Search Results

Search found 9567 results on 383 pages for 'hg convert'.

Page 37/383 | < Previous Page | 33 34 35 36 37 38 39 40 41 42 43 44  | Next Page >

  • Convert GMT time to local time

    - by Dibish
    Am getting a GMT time from my server in this format Fri, 18 Oct 2013 11:38:23 GMT My requirement is to convert this time to local time using Javascript, eg:/ if the user is from India, first i need to take the time zone +5.30 and add that to my servertime and convert the time string to the following format 2013-10-18 16:37:06 I tried with following code but not working var date = new Date('Fri, 18 Oct 2013 11:38:23 GMT'); date.toString(); Please help me to solve this issue, Thanks in advance

    Read the article

  • How to convert a PGresult to custom data type with libpq (PostgreSQL)

    - by mocopera
    Hi everyone! I'm using the libpq library in C to accessing my PostgreSQL database. So, when I do res = PQexec(conn, "SELECT point FROM test_point3d"); I don't know how to convert the PGresult I got to my custom data type. I know I can use the PQgetValue function, but again I don't know how to convert the returning string to my custom data type. Any suggestion? Thanks in advice.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Convert Java.Util.HashMap to System.Collections.IDictionary

    - by Paul
    In Xamarin I've got a .jar I've imported using a Java Binding Library. One of the callbacks has a Java.Lang.Object parameter which gives me Java.Util.HashMap and Java.Util.ArrayList at runtime. I'm abstracting this SDK behind a cross-platform interface, so I need to convert this to a .NET type. It there anything like the ArrayAdapter except in reverse that can convert the Java types to their .NET equivalents?

    Read the article

  • How to convert a BufferedImage to 8 bit?

    - by Zach Sugano
    I was looking at the ImageConverter class, trying to figure out how to convert a BufferedImage to 8-bit color, but I have no idea how I would do this. I was also searching around the internet and I could find no simple answer, they were all talking about 8 bit grayscale images. I simply want to convert the colors of an image to 8 bit... nothing else, no resizing no nothing. Does anyone mind telling me how to do this.

    Read the article

  • Convert video from .mp4 to .ogg

    - by Unknown
    I am using ffmpeg version 0.11.1 Copyright (c) 2000-2012 the FFmpeg developers . I need to convert a file .mp4, to .ogg format. I am on Mac OS X, and I have tried this so far: ffmpeg -i sample_mpeg4.mp4 -acodec vorbis -vcodec libtheora -f ogg output.ogv I am getting: Unknown encoder 'libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec --enable-libtheora output.ogv I am getting: Unknown encoder '--enable-libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec libtheora -f ogv output.ogv I am getting: [NULL @ 0x7f81bb00f800] Requested output format 'ogv' is not a suitable output format output.ogv: Invalid argument ffmpegtheora is not an option as it can not be install on the server.

    Read the article

  • Convert any object to pretty HTML in java

    - by ripper234
    How can I convert a given object (in a generic way with reflection) to pretty printable HTML? What ready made library do you recommend that does this? I need support for simple nested objects (as long as they don't create loops in the object graph). I tried to convert it to JSON, but DefaultPrettyPrinter is not HTML friendly.

    Read the article

  • Convert &euro; -> € in XUL

    - by Michael
    I need to convert HTML special symbols to their appropriate Unicode values in my Firefox extension. I'm not dealing with HTML DOM, so can't use the trick with giving value to div and taking back. Also there are too many of them to convert manually. Thought Firefox has something to use. The converted text should go to XUL's description element on statusbar. Any idea how to accomplish this?

    Read the article

  • When to use reflection to convert datarow to an object

    - by Daniel McNulty
    I'm in a situation now were I need to convert a datarow I've fetched from a query into a new instance of an object. I can do the obvious looping through columns and 'manually' assign these to properties of the object - or I can look into reflection such as this: http://www.codeproject.com/Articles/11914/Using-Reflection-to-convert-DataRows-to-objects-or What would I base the decision on? Just scalability??

    Read the article

  • VMware convert to Virtualbox?

    - by TechSavvySmurf
    I downloaded a Kali Linux ISO VMware image thinking that it would be able to run in Virtualbox as well. However, this only seems to be the case with .vmdk files, and my image is a .vm.tar.gz file. Virtualbox does not recognize it as a valid ISO file, and I am not sure how to convert it. The entire thing is kali-linux-1.0-i386-gnome-vm.tar.gz The goal is to be able to run this in a Virtualbox, is there any way to convert this from VMware to Virtualbox?

    Read the article

  • Convert Custom Firefox Setup to Firefox Portable?

    - by dfree
    I have a pretty awesome firefox set up and spent a lot of time getting it perfect. Is there any way that anyone knows about to convert the entire configuration to portable? Programs like MozBackup are great for backing up the complete set up, but you can't restore a Firefox profile to Firefox portable (maybe there is a workaround to fake it out? or possibly another method?) In case anyone is interested here is the gist of the best add-ons I've found: Autopager (scroll down google and other multi page results without clicking next) Coral IE Tab (IE in firefox - in case a website 'insists' that you use IE) Cyber search (search google straight from the address bar - VERY HELPFUL) Download StatusBar (display progress of downloads in the bottom of ff - no annoying popups FireFTP (erases need for an external FTP client - opens in a tab) Gmail manager (if you use multiple gmail accounts) Session Manager (saving multiple sessions of tabs - ff session recover) Surf Canyon (pull relevant stuff out of the depths of search results - even from craigslist Tab Mix Plus (ESSENTIAL - tab behavior customization - have multiple rows of tabs I also have it set up so you can type 'g test' in the address bar and ff will pull up the google results for 'test'. Similarly have it set up for guitar tabs (tab), facebook (f), wikipedia (w), google maps from my house (gmhome), torrents (tor), ticketmaster (t), rotten tomatoes (rt), craiglist (c) plus about 20 other sites.

    Read the article

  • Need clear steps on how to convert a Windows 2000 Server to a XenServer VM

    - by Jay
    The source system is not local. The target host running XenServer is not local. The source system is running Windows 2000 Server SP4 and has 1 disk split into 6 partitions, all NTFS: C: 6 GB (boot) D: 15 GB E: 6 GB F: 6 GB G: 5 GB H: 26 GB Most of the partitions are mostly mostly full ( 60%). What is the most straightforward way to do a P2V migration of the server? I can do minor database & data syncs after the P2V is successful & running as a VM within XenServer, it's just getting to that point which is not clear. The option of installing a Windows 2000 Server from scratch is not available, I need to convert the existing physical server as-is into a VM to be hosted within a XenServer environment. I've looked at XenConvert but it maxes out on converting only 4 partitions in one shot, and I'm not certain how to account for the 2 extra partitions. I'm not familiar with XenServer but it's my only option right now to go P2V.

    Read the article

  • Convert a Linksys WAG54GP2 ADSL router into Access point only to extend my Wifi range

    - by Preet Sangha
    I have a wireless lan running on my ASDL2 connection. The router (Seimens Gigaset sx763) is provided by the ISP and is generally good. However I have couple of dead spots at the far end of the house and since I have my old router sitting in the drawer I thought that I'd try to convert it into simple WAP. However downloading the manual from linksys it seems to be that the manual is from an earlier firmware, but the very first option on the very first page seems promising: Wan Mode: Router or ADSL However after this I'm a bit lost. I know that the wireless card on this box will need a mac address and it must get its address from the master router (I thought static might be best). However the again the manual is out of date I have the option of DHCP: ON or OFF or RELAY I've not even got to the more complex options yet. Question is can this device even work this way (seems like it but I cannot find any docs on it), and if so how? Edit: Having now fiddled around I'm of the opinion that this cannot be done.

    Read the article

  • Need clear steps on how to convert a Windows 2000 Server to a XenServer VM

    - by Jay
    The source system is not local. The target host running XenServer is not local. The source system is running Windows 2000 Server SP4 and has 1 disk split into 6 partitions, all NTFS: C: 6 GB (boot) D: 15 GB E: 6 GB F: 6 GB G: 5 GB H: 26 GB Most of the partitions are mostly mostly full ( 60%). What is the most straightforward way to do a P2V migration of the server? I can do minor database & data syncs after the P2V is successful & running as a VM within XenServer, it's just getting to that point which is not clear. The option of installing a Windows 2000 Server from scratch is not available, I need to convert the existing physical server as-is into a VM to be hosted within a XenServer environment. I've looked at XenConvert but it maxes out on converting only 4 partitions in one shot, and I'm not certain how to account for the 2 extra partitions. I'm not familiar with XenServer but it's my only option right now to go P2V.

    Read the article

  • Convert Mac font to Windows format?

    - by Moshe
    I have a font that was used on Mac OS X 10.5. Mac recognizes it as a font file. Windows Vista shows it as a "File". Changing the file extension doesn't work. I tried both .otf and .ttf and neither worked. (Surprise! I didn't thinks so, but I'd be a fool for asking if that was the answer, so I tried...) Perhaps I need to try a different extension? Are there any utilities to convert the font? A Windows equivalent? It's called Franco. (FrancoNormal, actually.) Thanks. EDIT: DFontSplitter didn't work. I saw something online about "data fork" and "resource fork" that has to match up. Can someone please explain that? Do I need both for a font conversion? What do I tell my graphic designer to send me? EDIT 2: The font doesn't work when downloaded to Mac OS X either. (A different machine from the original.) "Get Info" reveals that there is no file extension, leading me to believe that this is the newer font format. Where wold I find the the "data fork" and "resource fork" on the Mac? I want to be able to tell the designer exactly where to look. EDIT 3: DFontSplitter works on the original computer but not on my PC. I converted and emailed myself the fonts from the graphic designers laptop. I guess it has to do with the data being stored in a "fork" whatnot. Thanks, Matt for that article. Thank you again for your help!

    Read the article

  • ftp.exe does not convert end of line characters while transferring to FreeBSD ftp server

    - by Jagger
    I am having problems transferring a text file from Windows 7 using ftp.exe to a FreeBSD server. After the file transfer the end-of-line characters are not changed from \r\n to \n, Instead they remain with the carriage return character which can be seen in for example mcedit as ^M. The file is transferred in ascii mode. Has anybody run into similar problems in the past? As far as I know using the ascii mode during FTP transfer should convert those characters automatically. Does it depend on the server configuration? EDIT: The file can be seen here. EDIT: I have also tried with ncftp.exe under Cygwin but the result is the same. The carriage return character has not been removed even if the transfer type was ASCII. EDIT: It does not work the other way round either. I created a text file in FreeBSD and then downloaded it is ASCII mode to my Windows machine. The end of line characters remained LF as they were in FreeBSD.

    Read the article

< Previous Page | 33 34 35 36 37 38 39 40 41 42 43 44  | Next Page >