Search Results

Search found 20617 results on 825 pages for 'mac os'.

Page 363/825 | < Previous Page | 359 360 361 362 363 364 365 366 367 368 369 370  | Next Page >

  • Migrating users and IIS settings from a workgroup win2k3 machine to a new win2k8r2

    - by amber
    I am retiring my old Windows Server 2003 Standard 32bit machine to a new machine with Windows Server 2008 R2 Standard. The two sticking points are migrating user accounts (and there are a lot of them) and IIS settings/websites (again, there are a lot). The new machine has not been provisioned yet. I'm at that point where I'm about install the OS on it. The old machibe is configured with a mirrored set for its OS and data partitions. I have broken the mirror set, replicated all of the data to an external drive, and then rebuilt the mirror set. In short, I have an image of the old machine to play with while safely leaving it up and running. Thanks!

    Read the article

  • Is it OK to create all primary partitions.?

    - by james
    I have a 320GB hard disk. I only use either ubuntu or kubuntu (12.04 for now). I don't want to use windows or any other dual boot os. And i need only 3 partitions on my hard disk. One for the OS and remaining two for data storage. I don't want to create swap also. Now can i create all primary partitions on the hard disk. Are there any disadvantages in doing so. If all the partitions are primary i think i can easily resize partitions in future. On second thought i have the idea of using seperate partition for /home. Is it good practice . If i have to do this, i will create 4 partitions all primary. In any case i don't want to create more than 4 partitions . And i know the limit will be 4. So is it safe to create all 3 or 4 primary partitions. Pls suggest me, What are the good practices . (previously i used win-xp and win-7 on dual boot with 2 primary partitions and that bugged me somehow i don't remember. Since then i felt there should be only one primary partition in a hard disk.) EDIT 1 : Now i will use four partitions in the sequence - / , /home , /for-data , /swap . I have another question. Does a partition need continuous blocks on the disk. I mean if i want to resize partitions later, can i add space from sda3 to sda1. Is it possible and is it safe to do ?

    Read the article

  • Google Chrome 5 et ses nombreuses améliorations sortent officiellement et simultanément sur Linux, M

    Mise à jour du 26/05/10 Google Chrome 5 et ses nombreuses améliorations sortent officiellement Et simultanément sur Linux, Mac et Windows L'arrivée de Chrome 6 sur le dev channel le laissait présager (lire ci-avant), Chrome 5 était en phase de finalisation. Ce n'est donc pas une surprise de voir arriver aujourd'hui la version officielle du navigateur de Google avec ses nombreuses améliorations : dont une « de 30 et 35 % aux be...

    Read the article

  • SATA Devices not showing up when in UEFI mode

    - by Dan Barzilay
    I'm trying to install Windows and the bios should be set to UEFI mode. The problem is that all SATA devices aren't showing up (shows as if there aren't any) so I can't boot from the installation CD (it's just not there). The weird thing is that when set to LEGACY mode they all show up.. SATA mode is set to AHCI and I'm on Lenovo Y510P. I have a Linux OS installed that is accessible only when BIOS is in LEGACY mode (otherwise the hard drive it's on is not available) I also tried reseting the BIOS settings which didn't help.. Comment please if more details needed Extra details: Computer model: Lenovo IdeaPad Y510P (not overcloacked) Installed Linux OS version: Linux 3.7-trunk-amd64 x86_64 Trying to install Windows: Windows 7 Ultimate 64bit BIOS Information: Vendor: LENOVO Version: 74CN26WW(V1.07) Update: Using user1608638 answer and suggestion of using the USB flash drive as the boot device instead of the CD/DVD method I succeeded in installing Windows 7! (Thanks alot user1608638)

    Read the article

  • How to automatically mount a folder and change ownership from root in virtualbox

    - by Fiztban
    It is my first time using virtualbox and ubuntu (14.04), I am on a host Windows 7 OS. I am trying to mount a shared folder that has files I need to access both in the virtualbox and on the windows OS. I have successfully mounted them using the vboxsf from the Guest Additions installed. To mount I used the command sudo mount -t vboxsf <dir name in vbox> <directory in linux for example I used sudo mount -t vboxsf Test /home/user/Test I found several ways of mounting the directories automatically upon startup using for example the /etc/rc.local method (here) where you modify said file appending the command to it (without sudo). Or by using the fstab method (here). I prefer the rc.local method personally. Once mounted it has permissions dr-xr-xr-x however once mounted the directory is of root ownership and chown user /home/user/Test has no effect. This means I cannot make or change files in it as a normal user. In the VirtualBox the directory to be shared is not set as read-only. Is there a way to automatically mount the shared folder and assign ownership to my non root user?

    Read the article

  • windows-server-2003, windows server, download utility from command line , http or ftp or any other p

    - by Michael
    Hello , I need to know if there is anyway utility bult-in windows 2003 that I can use from the command line to download a file using only one command. Basically I know that I can download from ftp using the "ftp" utility but in order to do that I need to do first "ftp open" and then pass the other commands so it doesn't help me because I need to do perform the download only from one command. The download may be performed through http, ftp or any other protocol. OS Name: Microsoft(R) Windows(R) Server 2003 Enterprise x64 Editio OS Version: 5.2.3790 Service Pack 2 Build 379 Thank you in advance for any answer !

    Read the article

  • Can I delete the OEM partition on the new Dell XPS 15?

    - by timepilot
    My new Dell XPS 15 L521X just arrived. I need to set this up to dual boot Linux. Sadly, the system comes with four primary partitions. I can't do a clean install at the moment, so one of the partitions will have to be deleted before I can install Linux. The layout is as follows: OEM: 39mb Hibernation: 8gb OS: 457gb Recovery: 12gb Obviously, I can't delete the Hibernation and OS partitions (will shrink to make space for Linux) and I'd like to keep the recovery partition if possible. So my question is what is on the small OEM partition? What functionality will I lose if I delete it?

    Read the article

  • How to install windows on a server with no CD or DVD drive

    - by user29266
    I've found a few posts on this site, however my situation is different. I have a new Dell server with no OS installed. I would like to install Windows 2008 Web Edition. I have a few USB ports and Ethernet. No CD or DVD drives. Is this article the best & only way to proceed? Installing Windows 2008 via USB thumbdrive or should I just get a external hardrive and hook it up to a usb. Once the OS is installed I'll never need a DVD drive again - so that's idea is a waste of money.

    Read the article

  • Procedure for dual booting (2 copies of Win-7) off 2 partitions on same disk

    - by Sam Holder
    What procedure should I follow to set a dual boot (both Win-7 x64) on a machine where (ideally): Both operating systems will be installed on the same physical disk in different partitions When booting into either operating system the contents of the other OS partition disk will not be seen (this just seems safer) Other hard drives in the system will be visible by both OS's 1 copy of Win7 is already installed. Is it as simple as shrinking the existing volume and creating the partition, then sticking the CD in and booting off it and formatting the new partition and then installing another copy of windows onto the new partition? Or will that not work? Or are there gotchas?

    Read the article

  • Can't access the Internet in VMware Workstation

    - by asunnysunday
    I'm using VMware 7.1.2 in Windows 7 with Ubuntu 11.04 as a guest OS. In the host OS (Windows 7), I can access the Internet without any problems but in the virtual machine I can't access the Internet. I've tried the following but with no success: Use all methods of connecting to the Internet in "Virtual Machine Settings": Bridged, NAT, Custom; none work. Used cabled and wireless connections on the PC - neither of them work. I've used Ubuntu in VMware for several months - previously the Internet was always accessible. Could the cause of this be because I upgraded to Ubuntu 11.04?

    Read the article

  • Eclipse Juno Switch Editor in Order

    - by inspectorG4dget
    In case it matters: OS: Mac OS X Lion (10.7.4) Eclipse: Juno, Build id: 20120614-1722 I have several files open in my eclipse workspace as tabs. The default shortcuts for previous and next editors are ?F6 and ?shiftF6. I know how to change these shortcuts, that's not the issue. However, what I want to do, is switch between editors in the way in which they're ordered in the tab bar. Currently, the editors change in order of last used/viewed. So, if I had three files (A, B and C in order) open and I'm currently editing A and I edited B last, when I use the shortcut for "Previous Editor", it takes me to B instead of C (and vice versa). Is there any way for me to get this functionality out of eclipse (if so, how)? Thank you

    Read the article

  • Dual boot centOS and Win7

    - by user1855965
    I posted this on stackoverflow, but it looks like superuser would be more appropriate. I have a CentOS 5 machine that runs Windows 7 as a dual boot. CentOS is the main OS and each OS is set up in a specific hard drive. This was set up before I joined the company and I don't really have need to run Windows now. My question is: can I, from CentOS, reformat the Windows HD, change GRUB settings and get the HD to be available on CentOS? Happy to provide more info if this helps. Many thanks for your help and apologies if this is a very simple issue... I don't want to blindly test things on this machine as it is used on a daily basis by several users.

    Read the article

  • Oracle Java Products Updates (2013/10/30)

    - by Hiro
    Oracle Java Products Media Pack ?????2013/10/30 ???????????????? Oracle JRE/JDK 7 Update 45 ???????????????????? ???????????????Apple Mac OS X (Intel) (64-bit), Linux x86, Linux x86-64, Microsoft Windows (32-bit), Microsoft Windows x64, Oracle Solaris on SPARC (32-bit), Oracle Solaris on SPARC (64-bit), Oracle Solaris on x86 (32-bit), Oracle Solaris on x86-64 (64-bit) ??? ?????

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Starting VM as an executable with as low overhead as possible

    - by Robert Koritnik
    Is there a solution to create a virtual machine and start it by having an executable file, that will start the machine? If possible to start as quickly as possible. Strange situation? Not at all. Read on... Real life scenario Since we can't have domain controller on a non-server OS it would be nice to have domain controller in an as thin as possible machine (possibly Samba or similar because we'd like to make it startup as quickly as possible - in a matter of a few seconds) packed in a single executable. We could then configure our non-server OS to run the executable when it starts and before user logs in. This would make it possible to login into a domain.

    Read the article

  • Blacklist a single access point of a wireless network

    - by Zr40
    At my university, one of the wireless access points is failing. When something tries to associate to the network using that access point, it deassociates the client, claiming 802.1X authentication failure. Other access points do work normally using the same credentials. The issue has been reported, but after a month it still has still not been fixed. Now, I'm looking for a way to blacklist the access point's BSSID, so the OS prefers other access points on the same SSID. How can I blacklist specific BSSIDs in either Mac OS X Snow Leopard or Windows 7?

    Read the article

  • Wrong resolution for TV connected via HDMI (32LG3000)

    - by timse201
    I have a LG Electronics 32LG3000 TV. I can't select the right resolution for my TV connected via HDMI. I can select 1360x768 but not 1366x768. The quality on my TV is very bad. HDMI1 connected 1360x768+1280+0 (normal left inverted right x axis y axis) 700mm x 390mm 1360x768 59.8*+ 1920x1080 60.0 1280x1024 60.0 1280x720 59.7 1024x768 75.1 70.1 60.0 832x624 74.6 800x600 75.0 60.3 640x480 75.0 60.0 59.9 720x400 70.1 I have a Intel 3000 graphic card and no settings menu like this there are no restricted drivers for my mac.

    Read the article

  • Win7 Professional x64 16GB (4.99GB usable)

    - by Killrawr
    I've installed Corsair Vengeance CMZ16GX3M2A1600C10, 2x8GB, DDR3-1600, PC3-12800, CL10, DIMM and my BIOS picks up that there is 16GB, Windows says there is 16GB, CPU-z says there is 16GB. But it only says I can use 4.99GB out of 16GB. Motherboard is P55-GD65 (MS-7583) Supports four unbuffered DIMM of 1.5 Volt DDR3 1066/1333/1600*/2000*/2133* (OC) DRAM, 16GB Max Windows (Above screenshot specifies that I am on a System type: 64-bit OS) CPU-z Microsoft says that the physical memory limit on a 64 bit win7 professional operating system is 192GB. Dxdiag Run Command BIOS Screenshot #1 BIOS Screenshot #2 Why is my OS limiting me to just over a quarter of the available memory? is there anyway to increase it?

    Read the article

  • What are the major distinctions between PureDarwin and FreeBSD?

    - by ??????? ???????????
    I'm looking to install a different unix on my workstation to acquire some perspective on GNU/Linux and out of curiosity. I have narrowed my options down to these two. The reason for considering PureDarwin is because I have very little experience with Apple's products. So my question is will installing and using PureDarwin give me a closer understanding of OSX than would running FreeBSD? What I have in mind are day to day routines like adding users, installing software and configuring various aspects of the underlying OS. I know that the GUI of OSX would not be available, but that is not a concern. As a secondary, less important question, can I buy OS X in the apple store and run it in a virtual machine or does that violate their EULA?

    Read the article

  • Is there an Ubuntu alternative to iExplorer (formerly iPhone Explorer)?

    - by nerdabilly
    I'm trying to view the entire contents of my iPhone in Ubuntu 10.04. I'm able to mount and view the digital media folders, but I'm looking for behavior more like the Mac/Windows iExplorer app that will list the /var folder as well as Applications, etc rather than just making it look like an external filesystem. I've found a few options that require jailbreak but I'd rather not go that route if it's at all possible. Thanks!

    Read the article

  • How to delete a folder in python when [Error 32] is present

    - by harish
    I am using python 2.7. I want to delete a folder which may or may not be empty. The folder is handled by thread for file-monitoring. I am not able to kill thread but wanted to delete this folder any how. I tried with os.rmdir(Location) shutil.rmtree(Location) os.unlink(Location) But, it didn't work. It is showing error as [Error 32] The process cannot access the file because it is being used by another process: 'c:\\users\\cipher~1\\appdata\\local\\temp\\fis\\a0c433973524de528420bbd56f8ede609e6ea700' I want to delete folder a0c433973524de528420bbd56f8ede609e6ea700 or delete whole path will also suffice.

    Read the article

  • Top causes of slow ssh logins

    - by Peter Lyons
    I'd love for one of you smart and helpful folks to post a list of common causes of delays during an ssh login. Specifically, there are 2 spots where I see a range from instantaneous to multi-second delays. Between issuing the ssh command and getting a login prompt and between entering the passphrase and having the shell load Now, specifically I'm looking at ssh details only here. Obviously network latency, speed of the hardware and OSes involved, complex login scripts, etc can cause delays. For context I ssh to a vast multitude of linux distributions and some Solaris hosts using mostly Ubuntu, CentOS, and MacOS X as my client systems. Almost all of the time, the ssh server configuration is unchanged from the OS's default settings. What ssh server configurations should I be interested in? Are there OS/kernel parameters that can be tuned? Login shell tricks? Etc?

    Read the article

  • Opera 12.10 disponible en beta : le navigateur norvégien s'attaque à Windows 8, Mountain Lion et aux écrans Retina

    Opera 12.10 disponible en beta Le navigateur s'attaque à Windows 8, Mountain Lion et aux écrans Retina Opera 12.10 vient de sortir en beta. Au menu, le support du SPDY, ce protocole proposé par Google pour accélérer le chargement des pages et de Web Socket (« depuis que les problèmes de sécurité ont été résolus » explique Opera Software), de nouvelles API pour créer des extensions, une meilleure intégration dans Mac OS X Mountain Lion et le support des écrans Retina. Des améliorations sur le zoom tactile ont également été faites pour la version Windo...

    Read the article

  • Solaris 11 installed, no updates?

    - by Paul De Niro
    I was messing around with solaris and decided to give Solaris 11 a try so I downloaded it from the Oracle website. After installing the OS, I went into the package manager and did an update. It told me that there were to available updates! I find this hard to believe considering that it's running a vulnerable version of firefox and java, its own in-house software product! Many of the other software products that came with the default install are also out of date and vulnerable. Is this normal for an Oracle install, or did I do something wrong with the upgrade process? I typed "pkg update" at the prompt, and I noticed that it did call out to pkg.oracle.com looking for updates. I find it bizarre that there are no updates available for an OS that was released a couple months ago with vulnerable software...

    Read the article

< Previous Page | 359 360 361 362 363 364 365 366 367 368 369 370  | Next Page >