query release]; } - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { //todaysWorkouts = [BIUtility todaysScheduledWorkouts]; static NSString *noteCellIdentifier = @"NoteCellIdentifier"; UITableViewCell *cell; if (indexPath.section < ([todaysWorkouts count])) { cell = [tableView dequeueReusableCellWithIdentifier:@"OtherCell"]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithFrame:CGRectZero reuseIdentifier: @"OtherCell"] autorelease]; cell.accessoryType = UITableViewCellAccessoryNone; } if (indexPath.row == 0) { Workout *wo = [todaysWorkouts objectAtIndex:indexPath.section]; [cell.textLabel setText:wo.workoutName]; } else { [cell.textLabel setText:@"Completed?"]; [cell.textLabel setFont:[UIFont fontWithName:@"Arial" size:15]]; [cell.textLabel setTextColor:[UIColor blueColor]]; } } else { cell = (NoteCell *)[tableView dequeueReusableCellWithIdentifier:noteCellIdentifier]; if (cell == nil) { NSArray *nib = [[NSBundle mainBundle] loadNibNamed:@"NoteCell" owner:self options:nil]; cell = [nib objectAtIndex:0]; } } return cell; //[cell release]; } - (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { NSUInteger row = [indexPath row]; if (indexPath.section < ([todaysWorkouts count]) && (row == 0)) { MoveListViewController *moveListController = [[MoveListViewController alloc] initWithStyle:UITableViewStylePlain]; moveListController.workoutID = [[todaysWorkouts objectAtIndex:indexPath.section] workoutID]; moveListController.workoutName = [[todaysWorkouts objectAtIndex:indexPath.section] workoutName]; moveListController.woInstanceID = [[todaysWorkouts objectAtIndex:indexPath.section] woInstanceID]; NSLog(@"Workout Selected: %@", [[todaysWorkouts objectAtIndex:indexPath.section] workoutName]); Bring_ItAppDelegate *delegate = [[UIApplication sharedApplication] delegate]; [delegate.workoutNavController pushViewController:moveListController animated:YES]; } else { UITableViewCell *cell = [tableView cellForRowAtIndexPath:indexPath]; if (indexPath.section < ([todaysWorkouts count]) && (row == 1)) { if (cell.accessoryType == UITableViewCellAccessoryNone) { cell.accessoryType = UITableViewCellAccessoryCheckmark; } else { cell.accessoryType = UITableViewCellAccessoryNone; } } } [tableView deselectRowAtIndexPath:indexPath animated:YES]; } - (CGFloat)tableView:(UITableView *)tableView heightForRowAtIndexPath:(NSIndexPath *)indexPath { NSInteger h = 35; return h; } - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { return ([todaysWorkouts count] + 1); //return ([todaysWorkouts count]); } - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { if (section < ([todaysWorkouts count])) { return 2; } else { return 1; } } - (NSString *)tableView:(UITableView *)tableView titleForHeaderInSection:(NSInteger)section { if (section < ([todaysWorkouts count])) { return @"Workout"; } else { return @"How Was Your Workout?"; } } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { [super viewDidUnload]; // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } - (void)dealloc { [todaysWorkouts release]; [bi release]; [super dealloc]; } @end

    Read the article

  • Reverse engineering windows mobile live search CellID location awareness protocol (yikes)...

    - by Jean-Charles
    I wasn't sure of how to form the question so I apologize if the title is misleading. Additionally, you may want to get some coffee and take a seat for this one ... It's long. Basically, I'm trying to reverse engineer the protocol used by the Windows Mobile Live Search application to get location based on cellID. Before I go on, I am aware of other open source services (such as OpenCellID) but this is more for the sake of education and a bit for redundancy. According to the packets I captured, a POST request is made to ... mobile.search.live.com/positionlookupservice_1/service.aspx ... with a few specific headers (agent, content-length, etc) and no body. Once this goes through, the server sends back a 100-Continue response. At this point, the application submits this data (I chopped off the packet header): 00 00 00 01 00 00 00 05 55 54 ........UT 46 2d 38 05 65 6e 2d 55 53 05 65 6e 2d 55 53 01 F-8.en-US.en-US. 06 44 65 76 69 63 65 05 64 75 6d 6d 79 01 06 02 .Device.dummy... 50 4c 08 0e 52 65 76 65 72 73 65 47 65 6f 63 6f PL..ReverseGeoco 64 65 01 07 0b 47 50 53 43 68 69 70 49 6e 66 6f de...GPSChipInfo 01 20 06 09 43 65 6c 6c 54 6f 77 65 72 06 03 43 . ..CellTower..C 47 49 08 03 4d 43 43 b6 02 07 03 4d 4e 43 03 34 GI..MCC....MNC.4 31 30 08 03 4c 41 43 cf 36 08 02 43 49 fd 01 00 10..LAC.6..CI... 00 00 00 ... And receives this in response (packet and HTTP response headers chopped): 00 00 00 01 00 00 00 00 01 06 02 50 4c ...........PL 06 08 4c 6f 63 61 6c 69 74 79 06 08 4c 6f 63 61 ..Locality..Loca 74 69 6f 6e 07 03 4c 61 74 09 34 32 2e 33 37 35 tion..Lat.42.375 36 32 31 07 04 4c 6f 6e 67 0a 2d 37 31 2e 31 35 621..Long.-71.15 38 39 33 38 00 07 06 52 61 64 69 75 73 09 32 30 8938...Radius.20 30 30 2e 30 30 30 30 00 42 07 0c 4c 6f 63 61 6c 00.0000.B..Local 69 74 79 4e 61 6d 65 09 57 61 74 65 72 74 6f 77 ityName.Watertow 6e 07 16 41 64 6d 69 6e 69 73 74 72 61 74 69 76 n..Administrativ 65 41 72 65 61 4e 61 6d 65 0d 4d 61 73 73 61 63 eAreaName.Massac 68 75 73 65 74 74 73 07 10 50 6f 73 74 61 6c 43 husetts..PostalC 6f 64 65 4e 75 6d 62 65 72 05 30 32 34 37 32 07 odeNumber.02472. 0b 43 6f 75 6e 74 72 79 4e 61 6d 65 0d 55 6e 69 .CountryName.Uni 74 65 64 20 53 74 61 74 65 73 00 00 00 ted States... Now, here is what I've determined so far: All strings are prepended with one byte that is the decimal equivalent of their length. There seem to be three different casts that are used throughout the request and response. They show up as one byte before the length byte. I've concluded that the three types map out as follows: 0x06 - parent element (subsequent values are children, closed with 0x00) 0x07 - string 0x08 - int? Based on these determinations, here is what the request and response look like in a more readable manner (values surrounded by brackets denote length and values surrounded by parenthesis denote a cast): \0x00\0x00\0x00\0x01\0x00\0x00\0x00 [5]UTF-8 [5]en-US [5]en-US \0x01 [6]Device [5]dummy \0x01 (6)[2]PL (8)[14]ReverseGeocode\0x01 (7)[11]GPSChipInfo[1]\0x20 (6)[9]CellTower (6)[3]CGI (8)[3]MCC\0xB6\0x02 //310 (7)[3]MNC[3]410 //410 (8)[3]LAC\0xCF\0x36 //6991 (8)[2]CI\0xFD\0x01 //259 \0x00 \0x00 \0x00 \0x00 and.. \0x00\0x00\0x00\0x01\0x00\0x00\0x00 \0x00\0x01 (6)[2]PL (6)[8]Locality (6)[8]Location (7)[3]Lat[9]42.375621 (7)[4]Long[10]-71.158938 \0x00 (7)[6]Radius[9]2000.0000 \0x00 \0x42 //"B" ... Has to do with GSM (7)[12]LocalityName[9]Watertown (7)[22]AdministrativeAreaName[13]Massachusetts (7)[16]PostalCodeNumber[5]02472 (7)[11]CountryName[13]United States \0x00 \0x00\0x00 My analysis seems to work out pretty well except for a few things: The 0x01s throughout confuse me ... At first I thought they were some sort of base level element terminators but I'm not certain. I'm not sure the 7-byte header is, in fact, a seven byte header. I wonder if it's maybe 4 bytes and that the three remaining 0x00s are of some other significance. The trailing 0x00s. Why is it that there is only one on the request but two on the response? The type 8 cast mentioned above ... I can't seem to figure out how those values are being encoded. I added comments to those lines with what the values should correspond to. Any advice on these four points will be greatly appreciated. And yes, these packets were captured in Watertown, MA. :)

    Read the article

  • Doctrine_Table_Exception: Unknown relation alias [closed]

    - by Sadiqur Rahman
    I am getting following error message: Doctrine_Table_Exception: Unknown relation alias shoesTable in /home/public_html/projects/giftshoes/system/database/doctrine/Doctrine/Relation/Parser.php on line 237 My Code is below: ------------BaseShoe------------ <?php // Connection Component Binding Doctrine_Manager::getInstance()->bindComponent('Shoes', 'sadiqsof_giftshoes'); /** * BaseShoes * * This class has been auto-generated by the Doctrine ORM Framework * * @property integer $sku * @property string $name * @property string $keywords * @property string $description * @property string $manufacturer * @property float $sale_price * @property float $price * @property string $url * @property string $image * @property string $category * @property Doctrine_Collection $Viewes * * @package ##PACKAGE## * @subpackage ##SUBPACKAGE## * @author ##NAME## <##EMAIL##> * @version SVN: $Id: Builder.php 6820 2009-11-30 17:27:49Z jwage $ */ abstract class BaseShoes extends Doctrine_Record { public function setTableDefinition() { $this->setTableName('shoes'); $this->hasColumn('sku', 'integer', 4, array( 'type' => 'integer', 'fixed' => 0, 'unsigned' => false, 'primary' => true, 'autoincrement' => false, 'length' => '4', )); $this->hasColumn('name', 'string', 255, array( 'type' => 'string', 'fixed' => 0, 'unsigned' => false, 'primary' => false, 'notnull' => true, 'autoincrement' => false, 'length' => '255', )); $this->hasColumn('keywords', 'string', 255, array( 'type' => 'string', 'fixed' => 0, 'unsigned' => false, 'primary' => false, 'notnull' => true, 'autoincrement' => false, 'length' => '255', )); $this->hasColumn('description', 'string', null, array( 'type' => 'string', 'fixed' => 0, 'unsigned' => false, 'primary' => false, 'notnull' => true, 'autoincrement' => false, 'length' => '', )); $this->hasColumn('manufacturer', 'string', 20, array( 'type' => 'string', 'fixed' => 0, 'unsigned' => false, 'primary' => false, 'notnull' => true, 'autoincrement' => false, 'length' => '20', )); $this->hasColumn('sale_price', 'float', null, array( 'type' => 'float', 'fixed' => 0, 'unsigned' => false, 'primary' => false, 'notnull' => true, 'autoincrement' => false, 'length' => '', )); $this->hasColumn('price', 'float', null, array( 'type' => 'float', 'fixed' => 0, 'unsigned' => false, 'primary' => false, 'notnull' => true, 'autoincrement' => false, 'length' => '', )); $this->hasColumn('url', 'string', null, array( 'type' => 'string', 'fixed' => 0, 'unsigned' => false, 'primary' => false, 'notnull' => true, 'autoincrement' => false, 'length' => '', )); $this->hasColumn('image', 'string', null, array( 'type' => 'string', 'fixed' => 0, 'unsigned' => false, 'primary' => false, 'notnull' => true, 'autoincrement' => false, 'length' => '', )); $this->hasColumn('category', 'string', 50, array( 'type' => 'string', 'fixed' => 0, 'unsigned' => false, 'primary' => false, 'notnull' => true, 'autoincrement' => false, 'length' => '50', )); } public function setUp() { parent::setUp(); $this->hasMany('Viewes', array( 'local' => 'sku', 'foreign' => 'sku')); } } --------------ShoesTable-------- <?php class ShoesTable extends Doctrine_Table { function getAllShoes($from = 0, $total = 15) { $q = Doctrine_Query::create() ->from('Shoes') ->limit($total) ->offset($from); return $q->execute(array(), Doctrine::HYDRATE_ARRAY); } } ---------------Shoes Model----------------- <?php /** * Shoes * * This class has been auto-generated by the Doctrine ORM Framework * * @package ##PACKAGE## * @subpackage ##SUBPACKAGE## * @author ##NAME## <##EMAIL##> * @version SVN: $Id: Builder.php 6820 2009-11-30 17:27:49Z jwage $ */ class Shoes extends BaseShoes { function __construct() { parent::__construct(); $this->shoesTable = Doctrine::getTable('Shoes'); } function getAllShoes() { return $this->shoesTable->getAllShoes(); } }

    Read the article

  • Gmail rejects emails. Openspf.net fails the tests

    - by pablomedok
    I've got a problem with Gmail. It started after one of our trojan infected PCs sent spam for one day from our IP address. We've fixed the problem, but we got into 3 black lists. We've fixed that, too. But still every time we send an email to Gmail the message is rejected: So I've checked Google Bulk Sender's guide once again and found an error in our SPF record and fixed it. Google says everything should become fine after some time, but this doesn't happen. 3 weeks already passed but we still can't send emails to Gmail. Our MX setup is a bit complex, but not too much: We have a domain name delo-company.com, it has it's own mail @delo-company.com (this one is fine, but the problems are with sub-domain name corp.delo-company.com). Delo-company.com domain has several DNS records for the subdomain: corp A 82.209.198.147 corp MX 20 corp.delo-company.com corp.delo-company.com TXT "v=spf1 ip4:82.209.198.147 ~all" (I set ~all for testing purposes only, it was -all before that) These records are for our corporate Exchange 2003 server at 82.209.198.147. Its LAN name is s2.corp.delo-company.com so its HELO/EHLO greetings are also s2.corp.delo-company.com. To pass EHLO check we've also created some records in delo-company.com's DNS: s2.corp A 82.209.198.147 s2.corp.delo-company.com TXT "v=spf1 ip4:82.209.198.147 ~all" As I understand SPF verifications should be passed in this way: Out server s2 connects to MX of the recepient (Rcp.MX): EHLO s2.corp.delo-company.com Rcp.MX says Ok, and makes SPF check of HELO/EHLO. It does NSlookup for s2.corp.delo-company.com and gets the above DNS-records. TXT records says that s2.corp.delo-company.com should be only from IP 82.209.198.147. So it should be passed. Then our s2 server says RCPT FROM: Rcp.MX` server checks it, too. The values are the same so they should also be positive. Maybe there is also a rDNS check, but I'm not sure what is checked HELO or RCPT FROM. Our PTR record for 82.209.198.147 is: 147.198.209.82.in-addr.arpa. 86400 IN PTR s2.corp.delo-company.com. To me everything looks fine, but anyway all emails are rejected by Gmail. So, I've checked MXtoolbox.com - it says everything is fine, I passed http://www.kitterman.com/spf/validate.html Python check, I did 25port.com email test. It's fine, too: Return-Path: <[email protected]> Received: from s2.corp.delo-company.com (82.209.198.147) by verifier.port25.com id ha45na11u9cs for <[email protected]>; Fri, 2 Mar 2012 13:03:21 -0500 (envelope-from <[email protected]>) Authentication-Results: verifier.port25.com; spf=pass [email protected] Authentication-Results: verifier.port25.com; domainkeys=neutral (message not signed) [email protected] Authentication-Results: verifier.port25.com; dkim=neutral (message not signed) Authentication-Results: verifier.port25.com; sender-id=pass [email protected] Content-class: urn:content-classes:message MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----_=_NextPart_001_01CCF89E.BE02A069" Subject: test Date: Fri, 2 Mar 2012 21:03:15 +0300 X-MimeOLE: Produced By Microsoft Exchange V6.5 Message-ID: <[email protected]> X-MS-Has-Attach: X-MS-TNEF-Correlator: Thread-Topic: test Thread-Index: Acz4jS34oznvbyFQR4S5rXsNQFvTdg== From: =?koi8-r?B?89XQ0tXOwMsg8MHXxcw=?= <[email protected]> To: <[email protected]> I also checked with [email protected], but it FAILs all the time, no matter which SPF records I make: <s2.corp.delo-company.com #5.7.1 smtp;550 5.7.1 <[email protected]>: Recipient address rejected: SPF Tests: Mail-From Result="softfail": Mail From="[email protected]" HELO name="s2.corp.delo-company.com" HELO Result="softfail" Remote IP="82.209.198.147"> I've filled Gmail form twice, but nothing happens. We do not send spam, only emails for our clients. 2 or 3 times we did mass emails (like New Year Greetings and sales promos) from corp.delo-company.com addresses, but they where all complying to Gmail Bulk Sender's Guide (I mean SPF, Open Relays, Precedence: Bulk and Unsubscribe tags). So, this should be not a problem. Please, help me. What am I doing wrong? UPD: I also tried Unlocktheinbox.com test and the server also fails this test. Here is the result: http://bit.ly/wYr39h . Here is one more http://bit.ly/ypWLjr I also tried to send email from that server manually via telnet and everything is fine. Here is what I type: 220 mx.google.com ESMTP g15si4811326anb.170 HELO s2.corp.delo-company.com 250 mx.google.com at your service MAIL FROM: <[email protected]> 250 2.1.0 OK g15si4811326anb.170 RCPT TO: <[email protected]> 250 2.1.5 OK g15si4811326anb.170 DATA 354 Go ahead g15si4811326anb.170 From: [email protected] To: Pavel <[email protected]> Subject: Test 28 This is telnet test . 250 2.0.0 OK 1330795021 g15si4811326anb.170 QUIT 221 2.0.0 closing connection g15si4811326anb.170 And this is what I get: Delivered-To: [email protected] Received: by 10.227.132.73 with SMTP id a9csp96864wbt; Sat, 3 Mar 2012 09:17:02 -0800 (PST) Received: by 10.101.128.12 with SMTP id f12mr4837125ann.49.1330795021572; Sat, 03 Mar 2012 09:17:01 -0800 (PST) Return-Path: <[email protected]> Received: from s2.corp.delo-company.com (s2.corp.delo-company.com. [82.209.198.147]) by mx.google.com with SMTP id g15si4811326anb.170.2012.03.03.09.15.59; Sat, 03 Mar 2012 09:17:00 -0800 (PST) Received-SPF: pass (google.com: domain of [email protected] designates 82.209.198.147 as permitted sender) client-ip=82.209.198.147; Authentication-Results: mx.google.com; spf=pass (google.com: domain of [email protected] designates 82.209.198.147 as permitted sender) [email protected] Date: Sat, 03 Mar 2012 09:17:00 -0800 (PST) Message-Id: <[email protected]> From: [email protected] To: Pavel <[email protected]> Subject: Test 28 This is telnet test

    Read the article

  • improving conversions to binary and back in C#

    - by Saad Imran.
    I'm trying to write a general purpose socket server for a game I'm working on. I know I could very well use already built servers like SmartFox and Photon, but I wan't to go through the pain of creating one myself for learning purposes. I've come up with a BSON inspired protocol to convert the the basic data types, their arrays, and a special GSObject to binary and arrange them in a way so that it can be put back together into object form on the client end. At the core, the conversion methods utilize the .Net BitConverter class to convert the basic data types to binary. Anyways, the problem is performance, if I loop 50,000 times and convert my GSObject to binary each time it takes about 5500ms (the resulting byte[] is just 192 bytes per conversion). I think think this would be way too slow for an MMO that sends 5-10 position updates per second with a 1000 concurrent users. Yes, I know it's unlikely that a game will have a 1000 users on at the same time, but like I said earlier this is supposed to be a learning process for me, I want to go out of my way and build something that scales well and can handle at least a few thousand users. So yea, if anyone's aware of other conversion techniques or sees where I'm loosing performance I would appreciate the help. GSBitConverter.cs This is the main conversion class, it adds extension methods to main datatypes to convert to the binary format. It uses the BitConverter class to convert the base types. I've shown only the code to convert integer and integer arrays, but the rest of the method are pretty much replicas of those two, they just overload the type. public static class GSBitConverter { public static byte[] ToGSBinary(this short value) { return BitConverter.GetBytes(value); } public static byte[] ToGSBinary(this IEnumerable<short> value) { List<byte> bytes = new List<byte>(); short length = (short)value.Count(); bytes.AddRange(length.ToGSBinary()); for (int i = 0; i < length; i++) bytes.AddRange(value.ElementAt(i).ToGSBinary()); return bytes.ToArray(); } public static byte[] ToGSBinary(this bool value); public static byte[] ToGSBinary(this IEnumerable<bool> value); public static byte[] ToGSBinary(this IEnumerable<byte> value); public static byte[] ToGSBinary(this int value); public static byte[] ToGSBinary(this IEnumerable<int> value); public static byte[] ToGSBinary(this long value); public static byte[] ToGSBinary(this IEnumerable<long> value); public static byte[] ToGSBinary(this float value); public static byte[] ToGSBinary(this IEnumerable<float> value); public static byte[] ToGSBinary(this double value); public static byte[] ToGSBinary(this IEnumerable<double> value); public static byte[] ToGSBinary(this string value); public static byte[] ToGSBinary(this IEnumerable<string> value); public static string GetHexDump(this IEnumerable<byte> value); } Program.cs Here's the the object that I'm converting to binary in a loop. class Program { static void Main(string[] args) { GSObject obj = new GSObject(); obj.AttachShort("smallInt", 15); obj.AttachInt("medInt", 120700); obj.AttachLong("bigInt", 10900800700); obj.AttachDouble("doubleVal", Math.PI); obj.AttachStringArray("muppetNames", new string[] { "Kermit", "Fozzy", "Piggy", "Animal", "Gonzo" }); GSObject apple = new GSObject(); apple.AttachString("name", "Apple"); apple.AttachString("color", "red"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)1.5); GSObject lemon = new GSObject(); apple.AttachString("name", "Lemon"); apple.AttachString("color", "yellow"); apple.AttachBool("inStock", false); apple.AttachFloat("price", (float)0.8); GSObject apricoat = new GSObject(); apple.AttachString("name", "Apricoat"); apple.AttachString("color", "orange"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)1.9); GSObject kiwi = new GSObject(); apple.AttachString("name", "Kiwi"); apple.AttachString("color", "green"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)2.3); GSArray fruits = new GSArray(); fruits.AddGSObject(apple); fruits.AddGSObject(lemon); fruits.AddGSObject(apricoat); fruits.AddGSObject(kiwi); obj.AttachGSArray("fruits", fruits); Stopwatch w1 = Stopwatch.StartNew(); for (int i = 0; i < 50000; i++) { byte[] b = obj.ToGSBinary(); } w1.Stop(); Console.WriteLine(BitConverter.IsLittleEndian ? "Little Endian" : "Big Endian"); Console.WriteLine(w1.ElapsedMilliseconds + "ms"); } Here's the code for some of my other classes that are used in the code above. Most of it is repetitive. GSObject GSArray GSWrappedObject

    Read the article

  • Javascript stockticker : not showing data on php page

    - by developer
    iam not getting any javascript errors , code is getting rendered properly only, but still server not displaying data on the page. please check the code below . <style type="text/css"> #marqueeborder { color: #cccccc; background-color: #EEF3E2; font-family:"Lucida Console", Monaco, monospace; position:relative; height:20px; overflow:hidden; font-size: 0.7em; } #marqueecontent { position:absolute; left:0px; line-height:20px; white-space:nowrap; } .stockbox { margin:0 10px; } .stockbox a { color: #cccccc; text-decoration : underline; } </style> </head> <body> <div id="marqueeborder" onmouseover="pxptick=0" onmouseout="pxptick=scrollspeed"> <div id="marqueecontent"> <?php // Original script by Walter Heitman Jr, first published on http://techblog.shanock.com // List your stocks here, separated by commas, no spaces, in the order you want them displayed: $stocks = "idt,iye,mill,pwer,spy,f,msft,x,sbux,sne,ge,dow,t"; // Function to copy a stock quote CSV from Yahoo to the local cache. CSV contains symbol, price, and change function upsfile($stock) { copy("http://finance.yahoo.com/d/quotes.csv?s=$stock&f=sl1c1&e=.csv","stockcache/".$stock.".csv"); } foreach ( explode(",", $stocks) as $stock ) { // Where the stock quote info file should be... $local_file = "stockcache/".$stock.".csv"; // ...if it exists. If not, download it. if (!file_exists($local_file)) { upsfile($stock); } // Else,If it's out-of-date by 15 mins (900 seconds) or more, update it. elseif (filemtime($local_file) <= (time() - 900)) { upsfile($stock); } // Open the file, load our values into an array... $local_file = fopen ("stockcache/".$stock.".csv","r"); $stock_info = fgetcsv ($local_file, 1000, ","); // ...format, and output them. I made the symbols into links to Yahoo's stock pages. echo "<span class=\"stockbox\"><a href=\"http://finance.yahoo.com/q?s=".$stock_info[0]."\">".$stock_info[0]."</a> ".sprintf("%.2f",$stock_info[1])." <span style=\""; // Green prices for up, red for down if ($stock_info[2]>=0) { echo "color: #009900;\">&uarr;"; } elseif ($stock_info[2]<0) { echo "color: #ff0000;\">&darr;"; } echo sprintf("%.2f",abs($stock_info[2]))."</span></span>\n"; // Done! fclose($local_file); } ?> <span class="stockbox" style="font-size:0.6em">Quotes from <a href="http://finance.yahoo.com/">Yahoo Finance</a></span> </div> </div> </body> <script type="text/javascript"> // Original script by Walter Heitman Jr, first published on http://techblog.shanock.com // Set an initial scroll speed. This equates to the number of pixels shifted per tick var scrollspeed=2; var pxptick=scrollspeed; var marqueediv=''; var contentwidth=""; var marqueewidth = ""; function startmarquee(){ alert("hi"); // Make a shortcut referencing our div with the content we want to scroll marqueediv=document.getElementById("marqueecontent"); //alert("marqueediv"+marqueediv); alert("hi"+marqueediv.innerHTML); // Get the total width of our available scroll area marqueewidth=document.getElementById("marqueeborder").offsetWidth; alert("marqueewidth"+marqueewidth); // Get the width of the content we want to scroll contentwidth=marqueediv.offsetWidth; alert("contentwidth"+contentwidth); // Start the ticker at 50 milliseconds per tick, adjust this to suit your preferences // Be warned, setting this lower has heavy impact on client-side CPU usage. Be gentle. var lefttime=setInterval("scrollmarquee()",50); alert("lefttime"+lefttime); } function scrollmarquee(){ // Check position of the div, then shift it left by the set amount of pixels. if (parseInt(marqueediv.style.left)>(contentwidth*(-1))) marqueediv.style.left=parseInt(marqueediv.style.left)-pxptick+"px"; //alert("hikkk"+marqueediv.innerHTML);} // If it's at the end, move it back to the right. else{ alert("marqueewidth"+marqueewidth); marqueediv.style.left=parseInt(marqueewidth)+"px"; } } window.onload=startmarquee; </script> </html> Below is the server displayed page. I have updated with screenshot with your suggestion, i made change in html too, to check what is showing by child dev

    Read the article

  • Toggle visibility of DIV based on Dropdown

    - by user1869787
    I have never used Javascript before, only HTML and CSS. I am attempting to have my information show only when selected from my drop down. I don't know any Javascript so any help would be overly appreciated. This is my html so far: <!DOCTYPE HTML> <html> <head> <meta charset="utf-8" /> <title>Gone Fishin'</title> <link href="finale.css" rel="stylesheet" type="text/css"> </head> <div id="wrapper"> <div id="nav"> <ul> <li><a href="Index.html">About Us</a></li> <li><a href="Species.html">List by Species</a></li> <li><a href="County.html">List by County</a></li> <li><a href="apply.html">Reservations</a></li> </ul> </div> <body> <div id="content"> <p>ontent</p> <fieldset> <legend>Choose your Target</legend> <select name="option" id="options"> <option value=""></option> <option value="1">American Shad</option> <option value="2">Black Crappie</option> <option value="3">Bluegill</option> <option value="4">Brook Trout</option> <option value="5">Brown Trout</option> <option value="6">Carp</option> <option value="7">Chain Pickerel</option> <option value="8">Channel Catfish</option> <option value="9">Flathead Catfish</option> <option value="10">Largemouth Bass</option> <option value="11">Muskellunge</option> <option value="12">Norhtern Pike</option> <option value="13">Pumkpinseed</option> <option value="14">Rainbow Trout</option> <option value="15">Readbreast Sunfish</option> <option value="16">Rock Bass</option> <option value="17">Sauger</option> <option value="18">Saugeye</option> <option value="19">Smallmouth Bass</option> <option value="20">Steelhead</option> <option value="21">Striped Bass</option> <option value="22">Walleye</option> <option value="23">White Bass</option> <option value="24">White Crappie</option> <option value="25">White Perch</option> <option value="26">Yellow Perch</option> </select> <div id="option"> <div id="1" style="display: block">Test 1</div> <div id="2">Test 2</div> <div id="3">Test 3</div> <div id="4">Test 4</div> <div id="5">Test 5</div> </div> </fieldset> </div> </body> </div> </html> And this is my CSS: @charset "utf-8"; /* CSS Document */ /*General Styles*/ * {font-family:Verdana, Geneva, sans-serif;} #wrapper {width:85%; margin:auto; background-color:#00CC00;} /*End of General Styles*/ /* nav div styles */ #nav {background-color:#FF0000; text-align:center;} #nav ul li {display:inline-block; background-color: #67e667; border:5px dashed; width: 90px text-align:center;} #nav ul li a:link {background-color:#a60000; width: 90px;} #nav ul li a:visited {background-color: #009999;} #nav ul li a:hover {background-color: #a64b00;} /* end nav styles */ /* content div styles*/ #content {padding: 5px;} #option {display:none;} /*end content styles*/ /*start form styles*/ fieldset {background-color:#ff7400; color:white} label {display:inline-block; width: 150px; float:left; margin-right: 3px;} #form li{margin-bottom:10px;} #dtg li{margin-bottom:5px;} Thank you for any help received

    Read the article

  • How to use CLEAR USB internet connection in Ubuntu (host) and WindowsXP (guest) using VirtualBox

    - by bithacker
    I'm trying to use CLEAR Motorola WiMax USB in Ubuntu as there is no support for linux as yet. I've installed windowsxp as guest in ubuntu and the version I'm using is 3.2.2. USB is connecting fine in WindowsXP but I can't use internet in Ubuntu. Can you please tell me how to do it. Here is the configuration that could help you guys. Thanks in advance. I'm using Two Network Adapters. Network Adapter 1: PCnet-FAST III (NAT) Adapter 2: PCnet-FAST III (Host-only adapter, 'vboxnet0') ipconfig [on Guest windowsXP] Windows IP Configuration Ethernet adapter Local Area Connection: PCnet-FAST III (NAT) Connection-specific DNS Suffix . : IP Address. . . . . . . . . . . . : 10.0.2.15 Subnet Mask . . . . . . . . . . . : 255.255.255.0 Default Gateway . . . . . . . . . : 10.0.2.2 Ethernet adapter Local Area Connection 3: PCnet-FAST III (Host-only adapter, 'vboxnet0') Connection-specific DNS Suffix . : IP Address. . . . . . . . . . . . : 192.168.56.101 Subnet Mask . . . . . . . . . . . : 255.255.255.0 Default Gateway . . . . . . . . . : Ethernet adapter Local Area Connection 2: Connection-specific DNS Suffix . : CLEAR Motorola USB IP Address. . . . . . . . . . . . : 10.168.242.33 Subnet Mask . . . . . . . . . . . : 255.255.192.0 Default Gateway . . . . . . . . . : 10.168.192.2 IFCONFIG [on Host Ubuntu] (Ethernet) eth0 Link encap:Ethernet HWaddr 00:14:22:b9:9d:76 UP BROADCAST MULTICAST MTU:1500 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:0 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:0 (0.0 B) TX bytes:0 (0.0 B) Interrupt:16 eth1 (Wireless) Link encap:Ethernet HWaddr 00:13:ce:f0:9b:0d inet6 addr: fe80::213:ceff:fef0:9b0d/64 Scope:Link UP BROADCAST MULTICAST MTU:1500 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:1 errors:0 dropped:5 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:0 (0.0 B) TX bytes:84 (84.0 B) Interrupt:17 Base address:0xe000 Memory:dfcff000-dfcfffff lo Link encap:Local Loopback inet addr:127.0.0.1 Mask:255.0.0.0 inet6 addr: ::1/128 Scope:Host UP LOOPBACK RUNNING MTU:16436 Metric:1 RX packets:2292 errors:0 dropped:0 overruns:0 frame:0 TX packets:2292 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:0 RX bytes:171952 (171.9 KB) TX bytes:171952 (171.9 KB) vboxnet0 Link encap:Ethernet HWaddr 0a:00:27:00:00:00 inet addr:192.168.56.1 Bcast:192.168.56.255 Mask:255.255.255.0 inet6 addr: fe80::800:27ff:fe00:0/64 Scope:Link UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:137 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:0 (0.0 B) TX bytes:21174 (21.1 KB)

    Read the article

  • Optimize php-fpm and varnish for a powerfull server

    - by Jim
    My setup is: Intel® Core™ i7-2600 and RAM 16 GB DDR3 RAM varnish+nginx+php-fpm+apc for a not very heavy WordPress blog with W3 Total Cache and CDN My problem is that after 55 hits per second according to blitz.io varnish starts giving out timeouts. CPU usage at this time is hardly 1%. Free memory at all time remains 10GB+. I tried benchmarking php-fpm directly with result of 150hits/s without any timeouts. But after that the CPU usage goes 100% and it stops responding. Can you help me optimize it to handle more? As i understand nginx has nothing to do over here so i dont put its config. php-fpm config listen = /tmp/php5-fpm.sock listen.allowed_clients = 127.0.0.1 user = nginx group = nginx pm = dynamic pm.max_children = 150 pm.start_servers = 7 pm.min_spare_servers = 2 pm.max_spare_servers = 15 pm.max_requests = 500 slowlog = /var/log/php-fpm/www-slow.log php_admin_value[error_log] = /var/log/php-fpm/www-error.log php_admin_flag[log_errors] = on apc extension = apc.so apc.enabled=1 apc.shm_size=512MB apc.num_files_hint=0 apc.user_entries_hint=0 apc.ttl=7200 apc.use_request_time=1 apc.user_ttl=7200 apc.gc_ttl=3600 apc.cache_by_default=1 apc.filters apc.mmap_file_mask=/tmp/apc.XXXXXX apc.file_update_protection=2 apc.enable_cli=0 apc.max_file_size=1M apc.stat=1 apc.stat_ctime=0 apc.canonicalize=0 apc.write_lock=1 apc.report_autofilter=0 apc.rfc1867=0 apc.rfc1867_prefix =upload_ apc.rfc1867_name=APC_UPLOAD_PROGRESS apc.rfc1867_freq=0 apc.rfc1867_ttl=3600 apc.include_once_override=0 apc.lazy_classes=0 apc.lazy_functions=0 apc.coredump_unmap=0 apc.file_md5=0 apc.preload_path Varnish VCL backend default { .host = "127.0.0.1"; .port = "8080"; .connect_timeout = 6s; .first_byte_timeout = 6s; .between_bytes_timeout = 60s; } acl purgehosts { "localhost"; "127.0.0.1"; } # Called after a document has been successfully retrieved from the backend. sub vcl_fetch { # Uncomment to make the default cache "time to live" is 5 minutes, handy # but it may cache stale pages unless purged. (TODO) # By default Varnish will use the headers sent to it by Apache (the backend server) # to figure out the correct TTL. # WP Super Cache sends a TTL of 3 seconds, set in wp-content/cache/.htaccess set beresp.ttl = 24h; # Strip cookies for static files and set a long cache expiry time. if (req.url ~ "\.(jpg|jpeg|gif|png|ico|css|zip|tgz|gz|rar|bz2|pdf|txt|tar|wav|bmp|rtf|js|flv|swf|html|htm)$") { unset beresp.http.set-cookie; set beresp.ttl = 24h; } # If WordPress cookies found then page is not cacheable if (req.http.Cookie ~"(wp-postpass|wordpress_logged_in|comment_author_)") { # set beresp.cacheable = false;#versions less than 3 #beresp.ttl>0 is cacheable so 0 will not be cached set beresp.ttl = 0s; } else { #set beresp.cacheable = true; set beresp.ttl=24h;#cache for 24hrs } # Varnish determined the object was not cacheable #if ttl is not > 0 seconds then it is cachebale if (!beresp.ttl > 0s) { # set beresp.http.X-Cacheable = "NO:Not Cacheable"; } else if ( req.http.Cookie ~"(wp-postpass|wordpress_logged_in|comment_author_)" ) { # You don't wish to cache content for logged in users set beresp.http.X-Cacheable = "NO:Got Session"; return(hit_for_pass); #previously just pass but changed in v3+ } else if ( beresp.http.Cache-Control ~ "private") { # You are respecting the Cache-Control=private header from the backend set beresp.http.X-Cacheable = "NO:Cache-Control=private"; return(hit_for_pass); } else if ( beresp.ttl < 1s ) { # You are extending the lifetime of the object artificially set beresp.ttl = 300s; set beresp.grace = 300s; set beresp.http.X-Cacheable = "YES:Forced"; } else { # Varnish determined the object was cacheable set beresp.http.X-Cacheable = "YES"; if (beresp.status == 404 || beresp.status >= 500) { set beresp.ttl = 0s; } # Deliver the content return(deliver); } sub vcl_hash { # Each cached page has to be identified by a key that unlocks it. # Add the browser cookie only if a WordPress cookie found. if ( req.http.Cookie ~"(wp-postpass|wordpress_logged_in|comment_author_)" ) { #set req.hash += req.http.Cookie; hash_data(req.http.Cookie); } } # vcl_recv is called whenever a request is received sub vcl_recv { # remove ?ver=xxxxx strings from urls so css and js files are cached. # Watch out when upgrading WordPress, need to restart Varnish or flush cache. set req.url = regsub(req.url, "\?ver=.*$", ""); # Remove "replytocom" from requests to make caching better. set req.url = regsub(req.url, "\?replytocom=.*$", ""); remove req.http.X-Forwarded-For; set req.http.X-Forwarded-For = client.ip; # Exclude this site because it breaks if cached if ( req.http.host == "sr.ituts.gr" ) { return( pass ); } # Serve objects up to 2 minutes past their expiry if the backend is slow to respond. set req.grace = 120s; # Strip cookies for static files: if (req.url ~ "\.(jpg|jpeg|gif|png|ico|css|zip|tgz|gz|rar|bz2|pdf|txt|tar|wav|bmp|rtf|js|flv|swf|html|htm)$") { unset req.http.Cookie; return(lookup); } # Remove has_js and Google Analytics __* cookies. set req.http.Cookie = regsuball(req.http.Cookie, "(^|;\s*)(__[a-z]+|has_js)=[^;]*", ""); # Remove a ";" prefix, if present. set req.http.Cookie = regsub(req.http.Cookie, "^;\s*", ""); # Remove empty cookies. if (req.http.Cookie ~ "^\s*$") { unset req.http.Cookie; } if (req.request == "PURGE") { if (!client.ip ~ purgehosts) { error 405 "Not allowed."; } #previous version ban() was purge() ban("req.url ~ " + req.url + " && req.http.host == " + req.http.host); error 200 "Purged."; } # Pass anything other than GET and HEAD directly. if (req.request != "GET" && req.request != "HEAD") { return( pass ); } /* We only deal with GET and HEAD by default */ # remove cookies for comments cookie to make caching better. set req.http.cookie = regsub(req.http.cookie, "1231111111111111122222222333333=[^;]+(; )?", ""); # never cache the admin pages, or the server-status page, or your feed? you may want to..i don't if (req.request == "GET" && (req.url ~ "(wp-admin|bb-admin|server-status|feed)")) { return(pipe); } # don't cache authenticated sessions if (req.http.Cookie && req.http.Cookie ~ "(wordpress_|PHPSESSID)") { return(lookup); } # don't cache ajax requests if(req.http.X-Requested-With == "XMLHttpRequest" || req.url ~ "nocache" || req.url ~ "(control.php|wp-comments-post.php|wp-login.php|bb-login.php|bb-reset-password.php|register.php)") { return (pass); } return( lookup ); } Varnish Daemon options DAEMON_OPTS="-a :80 \ -T 127.0.0.1:6082 \ -f /etc/varnish/ituts.vcl \ -u varnish -g varnish \ -S /etc/varnish/secret \ -p thread_pool_add_delay=2 \ -p thread_pools=8 \ -p thread_pool_min=100 \ -p thread_pool_max=1000 \ -p session_linger=50 \ -p session_max=150000 \ -p sess_workspace=262144 \ -s malloc,5G" Im not sure where to start, should i for start optimize php-fpm and then go to varnish or php-fpm is at its max right now so i should start looking for the problem in varnish?

    Read the article

  • creating a Menu from SQLite values in Java

    - by shanahobo86
    I am trying to create a ListMenu using data from an SQLite database to define the name of each MenuItem. So in a class called menu.java I have defined the array String classes [] = {}; which should hold each menu item name. In a DBAdapter class I created a function so the user can insert info to a table (This all works fine btw). public long insertContact(String name, String code, String location, String comments, int days, int start, int end, String type) { ContentValues initialValues = new ContentValues(); initialValues.put(KEY_NAME, name); initialValues.put(KEY_CODE, code); initialValues.put(KEY_LOCATION, location); initialValues.put(KEY_COMMENTS, comments); initialValues.put(KEY_DAYS, days); initialValues.put(KEY_START, start); initialValues.put(KEY_END, end); initialValues.put(KEY_TYPE, type); return db.insert(DATABASE_TABLE, null, initialValues); } It would be the Strings inserted into KEY_NAME that I need to populate that String array with. Does anyone know if this is possible? Thanks so much for the help guys. If I implement that function by Sam/Mango the program crashes, am I using it incorrectly or is the error due to the unknown size of the array? DBAdapter db = new DBAdapter(this); String classes [] = db.getClasses(); edit: I should mention that if I manually define the array: String classes [] = {"test1", "test2", "test3", etc}; It works fine. The error is a NullPointerException Here's the logcat (sorry about the formatting). I hadn't initialized with db = helper.getReadableDatabase(); in the getClasses() function but unfortunately it didn't fix the problem. 11-11 22:53:39.117: D/dalvikvm(17856): Late-enabling CheckJNI 11-11 22:53:39.297: D/TextLayoutCache(17856): Using debug level: 0 - Debug Enabled: 0 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libGLES_android.so 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libEGL_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv1_CM_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv2_adreno200.so 11-11 22:53:39.387: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:39.407: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c66d000 size:36593664 offset:32825344 fd:65 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: D/OpenGLRenderer(17856): Enabling debug mode 0 11-11 22:53:39.477: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5ecd3000 size:40361984 offset:36593664 fd:68 11-11 22:53:40.507: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61451000 size:7254016 offset:3485696 fd:71 11-11 22:53:41.077: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:41.077: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c4c000 size:7725056 offset:7254016 fd:74 11-11 22:53:41.097: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x623aa000 size:8196096 offset:7725056 fd:80 11-11 22:53:41.937: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x62b7b000 size:8667136 offset:8196096 fd:83 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61c4c000 size:7725056 offset:7254016 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x623aa000 size:8196096 offset:7725056 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x62b7b000 size:8667136 offset:8196096 11-11 22:53:42.167: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:42.177: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c5d000 size:17084416 offset:13316096 fd:74 11-11 22:53:42.317: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x63853000 size:20852736 offset:17084416 fd:80 11-11 22:53:42.357: D/OpenGLRenderer(17856): Flushing caches (mode 0) 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5c66d000 size:36593664 offset:32825344 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5ecd3000 size:40361984 offset:36593664 11-11 22:53:42.367: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61451000 size:7254016 offset:3485696 11-11 22:53:42.757: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c56d000 size:24621056 offset:20852736 fd:65 11-11 22:53:44.247: D/AndroidRuntime(17856): Shutting down VM 11-11 22:53:44.247: W/dalvikvm(17856): threadid=1: thread exiting with uncaught exception (group=0x40ac3210) 11-11 22:53:44.257: E/AndroidRuntime(17856): FATAL EXCEPTION: main 11-11 22:53:44.257: E/AndroidRuntime(17856): java.lang.RuntimeException: Unable to instantiate activity ComponentInfo{niall.shannon.timetable/niall.shannon.timetable.menu}: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1891) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1992) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.access$600(ActivityThread.java:127) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1158) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Handler.dispatchMessage(Handler.java:99) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Looper.loop(Looper.java:137) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.main(ActivityThread.java:4441) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invokeNative(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invoke(Method.java:511) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:823) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:590) 11-11 22:53:44.257: E/AndroidRuntime(17856): at dalvik.system.NativeStart.main(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): Caused by: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.content.ContextWrapper.openOrCreateDatabase(ContextWrapper.java:221) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.database.sqlite.SQLiteOpenHelper.getWritableDatabase(SQLiteOpenHelper.java:157) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.DBAdapter.getClasses(DBAdapter.java:151) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.menu.<init>(menu.java:15) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstanceImpl(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstance(Class.java:1319) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.Instrumentation.newActivity(Instrumentation.java:1023) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1882) 11-11 22:53:44.257: E/AndroidRuntime(17856): ... 11 more 11-11 22:53:46.527: I/Process(17856): Sending signal. PID: 17856 SIG: 9

    Read the article

  • Calculix Data Visualiser using QT

    - by Ann
    I am doing a project on CalculiX data visualizor,using Qt.I 've to draw the structure and after giving force the displacement should be shawn as variation in color.I chose HSV coloring,but while executing I got an error message:"QColor::from Hsv:HSV parameters out of range".The code is: DataViz1::DataViz1(QWidget *parent) : QWidget(parent), ui(new Ui::DataViz1) { DArea = new QGLScreen(this); DArea-setGeometry(QRect(10,10,700,600)); //TODO This values are feeded by user dfile="/home/41407/color.txt";//input file with displacement mfile="/home/41407/mesh21.txt";//input file nodeId="*NODE"; elId="*ELEMENT"; DataId="displ"; parseMfile(); parseDfile(); DArea->Nodes=Nodes; DArea->Elements=Elements; DArea->Data=Data; DArea->fillColorArray(); //printf("Colr is %d",DArea->pickColor(-11.02,0));fflush(stdout); ui->setupUi(this); } DataViz1::~DataViz1() { delete ui; } void DataViz1::parseMfile() { QFile file(mfile); if (!file.open(QIODevice::ReadOnly | QIODevice::Text)) return; int node_end=0; QTextStream in(&file); in.skipWhiteSpace(); while (!in.atEnd()) { QString line = in.readLine(); if(line.startsWith(nodeId))//Node block in Mfile { while(1) { line = in.readLine(); if(line.startsWith(elId)) { break; } Nodes< while(1) { line = in.readLine(); Elements<<line; //printf("Element is %s\n",line.toLocal8Bit().constData());fflush(stdout); if(in.atEnd()) break; } } } } void DataViz1::parseDfile() { QFile file(dfile); if (!file.open(QIODevice::ReadOnly | QIODevice::Text)) return; int node_end=0; QTextStream in(&file); in.skipWhiteSpace(); while (!in.atEnd()) { QString line = in.readLine(); if(line.startsWith(DataId)) { continue; } line = in.readLine(); Data< } /......................................................................../ include "qglscreen.h" include GLfloat LightAmbient[]= { 0.5f, 0.5f, 0.5f, 1.0f }; GLfloat LightDiffuse[]= { 1.0f, 1.0f, 1.0f, 1.0f }; GLfloat LightPosition[]= { 0.0f, 0.0f, 2.0f, 1.0f }; QGLScreen::QGLScreen(QWidget *parent):QGLWidget(QGLFormat(QGL::SampleBuffers), parent) { clearColor = Qt::black; xRot = 0; yRot = 0; zRot = 0; ifdef QT_OPENGL_ES_2 program = 0; endif //TODO user input ElType="HE8"; DType="SolidFrame"; axis="X"; } QGLScreen::~QGLScreen() { } QSize QGLScreen::minimumSizeHint() const { return QSize(50, 50); } QSize QGLScreen::sizeHint() const { return QSize(200, 200); } void QGLScreen::setClearColor(const QColor &color) { clearColor = color; updateGL(); } void QGLScreen::initializeGL() { xRot=0; yRot=0; zRot=0; scaling = 1.0; /* select clearing (background) color */ glClearColor (0.0, 0.0, 0.0, 0.0); glMatrixMode(GL_PROJECTION); glLoadIdentity(); // glViewport(0,0,10,10); glOrtho(-10.0, +10.0, -10.0, +10.0, -10.0,+10.0); glEnable (GL_LINE_SMOOTH); glHint (GL_LINE_SMOOTH_HINT, GL_DONT_CARE); } void QGLScreen::wheel1() { scaling1 += .0025; count2++; update(); } void QGLScreen::wheel2() { if(count2-14) { scaling1 -= .0025; count2--; update(); } } void QGLScreen::drawModel(int x1,int y1,int x2,int y2) { makeCurrent(); QStringList Cnode,Celement; for (int i = 0; i < Elements.size(); ++i) { Celement=Elements.at(i).split(","); // printf("Element is %s",Celement.at(0).toLocal8Bit().constData());fflush(stdout); //printf("Node at el is %s\n",(findNode(Celement.at(1).toInt())).at(1).toLocal8Bit().constData()); fflush(stdout); if(ElType=="HE8") { //First four nodes float ENX1=(findNode(Celement.at(1).toInt())).at(1).toDouble(); float ENX2=(findNode(Celement.at(2).toInt())).at(1).toDouble(); float ENX3=(findNode(Celement.at(3).toInt())).at(1).toDouble(); float ENX4=(findNode(Celement.at(4).toInt())).at(1).toDouble(); float ENY1=(findNode(Celement.at(1).toInt())).at(2).toDouble(); float ENY2=(findNode(Celement.at(2).toInt())).at(2).toDouble(); float ENY3=(findNode(Celement.at(3).toInt())).at(2).toDouble(); float ENY4=(findNode(Celement.at(4).toInt())).at(2).toDouble(); float ENZ1=(findNode(Celement.at(1).toInt())).at(3).toDouble(); float ENZ2=(findNode(Celement.at(2).toInt())).at(3).toDouble(); float ENZ3=(findNode(Celement.at(3).toInt())).at(3).toDouble(); float ENZ4=(findNode(Celement.at(4).toInt())).at(3).toDouble(); //Second four Nodes float ENX5=(findNode(Celement.at(5).toInt())).at(1).toDouble(); float ENX6=(findNode(Celement.at(6).toInt())).at(1).toDouble(); float ENX7=(findNode(Celement.at(7).toInt())).at(1).toDouble(); float ENX8=(findNode(Celement.at(8).toInt())).at(1).toDouble(); float ENY5=(findNode(Celement.at(5).toInt())).at(2).toDouble(); float ENY6=(findNode(Celement.at(6).toInt())).at(2).toDouble(); float ENY7=(findNode(Celement.at(7).toInt())).at(2).toDouble(); float ENY8=(findNode(Celement.at(8).toInt())).at(2).toDouble(); float ENZ5=(findNode(Celement.at(5).toInt())).at(3).toDouble(); float ENZ6=(findNode(Celement.at(6).toInt())).at(3).toDouble(); float ENZ7=(findNode(Celement.at(7).toInt())).at(3).toDouble(); float ENZ8=(findNode(Celement.at(8).toInt())).at(3).toDouble(); //Identify Colors GLfloat ENC[8][3]; for(int k=1;k<8;k++) { int hsv=pickColor(findData(Celement.at(k).toInt()).toDouble(),0); //printf("hsv is %d=",hsv);fflush(stdout); getRGB(hsv); //printf("%d*%d*%d\n",red,green,blue); //ENC[k]={red,green,blue}; ENC[k][0]=red; ENC[k][1]=green; ENC[k][2]=blue; } //Plot the first four direct loop if(DType=="WireFrame"){ glBegin(GL_LINE_LOOP); glColor3f(255,0,0); glVertex3f(ENX1,ENY1,ENZ1); glColor3f(255,0,0); glVertex3f(ENX2,ENY2,ENZ2); glColor3f(255,0,0); glVertex3f(ENX3,ENY3,ENZ3); glColor3f(255,0,0); glVertex3f(ENX4,ENY4,ENZ4); glEnd(); //Plot the second four direct loop glBegin(GL_LINE_LOOP); glColor3f(0,0,255); glVertex3f(ENX5,ENY5,ENZ5); glColor3f(0,0,255); glVertex3f(ENX6,ENY6,ENZ6); glColor3f(0,0,255); glVertex3f(ENX7,ENY7,ENZ7); glColor3f(0,0,255); glVertex3f(ENX8,ENY8,ENZ8); glEnd(); //Plot the interconnections glBegin(GL_LINE); glColor3f(150,150,150); glVertex3f(ENX1,ENY1,ENZ1); glVertex3f(ENX5,ENY5,ENZ5); glEnd(); glBegin(GL_LINE); glColor3f(150,150,150); glVertex3f(ENX2,ENY2,ENZ2); glVertex3f(ENX6,ENY6,ENZ6); glEnd(); glBegin(GL_LINE); glColor3f(150,150,150); glVertex3f(ENX3,ENY3,ENZ3); glVertex3f(ENX7,ENY7,ENZ7); glEnd(); glBegin(GL_LINE); glColor3f(150,150,150); glVertex3f(ENX4,ENY4,ENZ4); glVertex3f(ENX8,ENY8,ENZ8); glEnd(); } if(DType=="SolidFrame") { glBegin(GL_QUADS); glColor3fv(ENC[1]); glVertex3f(ENX1,ENY1,ENZ1); glColor3fv(ENC[2]); glVertex3f(ENX2,ENY2,ENZ2); glColor3fv(ENC[3]); glVertex3f(ENX3,ENY3,ENZ3); glColor3fv(ENC[4]); glVertex3f(ENX4,ENY4,ENZ4); glEnd(); //break; glBegin(GL_QUADS); glColor3fv(ENC[5]); glVertex3f(ENX5,ENY5,ENZ5); glColor3fv(ENC[6]); glVertex3f(ENX6,ENY6,ENZ6); glColor3fv(ENC[7]); glVertex3f(ENX7,ENY7,ENZ7); glColor3fv(ENC[8]); glVertex3f(ENX8,ENY8,ENZ8); glEnd(); glBegin(GL_QUAD_STRIP); glColor3fv(ENC[1]); glVertex3f(ENX1,ENY1,ENZ1); glColor3fv(ENC[5]); glVertex3f(ENX5,ENY5,ENZ5); glColor3fv(ENC[2]); glVertex3f(ENX2,ENY2,ENZ2); glColor3fv(ENC[6]); glVertex3f(ENX6,ENY6,ENZ6); glEnd(); glBegin(GL_QUAD_STRIP); glColor3fv(ENC[3]); glVertex3f(ENX3,ENY3,ENZ3); glColor3fv(ENC[7]); glVertex3f(ENX7,ENY7,ENZ7); glColor3fv(ENC[4]); glVertex3f(ENX4,ENY4,ENZ4); glColor3fv(ENC[8]); glVertex3f(ENX8,ENY8,ENZ8); glEnd(); glBegin(GL_QUAD_STRIP); glColor3fv(ENC[2]); glVertex3f(ENX2,ENY2,ENZ2); glColor3fv(ENC[6]); glVertex3f(ENX6,ENY6,ENZ6); glColor3fv(ENC[3]); glVertex3f(ENX3,ENY3,ENZ3); glColor3fv(ENC[7]); glVertex3f(ENX7,ENY7,ENZ7); glEnd(); glBegin(GL_QUAD_STRIP); glColor3fv(ENC[1]); glVertex3f(ENX1,ENY1,ENZ1); glColor3fv(ENC[5]); glVertex3f(ENX5,ENY5,ENZ5); glColor3fv(ENC[4]); glVertex3f(ENX4,ENY4,ENZ4); glColor3fv(ENC[8]); glVertex3f(ENX8,ENY8,ENZ8); glEnd(); } } } } QStringList QGLScreen::findNode(int element) { QStringList Temp; for (int i = 0; i < Nodes.size(); ++i) { Temp=Nodes.at(i).split(","); if(Temp.at(0).toInt()==element) { break; } } return Temp; } QString QGLScreen::findData(int Node) { QString Temp; QRegExp sep("\s+"); for (int i = 0; i < Data.size(); ++i) { if((Data.at(i).split("\t")).at(0).section(sep,1,1).toInt()==Node) { if(axis=="X") { Temp=Data.at(i).split("\t").at(0).section(sep,2,2); } if(axis=="Y") { Temp=Data.at(i).split("\t").at(0).section(sep,3,3); } if(axis=="Z") { Temp=Data.at(i).split("\t").at(0).section(sep,4,4); } break; } } return Temp; } void QGLScreen::fillColorArray() { QString Temp1,Temp2,Temp3; double d1s=0,d2s=0,d3s=0,d1l=0,d2l=0,d3l=0,diff=0; QRegExp sep("\\s+"); for (int i = 0; i < Data.size(); ++i) { Temp1=(Data.at(i).split("\t")).at(0).section(sep,2,2); if(d1s>Temp1.toDouble()) { d1s=Temp1.toDouble(); } if(d1l<Temp1.toDouble()) { d1l=Temp1.toDouble(); } Temp2=(Data.at(i).split("\t")).at(0).section(sep,3,3); if(d2s>Temp2.toDouble()) { d2s=Temp2.toDouble(); } if(d2l<Temp2.toDouble()) { d2l=Temp2.toDouble(); } Temp3=(Data.at(i).split("\t")).at(0).section(sep,4,4); if(d3s>Temp3.toDouble()) { d3s=Temp3.toDouble(); } if(d3l<Temp3.toDouble()) { d3l=Temp3.toDouble(); } // printf("data is %s",Temp.toLocal8Bit().constData());fflush(stdout); } color[0][0]=d1l; for(int i=1;i<360;i++) { //printf("Large is%f small is %f",d1l,d1s); diff=d1l-d1s; if(d1l==0&&d1s<0) color[0][i]=color[0][i-1]-diff/360; else if(d1l>0&&d1s==0) color[0][i]=color[0][i-1]+diff/360; else if(d1l>0&&d1s<0) color[0][i]=color[0][i-1]-diff/360; diff=d2l-d2s; if(d2l==0&&d2s<0) color[1][i]=color[1][i-1]-diff/360; else if(d2l>0&&d2s==0) color[1][i]=color[1][i-1]+diff/360; else if(d2l>0&&d2s<0) color[1][i]=color[1][i-1]-diff/360; diff=d3l-d3s; if(d3l==0&&d3s<0) color[2][i]=color[2][i-1]-diff/360; else if(d3l>0&&d3s==0) color[2][i]=color[2][i-1]+diff/360; else if(d3l>0&&d3s<0) color[2][i]=color[2][i-1]-diff/360; } //for(int i=0;i<360;i++) printf("%d %f %f %f\n",i,color[0][i],color[1][i],color[2][i]); } int QGLScreen::pickColor(double data,int Did) { int i,pos; if(axis=="X")Did=0; if(axis=="Y")Did=1; if(axis=="Z")Did=2; //printf("%f data is",data);fflush(stdout); for(int i=0;i<360;i++) { if(color[Did][i]<data && data>color[Did][i+1]) { //printf("Orginal dat is %f Data found is %f and pos %d\n",data,color[Did][i],i);fflush(stdout); pos=i; break; } } return pos; } void QGLScreen::getRGB(int hsv) { QColor c; c.setHsv(hsv,255,255,255); QColor r=QColor::fromHsv(hsv,255,255); red=r.red(); green=r.green(); blue=r.blue(); } void QGLScreen::paintGL() { glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); glPushAttrib(GL_ALL_ATTRIB_BITS); glMatrixMode(GL_PROJECTION); glPushMatrix(); glLoadIdentity(); GLfloat x = 3.0 * GLfloat(width()) / height(); glOrtho(-x, +x, -3.0, +3.0, 4.0, 15.0); glMatrixMode(GL_MODELVIEW); glPushMatrix(); glLoadIdentity(); glTranslatef(0.0, 0.0, -10.0); glScalef(scaling, scaling, scaling); glRotatef(xRot, 1.0, 0.0, 0.0); glRotatef(yRot, 0.0, 1.0, 0.0); glRotatef(zRot, 0.0, 0.0, 1.0); drawModel(0,0,1,1); /* don't wait! * start processing buffered OpenGL routines */ glFlush (); } /void QGLScreen::zoom1() { scaling+=.05; update(); }/ void QGLScreen::resizeGL(int width, int height) { int side = qMin(width, height); glViewport((width - side) / 2, (height - side) / 2, side, side); #if !defined(QT_OPENGL_ES_2) glMatrixMode(GL_PROJECTION); glLoadIdentity(); #ifndef QT_OPENGL_ES glOrtho(-0.5, +0.5, +0.5, -0.5, 4.0, 15.0); #else glOrthof(-0.5, +0.5, +0.5, -0.5, 4.0, 15.0); #endif glMatrixMode(GL_MODELVIEW); #endif } void QGLScreen::mousePressEvent(QMouseEvent *event) { lastPos = event-pos(); } void QGLScreen::mouseMoveEvent(QMouseEvent *event) { GLfloat dx = GLfloat(event->x() - lastPos.x()) / width(); GLfloat dy = GLfloat(event->y() - lastPos.y()) / height(); if (event->buttons() & Qt::LeftButton) { xRot+= 180 * dy; yRot += 180 * dx; update(); } else if (event->buttons() & Qt::RightButton) { xRot += 180 * dy; yRot += 180 * dx; update(); } lastPos = event->pos(); } void QGLScreen::mouseReleaseEvent(QMouseEvent * /* event */) { emit clicked(); }

    Read the article

  • cannot access a site from Mac OSX Lion but can from other machines on network?

    - by house9
    SOLVED: The issue is with the hamachi client, hamachi is hi-jacking all of the 5.0.0.0/8 address block http://en.wikipedia.org/wiki/Hamachi_(software)#Criticism http://b.logme.in/2012/11/07/changes-to-hamachi-on-november-19th/ The fix on Mac LogMeIn Hamachi Preferences Settings Advanced Peer Connections IP protocol mode IPv6 only (default is both) If you can only connect to some of your network over IPv4 this 'fix' will NOT work for you ----- A few weeks ago I started using a service - https://semaphoreapp.com I think they made DNS changes a week ago and ever since I cannot access the site from my Mac OSX Lion (10.7.4) machine (my main development machine) but I can access the site from other machines on my network ipad windows machine MacMini (10.6.8) After some google searching I tried both of these dscacheutil -flushcache sudo killall -HUP mDNSResponder but no go, I've contacted semaphoreapp as well, but nothing so far - also of interest, one of my colleagues has the exact same problem, cannot access via Mac OSX Lion but can via windows machine, we work remotely and are not on the same ISP some additional info Lion (10.7.4) cannot access site host semaphoreapp.com semaphoreapp.com has address 5.9.53.16 ping semaphoreapp.com PING semaphoreapp.com (5.9.53.16): 56 data bytes Request timeout for icmp_seq 0 Request timeout for icmp_seq 1 Request timeout for icmp_seq 2 Request timeout for icmp_seq 3 ping: sendto: No route to host Request timeout for icmp_seq 4 ping: sendto: Host is down Request timeout for icmp_seq 5 ping: sendto: Host is down Request timeout for icmp_seq 6 ping: sendto: Host is down Request timeout for icmp_seq 7 .... traceroute semaphoreapp.com traceroute to semaphoreapp.com (5.9.53.16), 64 hops max, 52 byte packets 1 * * * 2 * * * traceroute: sendto: No route to host 3 traceroute: wrote semaphoreapp.com 52 chars, ret=-1 *traceroute: sendto: Host is down traceroute: wrote semaphoreapp.com 52 chars, ret=-1 .... and MacMini (10.6.8) can access it host semaphoreapp.com semaphoreapp.com has address 5.9.53.16 ping semaphoreapp.com PING semaphoreapp.com (5.9.53.16): 56 data bytes 64 bytes from 5.9.53.16: icmp_seq=0 ttl=44 time=191.458 ms 64 bytes from 5.9.53.16: icmp_seq=1 ttl=44 time=202.923 ms 64 bytes from 5.9.53.16: icmp_seq=2 ttl=44 time=180.746 ms 64 bytes from 5.9.53.16: icmp_seq=3 ttl=44 time=200.616 ms 64 bytes from 5.9.53.16: icmp_seq=4 ttl=44 time=178.818 ms .... traceroute semaphoreapp.com traceroute to semaphoreapp.com (5.9.53.16), 64 hops max, 52 byte packets 1 192.168.0.1 (192.168.0.1) 1.677 ms 1.446 ms 1.445 ms 2 * LOCAL ISP 11.957 ms * 3 etc... 10.704 ms 14.183 ms 9.341 ms 4 etc... 32.641 ms 12.147 ms 10.850 ms 5 etc.... 44.205 ms 54.563 ms 36.243 ms 6 vlan139.car1.seattle1.level3.net (4.53.145.165) 50.136 ms 45.873 ms 30.396 ms 7 ae-32-52.ebr2.seattle1.level3.net (4.69.147.182) 31.926 ms 40.507 ms 49.993 ms 8 ae-2-2.ebr2.denver1.level3.net (4.69.132.54) 78.129 ms 59.674 ms 49.905 ms 9 ae-3-3.ebr1.chicago2.level3.net (4.69.132.62) 99.019 ms 82.008 ms 76.074 ms 10 ae-1-100.ebr2.chicago2.level3.net (4.69.132.114) 96.185 ms 75.658 ms 75.662 ms 11 ae-6-6.ebr2.washington12.level3.net (4.69.148.145) 104.322 ms 105.563 ms 118.480 ms 12 ae-5-5.ebr2.washington1.level3.net (4.69.143.221) 93.646 ms 99.423 ms 96.067 ms 13 ae-41-41.ebr2.paris1.level3.net (4.69.137.49) 177.744 ms ae-44-44.ebr2.paris1.level3.net (4.69.137.61) 199.363 ms 198.405 ms 14 ae-47-47.ebr1.frankfurt1.level3.net (4.69.143.141) 176.876 ms ae-45-45.ebr1.frankfurt1.level3.net (4.69.143.133) 170.994 ms ae-46-46.ebr1.frankfurt1.level3.net (4.69.143.137) 177.308 ms 15 ae-61-61.csw1.frankfurt1.level3.net (4.69.140.2) 176.769 ms ae-91-91.csw4.frankfurt1.level3.net (4.69.140.14) 178.676 ms 173.644 ms 16 ae-2-70.edge7.frankfurt1.level3.net (4.69.154.75) 180.407 ms ae-3-80.edge7.frankfurt1.level3.net (4.69.154.139) 174.861 ms 176.578 ms 17 as33891-net.edge7.frankfurt1.level3.net (195.16.162.94) 175.448 ms 185.658 ms 177.081 ms 18 hos-bb1.juniper4.rz16.hetzner.de (213.239.240.202) 188.700 ms 190.332 ms 188.196 ms 19 hos-tr4.ex3k14.rz16.hetzner.de (213.239.233.98) 199.632 ms hos-tr3.ex3k14.rz16.hetzner.de (213.239.233.66) 185.938 ms hos-tr2.ex3k14.rz16.hetzner.de (213.239.230.34) 182.378 ms 20 * * * 21 * * * 22 * * * any ideas? EDIT: adding tcpdump MacMini (which can connect) while running - ping semaphoreapp.com sudo tcpdump -v -i en0 dst semaphoreapp.com Password: tcpdump: listening on en0, link-type EN10MB (Ethernet), capture size 65535 bytes 17:33:03.337165 IP (tos 0x0, ttl 64, id 20153, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->3129)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 0, length 64 17:33:04.337279 IP (tos 0x0, ttl 64, id 26049, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->1a21)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 1, length 64 17:33:05.337425 IP (tos 0x0, ttl 64, id 47854, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->c4f3)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 2, length 64 17:33:06.337548 IP (tos 0x0, ttl 64, id 24772, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->1f1e)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 3, length 64 17:33:07.337670 IP (tos 0x0, ttl 64, id 8171, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->5ff7)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 4, length 64 17:33:08.337816 IP (tos 0x0, ttl 64, id 35810, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->f3ff)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 5, length 64 17:33:09.337948 IP (tos 0x0, ttl 64, id 31120, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->652)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 6, length 64 ^C 7 packets captured 1047 packets received by filter 0 packets dropped by kernel OSX Lion (cannot connect) while running - ping semaphoreapp.com # wireless ~ $ sudo tcpdump -v -i en1 dst semaphoreapp.com Password: tcpdump: listening on en1, link-type EN10MB (Ethernet), capture size 65535 bytes ^C 0 packets captured 262 packets received by filter 0 packets dropped by kernel and # wired ~ $ sudo tcpdump -v -i en0 dst semaphoreapp.com tcpdump: listening on en0, link-type EN10MB (Ethernet), capture size 65535 bytes ^C 0 packets captured 219 packets received by filter 0 packets dropped by kernel above output after Request timeout for icmp_seq 25 or 30 times from ping. I don't know much about tcpdump, but to me it doesn't seem like the ping requests are leaving my machine?

    Read the article

  • PHP - not returning a count number for filled array...

    - by Phil Jackson
    Morning, this is eating me alive so Im hoping it's not something stupid, lol. $arrg = array(); if( str_word_count( $str ) > 1 ) { $input_arr = explode(' ', $str); die(print_r($input_arr)); $count = count($input_arr); die($count); above is part of a function. when i run i get; > Array ( > [0] => luke > [1] => snowden > [2] => create > [3] => develop > [4] => web > [5] => applications > [6] => sites > [7] => alse > [8] => dab > [9] => hand > [10] => design > [11] => love > [12] => helping > [13] => business > [14] => thrive > [15] => latest > [16] => industry > [17] => developer > [18] => act > [19] => designs > [20] => php > [21] => mysql > [22] => jquery > [23] => ajax > [24] => xhtml > [25] => css > [26] => de > [27] => montfont > [28] => award > [29] => advanced > [30] => programming > [31] => taught > [32] => development > [33] => years > [34] => experience > [35] => topic > [36] => fully > [37] => qualified > [38] => electrician > [39] => city > [40] => amp > [41] => guilds > [42] => level ) Which im expecting; run this however and nothing is returned!?!?! $arrg = array(); if( str_word_count( $str ) > 1 ) { $input_arr = explode(' ', $str); //die(print_r($input_arr)); $count = count($input_arr); die($count); can anyone see anything that my eyes cant?? regards, Phil

    Read the article

  • How to set up linux watchdog daemon with Intel 6300esb

    - by ACiD GRiM
    I've been searching for this on Google for sometime now and I have yet to find proper documentation on how to connect the kernel driver for my 6300esb watchdog timer to /dev/watchdog and ensure that watchdog daemon is keeping it alive. I am using RHEL compatible Scientific Linux 6.3 in a KVM virtual machine by the way Below is everything I've tried so far: dmesg|grep 6300 i6300ESB timer: Intel 6300ESB WatchDog Timer Driver v0.04 i6300ESB timer: initialized (0xffffc900008b8000). heartbeat=30 sec (nowayout=0) | ll /dev/watchdog crw-rw----. 1 root root 10, 130 Sep 22 22:25 /dev/watchdog | /etc/watchdog.conf #ping = 172.31.14.1 #ping = 172.26.1.255 #interface = eth0 file = /var/log/messages #change = 1407 # Uncomment to enable test. Setting one of these values to '0' disables it. # These values will hopefully never reboot your machine during normal use # (if your machine is really hung, the loadavg will go much higher than 25) max-load-1 = 24 max-load-5 = 18 max-load-15 = 12 # Note that this is the number of pages! # To get the real size, check how large the pagesize is on your machine. #min-memory = 1 #repair-binary = /usr/sbin/repair #test-binary = #test-timeout = watchdog-device = /dev/watchdog # Defaults compiled into the binary #temperature-device = #max-temperature = 120 # Defaults compiled into the binary #admin = root interval = 10 #logtick = 1 # This greatly decreases the chance that watchdog won't be scheduled before # your machine is really loaded realtime = yes priority = 1 # Check if syslogd is still running by enabling the following line #pidfile = /var/run/syslogd.pid Now maybe I'm not testing it correctly, but I would expecting that stopping the watchdog service would cause the /dev/watchdog to time out after 30 seconds and I should see the host reboot, however this does not happen. Also, here is my config for the KVM vm <!-- WARNING: THIS IS AN AUTO-GENERATED FILE. CHANGES TO IT ARE LIKELY TO BE OVERWRITTEN AND LOST. Changes to this xml configuration should be made using: virsh edit sl6template or other application using the libvirt API. --> <domain type='kvm'> <name>sl6template</name> <uuid>960d0ac2-2e6a-5efa-87a3-6bb779e15b6a</uuid> <memory unit='KiB'>262144</memory> <currentMemory unit='KiB'>262144</currentMemory> <vcpu placement='static'>1</vcpu> <os> <type arch='x86_64' machine='rhel6.3.0'>hvm</type> <boot dev='hd'/> </os> <features> <acpi/> <apic/> <pae/> </features> <cpu mode='custom' match='exact'> <model fallback='allow'>Westmere</model> <vendor>Intel</vendor> <feature policy='require' name='tm2'/> <feature policy='require' name='est'/> <feature policy='require' name='vmx'/> <feature policy='require' name='ds'/> <feature policy='require' name='smx'/> <feature policy='require' name='ss'/> <feature policy='require' name='vme'/> <feature policy='require' name='dtes64'/> <feature policy='require' name='rdtscp'/> <feature policy='require' name='ht'/> <feature policy='require' name='dca'/> <feature policy='require' name='pbe'/> <feature policy='require' name='tm'/> <feature policy='require' name='pdcm'/> <feature policy='require' name='pdpe1gb'/> <feature policy='require' name='ds_cpl'/> <feature policy='require' name='pclmuldq'/> <feature policy='require' name='xtpr'/> <feature policy='require' name='acpi'/> <feature policy='require' name='monitor'/> <feature policy='require' name='aes'/> </cpu> <clock offset='utc'/> <on_poweroff>destroy</on_poweroff> <on_reboot>restart</on_reboot> <on_crash>restart</on_crash> <devices> <emulator>/usr/libexec/qemu-kvm</emulator> <disk type='file' device='disk'> <driver name='qemu' type='raw'/> <source file='/mnt/data/vms/sl6template.img'/> <target dev='vda' bus='virtio'/> <address type='pci' domain='0x0000' bus='0x00' slot='0x04' function='0x0'/> </disk> <controller type='usb' index='0'> <address type='pci' domain='0x0000' bus='0x00' slot='0x01' function='0x2'/> </controller> <interface type='bridge'> <mac address='52:54:00:44:57:f6'/> <source bridge='br0.2'/> <model type='virtio'/> <address type='pci' domain='0x0000' bus='0x00' slot='0x03' function='0x0'/> </interface> <interface type='bridge'> <mac address='52:54:00:88:0f:42'/> <source bridge='br1'/> <model type='virtio'/> <address type='pci' domain='0x0000' bus='0x00' slot='0x07' function='0x0'/> </interface> <serial type='pty'> <target port='0'/> </serial> <console type='pty'> <target type='serial' port='0'/> </console> <watchdog model='i6300esb' action='reset'> <address type='pci' domain='0x0000' bus='0x00' slot='0x06' function='0x0'/> </watchdog> <memballoon model='virtio'> <address type='pci' domain='0x0000' bus='0x00' slot='0x05' function='0x0'/> </memballoon> </devices> </domain> Any help is appreciated as the most I've found are patches to kvm and general softdog documentation or IPMI watchdog answers.

    Read the article

  • Zend_Form validation problem

    - by GrumpyCanuck
    I am having problems getting validation to work for a form built using Zend_Form. The idea is this: I have two dropdown. One is a list of players. The other is a list of free agents who play the same position as the player. I am using an onChange javascript callback to run some Ajax code that replaces the free agent list dropdown with a new one at the position of the player they've selected from the player dropdown. Now, perhaps this is the wrong way, but I built the form by creating an instance of Zend_Form and then creating all these setX methods that add elements to the form. My reasoning was that I wanted to display certain elements in specific places on the page, not just output $this-form on my template. The problem appears to be when I get the form post back, the validator seems to not know about the validation rule I set up for the free agent drop down. Here's some relevant code to look at. I'm a relative ZF n00b so feel free to tell me I am not doing things the ZF way if it leaps out at you. The action in the controller: public function indexAction() { if ($this->getRequest()->isPost()) { $form = new Baseball_Form_Transactions(); if ($form->isValid($this->_request->getPost())) { $data = $this->_request->getPost(); $leagueInfo = Doctrine::getTable('League')->findOneByShortName($data['shortLeagueName'])->toArray(); // Create the request top drop an existing player $transactionInfo = array( 'league_id' => $leagueInfo['id'], 'team_id' => $data['teamId'], 'player_id' => $data['players'], 'type' => 'drop', 'target_team_id' => 0, 'transaction_date' => date('Y-m-d H:m:s') ); $transaction = new Transaction(); $transaction->fromArray($transactionInfo); $transaction->save(); // Now we do the request to add a player $transactionInfo['team_id'] = 0; $transactionInfo['player_id'] = $data['freeAgents']; $transactionInfo['target_team_id'] = $data['teamId']; $transactionInfo['type'] = 'add'; $transaction = new Transaction(); $transaction->fromArray($transactionInfo); $transaction->save(); $this->_flashMessenger->addMessage('Added transaction'); } } $options = array( 'teamId' => $this->teamId, 'position' => 'C', 'leagueShortName' => $this->league ); $this->transactionForm->setMyPlayers($options); $this->transactionForm->setFreeAgents($options); $this->transactionForm->setTeamId($options); $this->transactionForm->setShortLeagueName($options); $this->view->transactionForm = $this->transactionForm; $this->view->messages = $this->_flashMessenger->getMessages(); $transaction = new Transaction(); $this->view->transactions = $transaction->byTeam($options); } Next we have the form itself public function setMyPlayers($options) { $data = Doctrine::getTable('Team')->find($options['teamId']); $players = array(); foreach ($data->Players->toArray() as $player) { $players[$player['id']] = "{$player['position']} - {$player['first_name']} {$player['last_name']}"; } $playersSelect = new Zend_Form_Element_Select( 'players', array( 'required' => true, 'label' => 'Players', 'multiOptions' => $players, ) ); $this->addElement($playersSelect); } public function setFreeAgents($options) { $q = Doctrine_Query::create() ->select('CONCAT(p.first_name, " ", p.last_name) as full_name, p.id, p.position') ->from('Player p') ->leftJoin('p.Teams t') ->leftJoin('t.League l ON l.short_name = ?', $options['leagueShortName']) ->where('t.id IS NULL') ->andWhere('p.position = ?', $options['position']) ->orderBy('p.last_name'); $q->setHydrationMode(Doctrine_Core::HYDRATE_ARRAY); $data = $q->execute(); $freeAgents = array(); foreach ($data as $player) { $freeAgents[$player['id']] = $player['full_name']; } $freeAgentsSelect = new Zend_Form_Element_Select( 'freeAgents', array( 'label' => 'Free Agents', 'multiOptions' => $freeAgents, 'size' => 15 ) ); $freeAgentsSelect->setRequired(true); $this->addElement($freeAgentsSelect); } public function setShortLeagueName($options) { $shortLeagueNameHidden = new Zend_Form_Element_Hidden( 'shortLeagueName', array('value' => $options['leagueShortName']) ); $this->addElement($shortLeagueNameHidden); } public function setTeamId($options) { $teamIdHidden = new Zend_Form_Element_Hidden( 'teamId', array('value' => $options['teamId']) ); $this->addElement($teamIdHidden); } There is no init or __construct() method in the form. My problem seems simple enough: reject the form contents as invalid if they have not selected someone from the free agent list. Right now, it sails through as valid. I've spent some considerable time searching online for an answer, and haven't been able to find it. Thanks in advance for any help.

    Read the article

  • VPN still working after rebooting without client - DrayTek client shows "No Connection"

    - by HeavenCore
    My home network is a simple router + pc's setup, nothing fancy - the router has DHCP enabled for 192.168.0.X (255.255.255.0) and my PC picks up the address 192.168.0.82. There are no devices on my local lan in the 192.168.1.x range. On my pc i have the DrayTek VPN client, and a company i do some work for has a DrayTek Vigor router. The VPN client establishes a VPN to that remote company using an IPSec Tunnel (PreShared Key - no encryption) Last night i shut down my pc with the VPN tunnel still connected, when i turned my computer on this morning i accidentally clicked an RDP shortcut to 192.168.1.2 (a host in the remote company) and to my amazement it connected?!? I checked and the DrayTek VPN client isnt running, and when i did run it, it clearly shows "Status: No connection". confused as to how my machine can still talk to this remote machine i tried a trace: C:\Users\HeavenCore>tracert 192.168.1.2 Tracing route to C4SERVERII [192.168.1.2] over a maximum of 30 hops: 1 * * * Request timed out. 2 * * * Request timed out. 3 * * * Request timed out. 4 * * * Request timed out. 5 * * * Request timed out. 6 * * * Request timed out. 7 * * * Request timed out. 8 * * * Request timed out. 9 * * * Request timed out. 10 * * * Request timed out. 11 * * * Request timed out. 12 15 ms 21 ms 32 ms C4SERVERII [192.168.1.2] Trace complete. No indication there as to how it's getting from my network to the remote host. with my network mask being 255.255.255.0 with ip 192.168.0.1 i dont even see how packets are routing to 192.168.1.1 - unless there was a static route in place, so i checked the route table: IPv4 Route Table =========================================================================== Active Routes: Network Destination Netmask Gateway Interface Metric 0.0.0.0 0.0.0.0 192.168.0.1 192.168.0.82 266 127.0.0.0 255.0.0.0 On-link 127.0.0.1 306 127.0.0.1 255.255.255.255 On-link 127.0.0.1 306 127.255.255.255 255.255.255.255 On-link 127.0.0.1 306 192.168.0.0 255.255.255.0 On-link 192.168.0.82 266 192.168.0.82 255.255.255.255 On-link 192.168.0.82 266 192.168.0.255 255.255.255.255 On-link 192.168.0.82 266 224.0.0.0 240.0.0.0 On-link 127.0.0.1 306 224.0.0.0 240.0.0.0 On-link 192.168.0.82 266 255.255.255.255 255.255.255.255 On-link 127.0.0.1 306 255.255.255.255 255.255.255.255 On-link 192.168.0.82 266 =========================================================================== Persistent Routes: Network Address Netmask Gateway Address Metric 0.0.0.0 0.0.0.0 192.168.0.1 Default =========================================================================== As far as i can see, nothing indicating how my packets are getting to 192.168.1.2??? To confirm i was on a different subnet i did an ipconfig /all: Ethernet adapter Local Area Connection: Connection-specific DNS Suffix . : Description . . . . . . . . . . . : Marvell Yukon 88E8056 PCI-E Gigabit Ether net Controller Physical Address. . . . . . . . . : 00-23-54-F3-4E-BA DHCP Enabled. . . . . . . . . . . : No Autoconfiguration Enabled . . . . : Yes IPv4 Address. . . . . . . . . . . : 192.168.0.82(Preferred) Subnet Mask . . . . . . . . . . . : 255.255.255.0 Default Gateway . . . . . . . . . : 192.168.0.1 DNS Servers . . . . . . . . . . . : 192.168.0.1 208.67.222.222 NetBIOS over Tcpip. . . . . . . . : Enabled Yet straight after confirming my ip and subnet as above i can go ahead and ping the remote machine: C:\Users\HeavenCore>ping 192.168.1.2 Pinging 192.168.1.2 with 32 bytes of data: Reply from 192.168.1.2: bytes=32 time=48ms TTL=127 Reply from 192.168.1.2: bytes=32 time=23ms TTL=127 Reply from 192.168.1.2: bytes=32 time=103ms TTL=127 Reply from 192.168.1.2: bytes=32 time=25ms TTL=127 Ping statistics for 192.168.1.2: Packets: Sent = 4, Received = 4, Lost = 0 (0% loss), Approximate round trip times in milli-seconds: Minimum = 23ms, Maximum = 103ms, Average = 49ms Also, note on the ping how the times are 35ms ish, this clearly shows the pings are to the remote host and not something on my local lan (all stuff on my local lan pings in 0ms) - plus i verified the host was actually the host via RDP. My Question: Can an IPSec tunnel stay up some how after a reboot without use of the VPN client? (well, i can clearly see that it can) - where in windows is there visibility of this? how does my machine know where to route the packets? I appreciate any insights & thoughts!

    Read the article

  • Extended with advice: Moving block wont work in Javascript

    - by Mack
    Hello Note: this is an extension of a question I just asked, i have made the edits & taken the advice but still no luck I am trying to make a webpage where when you click a link, the link moves diagonally every 100 milliseconds. So I have my Javascript, but right now when I click the link nothing happens. I have run my code through JSLint (therefore changed comaprisions to === not ==, thats weird in JS?). I get this error from JSLink though: Error: Implied global: self 15,38, document 31 What do you think I am doing wrong? <script LANGUAGE="JavaScript" type = "text/javascript"> <!-- var block = null; var clockStep = null; var index = 0; var maxIndex = 6; var x = 0; var y = 0; var timerInterval = 100; // milliseconds var xPos = null; var yPos = null; function moveBlock() { if ( index < 0 || index >= maxIndex || block === null || clockStep === null ) { self.clearInterval( clockStep ); return; } block.style.left = xPos[index] + "px"; block.style.top = yPos[index] + "px"; index++; } function onBlockClick( blockID ) { if ( clockStep !== null ) { return; } block = document.getElementById( blockID ); index = 0; x = number(block.style.left); // parseInt( block.style.left, 10 ); y = number(block.style.top); // parseInt( block.style.top, 10 ); xPos = new Array( x+10, x+20, x+30, x+40, x+50, x+60 ); yPos = new Array( y-10, y-20, y-30, y-40, y-50, y-60 ); clockStep = self.SetInterval( moveBlock(), timerInterval ); } --> </script> <style type="text/css" media="all"> <!-- @import url("styles.css"); #blockMenu { z-index: 0; width: 650px; height: 600px; background-color: blue; padding: 0; } #block1 { z-index: 30; position: relative; top: 10px; left: 10px; background-color: red; width: 200px; height: 200px; margin: 0; padding: 0; /* background-image: url("images/block1.png"); */ } #block2 { z-index: 30; position: relative; top: 50px; left: 220px; background-color: red; width: 200px; height: 200px; margin: 0; padding: 0; /* background-image: url("images/block1.png"); */ } #block3 { z-index: 30; position: relative; top: 50px; left: 440px; background-color: red; width: 200px; height: 200px; margin: 0; padding: 0; /* background-image: url("images/block1.png"); */ } #block4 { z-index: 30; position: relative; top: 0px; left: 600px; background-color: red; width: 200px; height: 200px; margin: 0; padding: 0; /* background-image: url("images/block1.png"); */ } #block1 a { display: block; width: 100%; height: 100%; } #block2 a { display: block; width: 100%; height: 100%; } #block3 a { display: block; width: 100%; height: 100%; } #block4 a { display: block; width: 100%; height: 100%; } #block1 a:hover { background-color: green; } #block2 a:hover { background-color: green; } #block3 a:hover { background-color: green; } #block4 a:hover { background-color: green; } #block1 a:active { background-color: yellow; } #block2 a:active { background-color: yellow; } #block3 a:active { background-color: yellow; } #block4 a:active { background-color: yellow; } --> </style>

    Read the article

  • Permissions denied on apache rewrite module virtual host configuration

    - by sina
    All of a sudden I keep getting "Permissions denied" on apache 2 virtualhost once we moved it to its own conf file. I have tried all the suggestions I have found here but none work. Please can someone tell me what I am doing wrong? Thanks! <VirtualHost *:80> DocumentRoot "/var/www/mm" <Directory "/var/www/mm"> Options +Indexes +MultiViews +FollowSymLinks AllowOverride all Order deny,allow Allow from all AddType text/vnd.sun.j2me.app-descriptor .jad AddType application/vnd.rim.cod .cod </Directory> Alias /holdspace "/var/www/mm/holdspace" RewriteLogLevel 9 RewriteLog "/var/log/httpd/rewrite.log" RewriteEngine on # 91xx RewriteCond %{HTTP_USER_AGENT} BlackBerry.9105 RewriteRule ^/download/(.*) /holdspace/bb6-360x480/$1 [L] # 92xx RewriteCond %{HTTP_USER_AGENT} BlackBerry.9220 RewriteRule ^/download/(.*) /holdspace/bb5-320x240/$1 [L] Errors in error.log: [Wed May 28 12:44:58 2014] [error] [client 197.255.173.95] (13)Permission denied: access to /download/eazymoney.jad denied [Wed May 28 12:44:58 2014] [error] [client 197.255.173.95] (13)Permission denied: access to /error/HTTP_FORBIDDEN.html.var denied [Wed May 28 12:44:59 2014] [error] [client 197.255.173.95] (13)Permission denied: access to /favicon.ico denied [Wed May 28 12:44:59 2014] [error] [client 197.255.173.95] (13)Permission denied: access to /error/HTTP_FORBIDDEN.html.var denied [Wed May 28 12:44:59 2014] [error] [client 197.255.173.95] (13)Permission denied: access to /favicon.ico denied [Wed May 28 12:44:59 2014] [error] [client 197.255.173.95] (13)Permission denied: access to /error/HTTP_FORBIDDEN.html.var denied Errors in rewrite.log: 197.255.173.95 - - [28/May/2014:12:46:01 +0100] [41.203.113.103/sid#7fe41704ca28][rid#7fe417123378/initial/redir#1] (3) applying pattern '^/download/(.*)' to uri '/error/HTTP_FORBIDDEN.html.var' 197.255.173.95 - - [28/May/2014:12:46:01 +0100] [41.203.113.103/sid#7fe41704ca28][rid#7fe417123378/initial/redir#1] (3) applying pattern '^/download/(.*)' to uri '/error/HTTP_FORBIDDEN.html.var' Apache Configuration file: ServerTokens Prod ServerRoot "/etc/httpd" PidFile run/httpd.pid Timeout 60 KeepAlive Off MaxKeepAliveRequests 100 KeepAliveTimeout 15 <IfModule prefork.c> StartServers 8 MinSpareServers 5 MaxSpareServers 20 ServerLimit 256 MaxClients 256 MaxRequestsPerChild 4000 </IfModule> <IfModule worker.c> StartServers 4 MaxClients 300 MinSpareThreads 25 MaxSpareThreads 75 ThreadsPerChild 25 MaxRequestsPerChild 0 </IfModule> Listen 80 LoadModule auth_basic_module modules/mod_auth_basic.so LoadModule auth_digest_module modules/mod_auth_digest.so LoadModule authn_file_module modules/mod_authn_file.so LoadModule authn_alias_module modules/mod_authn_alias.so LoadModule authn_anon_module modules/mod_authn_anon.so LoadModule authn_dbm_module modules/mod_authn_dbm.so LoadModule authn_default_module modules/mod_authn_default.so LoadModule authz_host_module modules/mod_authz_host.so LoadModule authz_user_module modules/mod_authz_user.so LoadModule authz_owner_module modules/mod_authz_owner.so LoadModule authz_groupfile_module modules/mod_authz_groupfile.so LoadModule authz_dbm_module modules/mod_authz_dbm.so LoadModule authz_default_module modules/mod_authz_default.so LoadModule ldap_module modules/mod_ldap.so LoadModule authnz_ldap_module modules/mod_authnz_ldap.so LoadModule include_module modules/mod_include.so LoadModule log_config_module modules/mod_log_config.so LoadModule logio_module modules/mod_logio.so LoadModule env_module modules/mod_env.so LoadModule ext_filter_module modules/mod_ext_filter.so LoadModule mime_magic_module modules/mod_mime_magic.so LoadModule expires_module modules/mod_expires.so LoadModule deflate_module modules/mod_deflate.so LoadModule headers_module modules/mod_headers.so LoadModule usertrack_module modules/mod_usertrack.so LoadModule setenvif_module modules/mod_setenvif.so LoadModule mime_module modules/mod_mime.so LoadModule dav_module modules/mod_dav.so LoadModule status_module modules/mod_status.so LoadModule autoindex_module modules/mod_autoindex.so LoadModule info_module modules/mod_info.so LoadModule dav_fs_module modules/mod_dav_fs.so LoadModule vhost_alias_module modules/mod_vhost_alias.so LoadModule negotiation_module modules/mod_negotiation.so LoadModule dir_module modules/mod_dir.so LoadModule actions_module modules/mod_actions.so LoadModule speling_module modules/mod_speling.so LoadModule userdir_module modules/mod_userdir.so LoadModule alias_module modules/mod_alias.so LoadModule substitute_module modules/mod_substitute.so LoadModule rewrite_module modules/mod_rewrite.so LoadModule proxy_module modules/mod_proxy.so LoadModule proxy_ftp_module modules/mod_proxy_ftp.so LoadModule proxy_http_module modules/mod_proxy_http.so LoadModule proxy_ajp_module modules/mod_proxy_ajp.so LoadModule proxy_connect_module modules/mod_proxy_connect.so LoadModule cache_module modules/mod_cache.so LoadModule suexec_module modules/mod_suexec.so LoadModule disk_cache_module modules/mod_disk_cache.so LoadModule cgi_module modules/mod_cgi.so LoadModule version_module modules/mod_version.so Include conf.d/*.conf User apache Group apache ServerAdmin root@localhost ServerName sv001zma002.africa.int.myorg.com UseCanonicalName Off DocumentRoot "/var/www/html" <Directory /> Options FollowSymLinks AllowOverride None </Directory> <Directory "/var/www/html"> Options FollowSymLinks AllowOverride None Order allow,deny Allow from all </Directory> <IfModule mod_userdir.c> UserDir disabled </IfModule> DirectoryIndex index.html index.html.var AccessFileName .htaccess <Files ~ "^\.ht"> Order allow,deny Deny from all Satisfy All </Files> TypesConfig /etc/mime.types DefaultType text/plain <IfModule mod_mime_magic.c> MIMEMagicFile conf/magic </IfModule> HostnameLookups Off ErrorLog logs/error_log LogLevel warn LogFormat "%h %l %u %t \"%r\" %>s %b \"%{Referer}i\" \"%{User-Agent}i\"" combined LogFormat "%h %l %u %t \"%r\" %>s %b" common LogFormat "%{Referer}i -> %U" referer LogFormat "%{User-agent}i" agent CustomLog logs/access_log combined ServerSignature Off TraceEnable Off Alias /icons/ "/var/www/icons/" <Directory "/var/www/icons"> Options MultiViews FollowSymLinks AllowOverride None Order allow,deny Allow from all </Directory> <IfModule mod_dav_fs.c> DAVLockDB /var/lib/dav/lockdb </IfModule> ScriptAlias /cgi-bin/ "/var/www/cgi-bin/" <Directory "/var/www/cgi-bin"> AllowOverride None Options None Order allow,deny Allow from all </Directory> IndexOptions FancyIndexing VersionSort NameWidth=* HTMLTable Charset=UTF-8 AddIconByEncoding (CMP,/icons/compressed.gif) x-compress x-gzip AddIconByType (TXT,/icons/text.gif) text/* AddIconByType (IMG,/icons/image2.gif) image/* AddIconByType (SND,/icons/sound2.gif) audio/* AddIconByType (VID,/icons/movie.gif) video/* AddIcon /icons/binary.gif .bin .exe AddIcon /icons/binhex.gif .hqx AddIcon /icons/tar.gif .tar AddIcon /icons/world2.gif .wrl .wrl.gz .vrml .vrm .iv AddIcon /icons/compressed.gif .Z .z .tgz .gz .zip AddIcon /icons/a.gif .ps .ai .eps AddIcon /icons/layout.gif .html .shtml .htm .pdf AddIcon /icons/text.gif .txt AddIcon /icons/c.gif .c AddIcon /icons/p.gif .pl .py AddIcon /icons/f.gif .for AddIcon /icons/dvi.gif .dvi AddIcon /icons/uuencoded.gif .uu AddIcon /icons/script.gif .conf .sh .shar .csh .ksh .tcl AddIcon /icons/tex.gif .tex AddIcon /icons/bomb.gif core AddIcon /icons/back.gif .. AddIcon /icons/hand.right.gif README AddIcon /icons/folder.gif ^^DIRECTORY^^ AddIcon /icons/blank.gif ^^BLANKICON^^ DefaultIcon /icons/unknown.gif ReadmeName README.html HeaderName HEADER.html IndexIgnore .??* *~ *# HEADER* README* RCS CVS *,v *,t AddLanguage ca .ca AddLanguage cs .cz .cs AddLanguage da .dk AddLanguage de .de AddLanguage el .el AddLanguage en .en AddLanguage eo .eo AddLanguage es .es AddLanguage et .et AddLanguage fr .fr AddLanguage he .he AddLanguage hr .hr AddLanguage it .it AddLanguage ja .ja AddLanguage ko .ko AddLanguage ltz .ltz AddLanguage nl .nl AddLanguage nn .nn AddLanguage no .no AddLanguage pl .po AddLanguage pt .pt AddLanguage pt-BR .pt-br AddLanguage ru .ru AddLanguage sv .sv AddLanguage zh-CN .zh-cn AddLanguage zh-TW .zh-tw LanguagePriority en ca cs da de el eo es et fr he hr it ja ko ltz nl nn no pl pt pt-BR ru sv zh-CN zh-TW ForceLanguagePriority Prefer Fallback AddDefaultCharset UTF-8 AddType application/x-compress .Z AddType application/x-gzip .gz .tgz AddType application/x-x509-ca-cert .crt AddType application/x-pkcs7-crl .crl AddHandler type-map var AddType text/html .shtml AddOutputFilter INCLUDES .shtml ProxyErrorOverride On Alias /error/ "/var/www/error/" <IfModule mod_negotiation.c> <IfModule mod_include.c> <Directory "/var/www/error"> AllowOverride None Options IncludesNoExec AddOutputFilter Includes html AddHandler type-map var Order allow,deny Allow from all LanguagePriority en es de fr ForceLanguagePriority Prefer Fallback </Directory> ErrorDocument 400 /error/HTTP_BAD_REQUEST.html.var ErrorDocument 401 /error/HTTP_UNAUTHORIZED.html.var ErrorDocument 403 /error/HTTP_FORBIDDEN.html.var ErrorDocument 404 /error/HTTP_NOT_FOUND.html.var </IfModule> </IfModule> BrowserMatch "Mozilla/2" nokeepalive BrowserMatch "MSIE 4\.0b2;" nokeepalive downgrade-1.0 force-response-1.0 BrowserMatch "RealPlayer 4\.0" force-response-1.0 BrowserMatch "Java/1\.0" force-response-1.0 BrowserMatch "JDK/1\.0" force-response-1.0 BrowserMatch "Microsoft Data Access Internet Publishing Provider" redirect-carefully BrowserMatch "MS FrontPage" redirect-carefully BrowserMatch "^WebDrive" redirect-carefully BrowserMatch "^WebDAVFS/1.[0123]" redirect-carefully BrowserMatch "^gnome-vfs/1.0" redirect-carefully BrowserMatch "^XML Spy" redirect-carefully BrowserMatch "^Dreamweaver-WebDAV-SCM1" redirect-carefully ErrorDocument 400 "Bad Request"

    Read the article

  • Casting a primitive int to a Number

    - by Tamer
    Let's say that I have the following: int a = 2; Number b = (Number) a; System.out.println(b); // Prints 2 http://java.sun.com/docs/books/jls/first_edition/html/15.doc.html#238146 says that a primitive value may not be cast to a reference type. Does Java know to create an Integer from the primitive int and then cast to the superclass? How exactly does Java handle this behind the scenes? Thanks!

    Read the article

  • Convert Decimal to ASCII

    - by Dan Snyder
    I'm having difficulty using reinterpret_cast. Before I show you my code I'll let you know what I'm trying to do. I'm trying to get a filename from a vector full of data being used by a MIPS I processor I designed. Basically what I do is compile a binary from a test program for my processor, dump all the hex's from the binary into a vector in my c++ program, convert all of those hex's to decimal integers and store them in a DataMemory vector which is the data memory unit for my processor. I also have instruction memory. So When my processor runs a SYSCALL instruction such as "Open File" my C++ operating system emulator receives a pointer to the beginning of the filename in my data memory. So keep in mind that data memory is full of ints, strings, globals, locals, all sorts of stuff. When I'm told where the filename starts I do the following: Convert the whole decimal integer element that is being pointed to to its ASCII character representation, and then search from left to right to see if the string terminates, if not then just load each character consecutively into a "filename" string. Do this until termination of the string in memory and then store filename in a table. My difficulty is generating filename from my memory. Here is an example of what I'm trying to do: C++ Syntax (Toggle Plain Text) 1.Index Vector NewVector ASCII filename 2.0 240faef0 128123792 'abc7' 'a' 3.0 240faef0 128123792 'abc7' 'ab' 4.0 240faef0 128123792 'abc7' 'abc' 5.0 240faef0 128123792 'abc7' 'abc7' 6.1 1234567a 243225 'k2s0' 'abc7k' 7.1 1234567a 243225 'k2s0' 'abc7k2' 8.1 1234567a 243225 'k2s0' 'abc7k2s' 9. //EXIT LOOP// 10.1 1234567a 243225 'k2s0' 'abc7k2s' Index Vector NewVector ASCII filename 0 240faef0 128123792 'abc7' 'a' 0 240faef0 128123792 'abc7' 'ab' 0 240faef0 128123792 'abc7' 'abc' 0 240faef0 128123792 'abc7' 'abc7' 1 1234567a 243225 'k2s0' 'abc7k' 1 1234567a 243225 'k2s0' 'abc7k2' 1 1234567a 243225 'k2s0' 'abc7k2s' //EXIT LOOP// 1 1234567a 243225 'k2s0' 'abc7k2s' Here is the code that I've written so far to get filename (I'm just applying this to element 1000 of my DataMemory vector to test functionality. 1000 is arbitrary.): C++ Syntax (Toggle Plain Text) 1.int i = 0; 2.int step = 1000;//top->a0; 3.string filename; 4.char *temp = reinterpret_cast<char*>( DataMemory[1000] );//convert to char 5.cout << "a0:" << top->a0 << endl;//pointer supplied 6.cout << "Data:" << DataMemory[top->a0] << endl;//my vector at pointed to location 7.cout << "Data(1000):" << DataMemory[1000] << endl;//the element I'm testing 8.cout << "Characters:" << &temp << endl;//my temporary char array 9. 10.while(&temp[i]!=0) 11.{ 12. filename+=temp[i];//add most recent non-terminated character to string 13. i++; 14. if(i==4)//when 4 chatacters have been added.. 15. { 16. i=0; 17. step+=1;//restart loop at the next element in DataMemory 18. temp = reinterpret_cast<char*>( DataMemory[step] ); 19. } 20. } 21. cout << "Filename:" << filename << endl; int i = 0; int step = 1000;//top-a0; string filename; char *temp = reinterpret_cast( DataMemory[1000] );//convert to char cout << "a0:" << top-a0 << endl;//pointer supplied cout << "Data:" << DataMemory[top-a0] << endl;//my vector at pointed to location cout << "Data(1000):" << DataMemory[1000] << endl;//the element I'm testing cout << "Characters:" << &temp << endl;//my temporary char array while(&temp[i]!=0) { filename+=temp[i];//add most recent non-terminated character to string i++; if(i==3)//when 4 chatacters have been added.. { i=0; step+=1;//restart loop at the next element in DataMemory temp = reinterpret_cast( DataMemory[step] ); } } cout << "Filename:" << filename << endl; So the issue is that when I do the conversion of my decimal element to a char array I assume that 8 hex #'s will give me 4 characters. Why isn't this this case? Here is my output: C++ Syntax (Toggle Plain Text) 1.a0:0 2.Data:0 3.Data(1000):4428576 4.Characters:0x7fff5fbff128 5.Segmentation fault

    Read the article

  • Failed to obtain JDBC Driver for MySQL under Tomcat environment

    - by Michael Mao
    Hi all: I've been trying to obtain the Driver class for JDBC connection to MySQL. The workstation is running on Linux, Fedora 10. I have manually set up the classpath variable for Java by CLI like this: bash-3.2$ echo $CLASSPATH /home/cmao/public_html/jsp/mysql-connector-java-5.1.12-bin.jar This shows that I've added the lastest mysql connection jar archive to my CLASSPATH variable. I've created a test JSP page which can be found here And source code for this page is: <%@page language="java"%> <%@page import="java.sql.*"%> <%@page import="java.util.*"%> <html> <head> <title>UTS JDBC MySQL connection test page</title> </head> <body> <% Connection con = null; out.print("Java version is : " + System.getProperty("java.version") + "<br />"); out.print("Tomcat version is : " + application.getServerInfo() + "<br />"); out.print("Servlet version is: " + application.getMajorVersion() + "<br />"); out.print("JSP version is : " + JspFactory.getDefaultFactory().getEngineInfo().getSpecificationVersion() +"<br />"); //out.print("Java classpath is : " + System.getProperty("java.class.path")+ "<br />"); //out.print("JSP classpath is : " + appliaction.getAttribute("org.apache.catalina.jsp_classpath") + "<br />"); //out.print("Tomcat classpath is : " + System.getProperty("org.apache.tomcat.common.classpath") + "<br />"); try { Class c = Class.forName("com.mysql.jdbc.Driver"); } catch(Exception e) { out.println("Error! Failed to obtain JDBC driver for MySQL... Missing class \"com.mysql.jdbc.Driver\"<br />"); } %> </body> </html> None of those commented out line would work, various Jsper Expetions would be thrown. You can check those Error pages from the following links: classpath Error page catalina Error page tomcat Error page It seems, from my limited knowledge of JSP and Servlet, the Tomcat environment "ignores" my Java CLASSPATH? In which case I cannot configure the MySQL JDBC package to let my Servlets(a JSP is but a Servlet anyway) work. I am not sure how to fix this issue. would it be better if I use an IDE like Eclipse or NetBeans and create a real Java "web app" so that everything can be "self-configured" by the usage of a web.config XML configuration file? So that I can certainly bypass this Tomcat environment restriction? Many thanks for the suggestions in advance.

    Read the article

  • Web-based JSON editor that works like property explorer with AJAXy input form

    - by dreftymac
    Background: This is a request for something that may not exist yet, but I've been meaning to build one for a long time. First I will ask if anyone has seen anything like it yet. Suppose you have an arbitrary JSON structure like the following: { 'str_title':'My Employee List' ,'str_lastmod': '2009-June-15' ,'arr_list':[ {'firstname':'john','lastname':'doe','age':'33',} ,{'firstname':'jane','lastname':'doe','age':'34',} ,{'firstname':'samuel','lastname':'doe','age':'35',} ] } Question: Is there a web-based JSON editor that could take a structure like this, and automatically allow the user to modify this in a user-friendly GUI? Example: Imagine an auto-generated HTML form that displays 2 input-type-text controls for both title and lastmod, and a table of input-type-text controls with three columns and three rows for arr_list ... with the ability to delete or add additional rows by clicking on a [+][X] next to each row in the table. Big Idea: The "big idea" behind this is that the user would be able to specify any arbitrary (non-recursive) JSON structure and then also be able to edit the structure with a GUI-based interaction (this would be similar to the "XML Editor Grid View" in XML Spy).

    Read the article

  • $_GET loading content before head tag instead of in specified div.

    - by s32ialx
    NOT EDITING BELOW BUT THANKS TO SOME REALLY NICE PEOPLE I CAN'T POST AN IMAGE ANYMORE BECAUSE I HAD a 15 Rep but NOW ONLY A 5 becuase my question wasn't what they wanted help with they gave me a neg rep. The problem is that the content loads it displays UNDER the div i placed #CONTENT# inside so the styles are being ignored and it's posting #CONTENT# outside the divs at positions 0,0 any suggestions? Found out whats happening by using "View Source" seems that it's putting all of the #CONTENT#, content that's being loaded in front of the <head> tag. Like this <doctype...> <div class="home"> \ blah blah #CONTENT# bot being loaded in correct specified area </div> / <head> <script src=""></script> </head> <body> <div class="header"></div> <div class="contents"> #CONTENT# < where content SHOULD load </div> <div class="footer"></div> </body> so anyone got a fix? OK so a better description I'll add relevant screen-shots Whats happening is /* file.class.php */ <?php $file = new file(); class file{ var $path = "templates/clean"; var $ext = "tpl"; function loadfile($filename){ return file_get_contents($this->path . "/" . $filename . "." . $this->ext); } function setcontent($content,$newcontent,$vartoreplace='#CONTENT#'){ $val = str_replace($vartoreplace,$newcontent,$content); return $val; } function p($content) { $v = $content; $v = str_replace('#CONTENT#','',$v); print $v; } } if(!isset($_GET['page'])){ // if not, lets load our index page(you can change home.php to whatever you want: include("main.txt"); // else $_GET['page'] was set so lets do stuff: } else { // lets first check if the file exists: if(file_exists($_GET['page'].'.txt')){ // and lets include that then: include($_GET['page'].'.txt'); // sorry mate, could not find it: } else { echo 'Sorry, could not find <strong>' . $_GET['page'] .'.txt</strong>'; } } ?> is calling for a file_get_contents at the bottom which I use in /* index.php */ <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en"> <?php include('classes/file.class.php'); // load the templates $header = $file->loadfile('header'); $body = $file->loadfile('body'); $footer = $file->loadfile('footer'); // fill body.tpl #CONTENT# slot with $content $body = $file->setcontent($body, $content); // cleanup and output the full page $file->p($header . $body . $footer); ?> and loads into /* body.tpl */ <div id="bodys"> <div id="bodt"></div> <div id="bodm"> <div id="contents"> #CONTENT# </div> </div> <div id="bodb"></div> </div> but the issue is as follows the $content loads properly img tags etc <h2> tags etc but CSS styling is TOTALY ignored for position width z-index etc. and as follows here's the screen-shot My Firefox Showing The Problem In Action REPOSTED DUE TO PEOPLE NOT HELPING AND JUST BEING ARROGANT AND GIVING NEGATIVE VOTES and not even saying a word. DO NOT COMMENT UNLESS YOU PLAN TO HELP god I'm a beginner and with you people giving me bad reviews this won't make me help you out when the chance comes.

    Read the article

  • Is there any better way for creating a dynamic HTML table without using any javascript library like

    - by piemesons
    Dont worry we dont need to find out any bug in this code.. Its working perfectly.:-P My boss came to me and said "Hey just tell me whats the best of way of writing code for a dynamic HTML table (add row, delete row, update row).No need to add any CSS. Just javascript. No Jquery library etc. I was confused that in the middle of the project why he asking for some stupid exercise like this. What ever i wrote the following code and mailed him and after 15 mins i got a mail from him. " I was expecting much better code from a guy like you. Anyways good job monkey.(And with a picture of monkey as attachment.) thats was the mail. Line by line. I want to reply him but before that i want to know about the quality of my code. Is this really shitty...!!! Or he was just making fun of mine. I dont think that code is really shitty. Still correct me if you can.Code is working perfectly fine. Just copy paste it in a HTML file. <html> <head> <title> Exercise CSS </title> <script type="text/javascript"> function add_row() { var table = document.getElementById('table'); var rowCount = table.rows.length; var row = table.insertRow(rowCount); var cell1 = row.insertCell(0); var element1 = document.createElement("input"); element1.type = "text"; cell1.appendChild(element1); var cell2 = row.insertCell(1); var element2 = document.createElement("input"); element2.type = "text"; cell2.appendChild(element2); var cell3 = row.insertCell(2); cell3.innerHTML = ' <span onClick="edit(this)">Edit</span>/<span onClick="delete_row(this)">Delete</span>'; cell3.setAttribute("style", "display:none;"); var cell4 = row.insertCell(3); cell4.innerHTML = '<span onClick="save(this)">Save</span>'; } function save(e) { var elTableCells = e.parentNode.parentNode.getElementsByTagName("td"); elTableCells[0].innerHTML=elTableCells[0].firstChild.value; elTableCells[1].innerHTML=elTableCells[1].firstChild.value; elTableCells[2].setAttribute("style", "display:block;"); elTableCells[3].setAttribute("style", "display:none;"); } function edit(e) { var elTableCells = e.parentNode.parentNode.getElementsByTagName("td"); elTableCells[0].innerHTML='<input type="text" value="'+elTableCells[0].innerHTML+'">'; elTableCells[1].innerHTML='<input type="text" value="'+elTableCells[1].innerHTML+'">'; elTableCells[2].setAttribute("style", "display:none;"); elTableCells[3].setAttribute("style", "display:block;"); } function delete_row(e) { e.parentNode.parentNode.parentNode.removeChild(e.parentNode.parentNode); } </script> </head> <body > <div id="display"> <table id='table'> <tr id='id'> <td> Piemesons </td> <td> 23 </td> <td > <span onClick="edit(this)">Edit</span>/<span onClick="delete_row(this)">Delete</span> </td> <td style="display:none;"> <span onClick="save(this)">Save</span> </td> </tr> </table> <input type="button" value="Add new row" onClick="add_row();" /> </div> </body>

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 356 357 358 359 360 361 362 363 364 365 366 367  | Next Page >