Search Results

Search found 62759 results on 2511 pages for 'view first'.

Page 363/2511 | < Previous Page | 359 360 361 362 363 364 365 366 367 368 369 370  | Next Page >

• Labels mail merge repeats on subsequent pages?

  - by leeand00

  I'm trying to do a mail merge to print to labels. The first field in the document does not contain a { NEXT } field code, and because of this the records repeat between label pages for example: Notice how the records shift to the left as the next page is displayed? But how they start over again in an off by one manner? Now I've tried to fix this by using the first record displayed on a page to see if the page number is 1. If it not on page 1 of the mail merge then it should just move to the next record; otherwise it should just display the first record: This doesn't work however, because when I do the preview and display the {page} field code, it reports that I am always on page 1 and thus the same behavior continues instead of just moving to the next record on the next page.

  Read the article

• SMTP Server Issue in intersystem cache

  - by nayanak

  I am facing an issue when I am sending Email from intersystems cache. I am able to send the mail, with out any problem the first time. But the second time when I am trying to send the smtp server is not responding properly. The first Helo command is sent. I recieve the confirmation 220 from the server. But I do not recieve the Message 250. So the next command is giving me the error 503, 5.5.2 "Send helo first" message. I am unable to find out why the server is not responding the second time.

  Read the article

• Unable to connect to second name of Windows 2008 Server R2 machine from XP

  - by Tumba

  I used the command netdom computername /add:newname.domainname.com to add a second name to a server running Windows 2008 Server R2. After restarting the server, I had DNS "A" entries for both names. In addition, the second name was added to HKLM\SYSTEM\CurrentControlSet\services\LanmanServer\Parameters\OptionalNames, which I believe should have taken care of any NetBIOS resolution. From my Windows 7 workstation, I can ping both names and running net view on both names reveals the same list of resources. From Windows XP, I can ping both names, but net view only works on the first name. Running net view on the second name returns: System error 52 has occurred. You were not connected because a duplicate name exists on the network. Go to System in Control Panel to change the computer name and try again. What do I need to do to make the second name usable from XP clients? Update: I was able to resolve the problem by adding the REG_DWORD key DisableStrictNameChecking = 1 to HKLM\SYSTEM\CurrentControlSet\services\LanmanServer\Parameters, then restarting the Server service. However, I do not understand why this was necessary.

  Read the article

• Laptop power supplies, does current matter?

  - by CodeSlave

  I have two laptops (same manufacture), with the same type of power connector. However, the power supplies/transformers are slightly different. The output on the first laptop's power supply is 15.6 V at 8.0 A. The output on the second laptop's power supply is 15.6 V at 5A. Clearly the voltages are the same, but the currents are different. I assume the second laptop's power supply can not be used on the first, because it can't supply enough power to the laptop. However, can the first laptop's power supply be safely used on the second laptop?

  Read the article

• Is there a reason the partition tool GParted doesn't show a percentage finish number initially?

  - by Jian Lin

  I am using GParted more, and it seems to do a reliable work. I just wonder why if the tasks is to resize a 250GB partition to 190GB, and then create a new partition, the first 10, 15 minutes, there is only a blue bar moving left and right, but there won't be an indicator showing how many percent is done. Then after that 10 to 15 minutes, it does show 1:05:00 left to finish the job. Update: at first I thought there is no percentage or time remaining at all... but after waiting for 10, 15 mintues, it does show. I just wonder why it didn't show at first.

  Read the article

• .htaccess modify rules and redirect if there's .php in the url

  - by Ron

  Hello everyone. I got the following code in my .htaccess: Options +FollowSymlinks RewriteBase /temp/test/ RewriteEngine on RewriteCond %{REQUEST_FILENAME} !-d RewriteCond %{REQUEST_FILENAME}\.php -f RewriteRule ^about/(.*)/$ $1.php [L] RewriteRule ^(.*)/download/(.*)/(.*)/(.*)/downloadfile/$ file-download.php?product=$1&version=$2&os=$3&method=$4 [L] RewriteRule ^(.*)/download/(.*)/(.*)/(.*)/$ download-donate.php?product=$1&version=$2&os=$3&method=$4 [L] RewriteRule ^(.*)/download/(.*)/$ download.php?product=$1&version=$2 [L] RewriteRule ^newsletter-confirm/(.*)/$ newsletter-confirm.php?email=$1 [L] RewriteRule ^newsletter-remove/(.*)/$ newsletter-remove.php?email=$1 [L] RewriteRule ^(.*)/screenshots/$ screenshots.php?product=$1 [L] RewriteRule ^(.*)/(.*)/$ products.php?product=$1&page=$2 [L] RewriteRule ^schedule-manager/$ products.php?product=schedule-manager&page=view [L] RewriteRule ^visual-command-line/$ products.php?product=visual-command-line&page=view [L] RewriteRule ^windows-hider/$ products.php?product=windows-hider&page=view [L] RewriteRule ^(.*)/$ $1.php [L] RewriteRule ^products/$ products.php [L] everything work perfect. I would like to know how can I modify it so it will be less lines. I am pretty sure I can atleast remove 4-5 lines, but I dont know how. (merge the schedule-manager, visual-command-line and windows-hider, and some more). I know that the order of the rules is important, this order works - although I have no idea why, I just played with the rules until it worked. If you think that there'll be a bug with the following order please tell me where. Another thing - I would like to redirect for example www.myweb.com/products.php to www.myweb.com/products/ (I mean that the URL in the address bar will change). I dont know if the redirect can go along with my rewrite rules. Thank you.

  Read the article

• Multi-Document TOC showing in wrong order

  - by Jeremy DeStefano

  I had a large document that was having formatting issues, so I split it into 2 files. Chapters 1-7 are in the main doc with the TOC and a second doc has chapters 8-12. I have the following: {TOC \O "1-3" \H \Z \U} {RD \f "MCDPS Training Manual Part2.docx"} The TOC is created and has entries from both documents, however its showing the entries from Chapter 8-11 first and then Chapter 1-7. I've read that it should list them based on page numbers, but its not. Chapter 8 starts at page 121, yet its listing it first. How can I get it to show the TOC from the main doc first and then the RD?

  Read the article

• Flow of packets in network

  - by user58859

  I can't visualize in my mind the network traffic flow. eg. If there are 15 pc's in a LAN When packet goes from router to local LAN, do it passes all the computers? Does it go to the ethernet card of every computer and those computers accept the packet based on their physical address? To which pc the packet will go first? To the nearest to the router? What happens if that first pc captures that packet(though it is not for it)? What happens when a pc broadcast a message? Do it have to generate 14 packets for all the pc's or only one packet reach to all pc's? If it is one packet and captured by first pc, how other pc's can get that? I can't imagine how this traffic is exactly flows? May be my analogy is completely wrong. Can anybody explain me this?

  Read the article

• configuration issue with respect to .htaccess file on ubuntu

  - by Registered User

  I am building an application tshirtshop I have following configuration in /etc/apache2/sites-enabled/tshirtshop <VirtualHost *:80> ServerAdmin webmaster@localhost DocumentRoot /var/www/tshirtshop <Directory /var/www/tshirtshop> Options Indexes FollowSymLinks AllowOverride All Order allow,deny allow from all </Directory> ErrorLog ${APACHE_LOG_DIR}/error.log # Possible values include: debug, info, notice, warn, error, crit, # alert, emerg. LogLevel warn CustomLog ${APACHE_LOG_DIR}/access.log combined </VirtualHost> and following in .htaccess file in location /var/www/tshirtshop/.htaccess <IfModule mod_rewrite.c> # Enable mod_rewrite RewriteEngine On # Specify the folder in which the application resides. # Use / if the application is in the root. RewriteBase /tshirtshop #RewriteBase / # Rewrite to correct domain to avoid canonicalization problems # RewriteCond %{HTTP_HOST} !^www\.example\.com # RewriteRule ^(.*)$ http://www.example.com/$1 [R=301,L] # Rewrite URLs ending in /index.php or /index.html to / RewriteCond %{THE_REQUEST} ^GET\ .*/index\.(php|html?)\ HTTP RewriteRule ^(.*)index\.(php|html?)$ $1 [R=301,L] # Rewrite category pages RewriteRule ^.*-d([0-9]+)/.*-c([0-9]+)/page-([0-9]+)/?$ index.php?DepartmentId=$1&CategoryId=$2&Page=$3 [L] RewriteRule ^.*-d([0-9]+)/.*-c([0-9]+)/?$ index.php?DepartmentId=$1&CategoryId=$2 [L] # Rewrite department pages RewriteRule ^.*-d([0-9]+)/page-([0-9]+)/?$ index.php?DepartmentId=$1&Page=$2 [L] RewriteRule ^.*-d([0-9]+)/?$ index.php?DepartmentId=$1 [L] # Rewrite subpages of the home page RewriteRule ^page-([0-9]+)/?$ index.php?Page=$1 [L] # Rewrite product details pages RewriteRule ^.*-p([0-9]+)/?$ index.php?ProductId=$1 [L] </IfModule> the site is working on localhost and is working as if there is no .htaccess rule specified i.e. if I were to view a page as http://localhost/tshirtshop/nature-d2 then I get a 404 Error but if I view the same page as http://localhost/tshirtshop/index.php?DepartmentId=2 then I can view it. What is the mistake if any one can point out in above configuration, or else I need to check any thing else? sudo apache2ctl -M Loaded Modules: core_module (static) log_config_module (static) logio_module (static) mpm_prefork_module (static) http_module (static) so_module (static) alias_module (shared) auth_basic_module (shared) authn_file_module (shared) authz_default_module (shared) authz_groupfile_module (shared) authz_host_module (shared) authz_user_module (shared) autoindex_module (shared) cgi_module (shared) deflate_module (shared) dir_module (shared) env_module (shared) mime_module (shared) negotiation_module (shared) php5_module (shared) reqtimeout_module (shared) rewrite_module (shared) setenvif_module (shared) status_module (shared) Syntax OK I am using Apache2 on Ubuntu 12.04

  Read the article

• Word: MAC 2011, TOC on too many pages

  - by Mark

  I have a Word: MAC 2011 document where the bottom of the first 40 pages or so say "TOC: Page x". This notation appears to be in the Footer, as it is gray until I click on it (then the rest of the text goes gray instead). There is no TOC that I can see in the document, so I'm presuming someone tried to create one and messed things up. After the first 40 pages or so, all the other bottom of the page notations appear to be correct. (i.e. Chapter One, Chapter Two, etc.) How can I get those first 40 pages to be part of Chapter One rather than TOC?

  Read the article

• Network Sharing Issues

  - by Mark Kramer

  I have two computers I want to have on a network share together (so the laptop can print through the desktop's printer). These are both connected to the same router. (One wired and one wireless) And they both have the same workgroup name. However, when I type "net view" in the command prompt, the only computer that shows up is the computer I type the command into. How do I get these computers to be shared with each other? Update: The tower is running Windows XP, the Laptop is running Windows 7. I have disabled the Firewall on both until I get this set up. Update 2: Typing the command net view on my desktop is acting very strangely. Noe sometimes it only shows itself on the list of computers, sometimes it shows itself and the laptop and sometimes it doesn't work at all and displays system error 6118. I typed net view into the command prompt on the Windows 7 laptop and both computers showed up, so I went to connect to the desktop from the laptop and it said the dekptop could not be found, even though it is showing up int he list of shared computers. Here are supporting pictures (these are coming from the laptop)

  Read the article

• Why does Windows Explorer highlight only second entry?

  - by normanius

  Why does Windows Explorer highlight the second but never the first entry if I use the keyboard for navigation? Example: let's look at a folder that contains the following entries a1 a2 a3 b1 b2 If I hit 'a' on the keyboard, the explorer highlights entry 'a2' instead of 'a1'. It works fine for 'b' with 'b1' (because it's not the first entry). Similarly, if I open a folder and use the arrow-down key to navigate then the first entry is skipped again. Why?! It's probable that I'm too stupid for this but this "feature" really annoys me!

  Read the article

• Boot from Second SATA Drive

  - by Chris

  I have a Dell Precision 490 Workstation, and I just had my other question answered, Install Ubuntu to drive B without impacting drive A, and now I'm having a boot sequence issue. The external drive is great, boots up fine on my laptop, but how do I tell my desktop to boot from my second SATA drive and not the first SATAdrive. My drive configuration as follows SATA-0: Windows SATA-1: DVDR SATA-2: Ubuntu When I choose the boot menu, the option I have is "Internal Hard Drive". I assume it searches all drives, and loads the first bootable one it finds (which happens to be Windows), but I'd like to be able to select the drive from a list. Has anyone experienced this? Is possible without disabling the first hard drive in the BIOS?

  Read the article

• Pre-load MS Windows right-click menus and Start menu at startup

  - by Steve

  Hello brainy people. On my WinXP SP3 laptop (1.4Ghz 1.2GB ram), after I first log in, when I right-click in Windows Explorer and choose New, the submenu can take up to 15 seconds to load, which is a pain in the ass when you want to do a quick easy operation. After the submenu has loaded the first time, subsequent loads perform instantly, obviously as the menu has been cached. My question is: can these right-click menus (and the Start menu, which also takes some time to load the first time) be pre-loaded at Windows startup? Thanks.

  Read the article

• How Do I Enable CUPS Browsing Across A Network?

  - by David Mackintosh

  I have a CUPS server with two print queues defined. Once this was defined, all the CUPS clients on the same subnet could see the two print queues automatically, no problem. Now I have a collection of machines on a separate subnet, reachable from the first subnet by a router. How do I enable CUPS browsing on the second set of machines so that they can see the print queues defined on the first machine? Let's call the server A.B.C.7. The first subnet is A.B.C.0/24. The second subnet is A.B.D.0/24, and there is a router with arms on both networks.

  Read the article

• Excel Matching problem with logic expression

  - by abelenky

  I have a block of data that represents the steps in a process and the possible errors: ProcessStep Status FeesPaid OK FormRecvd OK RoleAssigned OK CheckedIn Not Checked In. ReadyToStart Not Ready for Start I want to find the first Status that is not "OK". I have attempted this: =Match("<>""OK""", StatusRange, 0) which is supposed to return the index of the first element in the range that is NOT-EQUAL (<) to "OK" But this doesn't work, instead returning #N/A. I expect it to return 4 (index #4, in a 1-based index, representing that CheckedIn is the first non-OK element) Any ideas how to do this?

  Read the article

• Query specific nameserver for a particular domain upon VPN connect

  - by MT

  Some background: I have a work laptop with Ubuntu 9.10 on it. I have a small network at home where I've been running some basic services (for myself/my family) for 10 some years. In my home network there is a nameserver (Fedora) running Bind 9 with two "views". One view is the "outside" view and it provides name resolution (to the Internet at large) for email, a wiki, and a couple of blogs. The "inside" view provides name resolution (to the internal RFC1918 addresses of theses servers) as well as all the inside hosts, network equipment, ...etc. I connect with an openvpn client to my home network from outside (such as work). What I'd like to be able to do is resolve names on my internal network across this VPN (so I get the RFC1918 "inside" responses) without fully changing my resolver to the DNS server at my hose. For example, if I connect to the VPN from work, I can change my resolver (by editing resolv.conf) to the DNS server at my house (across the VPN) and then successfully resolve all of the inside DNS names on my home network. The issue I have with this is that now I'm no longer able to resolve "inside" names provided by my work's DNS servers (because I'm using my home DNS server). Alternatively, I can connect to the VPN and access my home severs via IP addresses directly, but this is inconvenient and causes issues with Apache name-based hosting (among other things). In the end, the effect I'm trying to achieve is as follows: When I connect to the VPN I automatically start sending DNS requests for *.myhomedomain.com to my home nameserver, but any other requests continue to go the the nameserver I was using before (the one I received on my company LAN via DHCP). When I disconnect the VPN, requests for *.myhomedomain.com go back to the local LAN DNS server (e.g. all requests are going there now). I'm looking for suggestion at to how this can be accomplished.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• ESX Firewall Command Troubles

  - by John

  Hi, I am working on creating some firewall rules to stop some of the SSH brute-force attacks that we have seen recently on our ESX server hosts. I have tried the following rules from the CLI to first block all SSH traffic and then allow the two ranges that I am interested in: esxcfg-firewall --ipruleAdd 0.0.0.0/0,22,tcp,REJECT,"Block_SSH" esxcfg-firewall --ipruleAdd 11.130.0.0/16,22,tcp,ACCEPT,"Allow_PUBLIC_SSH" esxcfg-firewall --ipruleAdd 10.130.0.0/16,22,tcp,ACCEPT,"Allow_PRIVATE_SSH" However, these rules are not working as intended. I know that if you do not enter the block rule first, then the allow rule will not be processed. We are now having the issue where the first entered allow rule is being ignored such that the block rule works and the last entered allow rule works. I was curious if anyone had any ideas on how I could allow a few different ranges of IP's with the esxcfg-firewall --ipruleAdd command? I am at a loss and am having a hard time locating examples or further documentation about this. Thanks in advance for your help with this.

  Read the article

• Sudo asks for password twice with LDAP authentication

  - by Gnudiff

  I have Ubuntu 8.04 LTS machine and Windows 2003 AD domain. I have succesfully set up that I can log in with domain username and password, using domain prefix, like "domain+username". Upon login to machine it all works first try, however, for some reason when I try to sudo my logged in user, it asks for the password twice every time when I try sudo. It accepts the password after 2nd time, but not the first time. Once or twice I might think I just keep entering wrong pass the first time, but this is what happens always, any ideas of what's wrong? pam.conf is empty pam.d/sudo only includes common-auth & common-account, and common-auth is: auth sufficient pam_unix.so nullok_secure auth sufficient pam_winbind.so auth requisite pam_deny.so auth required pam_permit.so

  Read the article

• How to convert excel individual cell values to percentage change values over time

  - by cgalloway

  I have two years of excel data showing daily share prices of a particular stock. I want to change those values to show percentage change (on a daily basis) from the zero date (ie the first day of the two year period). I know that the formula for showing daily percentage change would be (second day/first day -1) and that I can click and drag on that formula to extend over the rest of the two-year time period. The formula I want would be, basically, (each day/first day-1). Is there an easy way to automate the script so I dont have to type it out 730 times?

  Read the article

• Asterisk Register username with special character like "@"

  - by Najibul Huq

  I am using a SIP provider that has provided me with a username like: [email protected] (Note this is only the username part) And has a numerical password. My Register string looks something like this: [email protected]:[email protected] But this is not working, as asterisk is only sending the first part +112223344 before the first @. My provider is adamant about having the full form of it. This is the first time I am facing this issue that is quite unusual for me. Please help.

  Read the article

• Merged rows in column, bottom row fixed height

  - by Styxxy

  I've been struggling some time now with a specific problem using Tables in MS Word (2010). I have a table with 2 rows and 2 columns and the last column, the rows are merged. Now it can happen that this last cell will expand, and I would like to have the last row in the first column to be of a fixed height and the first row has to expand. What happens now is that the last row expands and the first row has a "fixed" height. A picture of the behaviour at this moment: And this is how I would like it to behave: I have been looking through all properties and settings, but I don't seem to find any option. Neither can I found anything by searching online (probably not using the exact right keywords). Any help is appreciated.

  Read the article

• Ubuntu 12.04 on Amazon EC2: /dev/xvda1 will be checked for errors at next reboot?

  - by cwd

  I'm running the lastest Ubuntu 12.04 AMI (ami-a29943cb) from Canonical on Amazon EC2 and quite often when I log in I get the message: *** /dev/xvda1 will be checked for errors at next reboot *** I have read a bunch of documentation on this and seem to understand that every so many reboots (around 37 see Mount count / Maximum mount count below) Ubuntu wants to check a disk for errors. I can see that by using dumpe2fs -h /dev/xvda1 (reference) to get information such as: Last mounted on: / Filesystem UUID: 1ad27d06-4ecf-493d-bb19-4710c3caf924 Filesystem magic number: 0xEF53 Filesystem revision #: 1 (dynamic) Filesystem features: has_journal ext_attr resize_inode dir_index filetype needs_recovery extent flex_bg sparse_super large_file huge_file uninit_bg dir_nlink extra_isize Filesystem flags: signed_directory_hash Default mount options: (none) Filesystem state: clean Errors behavior: Continue Filesystem OS type: Linux Inode count: 524288 Block count: 2097152 Reserved block count: 104857 Free blocks: 1778055 Free inodes: 482659 First block: 0 Block size: 4096 Fragment size: 4096 Reserved GDT blocks: 511 Blocks per group: 32768 Fragments per group: 32768 Inodes per group: 8192 Inode blocks per group: 512 Flex block group size: 16 Filesystem created: Tue Apr 24 03:07:48 2012 Last mount time: Thu Nov 8 03:17:58 2012 Last write time: Tue Apr 24 03:08:52 2012 Mount count: 3 Maximum mount count: 37 Last checked: Tue Apr 24 03:07:48 2012 Check interval: 15552000 (6 months) Next check after: Sun Oct 21 03:07:48 2012 Lifetime writes: 2454 MB Reserved blocks uid: 0 (user root) Reserved blocks gid: 0 (group root) First inode: 11 Inode size: 256 Required extra isize: 28 Desired extra isize: 28 Journal inode: 8 Default directory hash: half_md4 Directory Hash Seed: 0a25e04c-6169-4d68-bfa6-a1acd8e39632 Journal backup: inode blocks Journal features: journal_incompat_revoke Journal size: 128M Journal length: 32768 Journal sequence: 0x0000158b Journal start: 1 I've tried these things to get rid of the message and usually the badblocks is what does it for me: Run this command and reboot: sudo touch /forcefsck Run badblocks to check the disk: badblocks /dev/sda1 Edit /etc/fstab and change the last "0" which is the fs_passno column accordingly and then reboot: The root filesystem should be specified with a fs_passno of 1, and other filesystems should have a fs_passno of 2. I don't understand: If this is a virtual drive shouldn't it be less prone to errors? Was the image created with one of the flags set? If not what is triggering it? Why is fs_passno set to 0 on Amazon EC2 Ubuntu images? This is not the first one that is like this.

  Read the article

• Sublinear Extra Space MergeSort

  - by hulkmeister

  I am reviewing basic algorithms from a book called Algorithms by Robert Sedgewick, and I came across a problem in MergeSort that I am, sad to say, having difficulty solving. The problem is below: Sublinear Extra Space. Develop a merge implementation that reduces that extra space requirement to max(M, N/M), based on the following idea: Divide the array into N/M blocks of size M (for simplicity in this description, assume that N is a multiple of M). Then, (i) considering the blocks as items with their first key as the sort key, sort them using selection sort; and (ii) run through the array merging the first block with the second, then the second block with the third, and so forth. The problem I have with the problem is that based on the idea Sedgewick recommends, the following set of arrays will not be sorted: {0, 10, 12}, {3, 9, 11}, {5, 8, 13}. The algorithm I use is the following: Divide the full array into subarrays of size M. Run Selection Sort on each of the subarrays. Merge each of the subarrays using the method Sedgwick recommends in (ii). (This is where I encounter the problem of where to store the results after the merge.) This leads to wanting to increase the size of the auxiliary space needed to handle at least two subarrays at a time (for merging), but based on the specifications of the problem, that is not allowed. I have also considered using the original array as space for one subarray and using the auxiliary space for the second subarray. However, I can't envision a solution that does not end up overwriting the entries of the first subarray. Any ideas on other ways this can be done? NOTE: If this is suppose to be on StackOverflow.com, please let me know how I can move it. I posted here because the question was academic.

  Read the article

< Previous Page | 359 360 361 362 363 364 365 366 367 368 369 370  | Next Page >