Search Results

Search found 32752 results on 1311 pages for 'multi line'.

Page 376/1311 | < Previous Page | 372 373 374 375 376 377 378 379 380 381 382 383  | Next Page >

• ODEE Green Field (Windows) Part 4 - Documaker

  - by AndyL-Oracle

  Welcome back! We're about nearing completion of our installation of Oracle Documaker Enterprise Edition ("ODEE") in a green field. In my previous post, I covered the installation of SOA Suite for WebLogic. Before that, I covered the installation of WebLogic, and Oracle 11g database - all of which constitute the prerequisites for installing ODEE. Naturally, if your environment already has a WebLogic server and Oracle database, then you can skip all those components and go straight for the heart of the installation of ODEE. The ODEE installation is comprised of two procedures, the first covers the installation, which is running the installer and answering some questions. This will lay down the files necessary to install into the tiers (e.g. database schemas, WebLogic domains, etcetera). The second procedure is to deploy the configuration files into the various components (e.g. deploy the database schemas, WebLogic domains, SOA composites, etcetera). I will segment my posts accordingly! Let's get started, shall we? Unpack the installation files into a temporary directory location. This should extract a zip file. Extract that zip file into the temporary directory location. Navigate to and execute the installer in Disk1/setup.exe. You may have to allow the program to run if User Account Control is enabled. Once the dialog below is displayed, click Next. Select your ODEE Home - inside this directory is where all the files will be deployed. For ease of support, I recommend using the default, however you can put this wherever you want. Click Next. Select the database type, database connection type – note that the database name should match the value used for the connection type (e.g. if using SID, then the name should be IDMAKER; if using ServiceName, the name should be “idmaker.us.oracle.com”). Verify whether or not you want to enable advanced compression. Note: if you are not licensed for Oracle 11g Advanced Compression option do not use this option! Terrible, terrible calamities will befall you if you do! Click Next. Enter the Documaker Admin user name (default "dmkr_admin" is recommended for support purposes) and set the password. Update the System name and ID (must be unique) if you want/need to - since this is a green field install you should be able to use the default System ID. The only time you'd change this is if you were, for some reason, installing a new ODEE system into an existing schema that already had a system. Click Next. Enter the Assembly Line user name (default "dmkr_asline" is recommended) and set the password. Update the Assembly Line name and ID (must be unique) if you want/need to - it's quite possible that at some point you will create another assembly line, in which case you have several methods of doing so. One is to re-run the installer, and in this case you would pick a different assembly line ID and name. Click Next. Note: you can set the DB folder if needed (typically you don’t – see ODEE Installation Guide for specifics. Select the appropriate Application Server type - in this case, our green field install is going to use WebLogic - set the username to weblogic (this is required) and specify your chosen password. This credential will be used to access the application server console/control panel. Keep in mind that there are specific criteria on password choices that are required by WebLogic, but are not enforced by the installer (e.g. must contain a number, must be of a certain length, etcetera). Choose a strong password. Set the connection information for the JMS server. Note that for the 12.3.x version, the installer creates a separate JVM (WebLogic managed server) that hosts the JMS server, whereas prior editions place the JMS server on the AdminServer.  You may also specify a separate URL to the JMS server in case you intend to move the JMS resources to a separate/different server (e.g. back to AdminServer). You'll need to provide a login principal and credentials - for simplicity I usually make this the same as the WebLogic domain user, however this is not a secure practice! Make your JMS principal different from the WebLogic principal and choose a strong password, then click Next. Specify the Hot Folder(s) (comma-delimited if more than one) - this is the directory/directories that is/are monitored by ODEE for jobs to process. Click Next. If you will be setting up an SMTP server for ODEE to send emails, you may configure the connection details here. The details required are simple: hostname, port, user/password, and the sender's address (e.g. emails will appear to be sent by the address shown here so if the recipient clicks "reply", this is where it will go). Click Next. If you will be using Oracle WebCenter:Content (formerly known as Oracle UCM) you can enable this option and set the endpoints/credentials here. If you aren't sure, select False - you can always go back and enable this later. I'm almost 76% certain there will be a post sometime in the future that details how to configure ODEE + WCC:C! Click Next. If you will be using Oracle UMS for sending MMS/text messages, you can enable and set the endpoints/credentials here. As with UCM, if you're not sure, don't enable it - you can always set it later. Click Next. On this screen you can change the endpoints for the Documaker Web Service (DWS), and the endpoints for approval processing in Documaker Interactive. The deployment process for ODEE will create 3 managed WebLogic servers for hosting various Documaker components (JMS, Interactive, DWS, Dashboard, Documaker Administrator, etcetera) and it will set the ports used for each of these services. In this screen you can change these values if you know how you want to deploy these managed servers - but for now we'll just accept the defaults. Click Next. Verify the installation details and click Install. You can save the installation into a response file if you need to (which might be useful if you want to rerun this installation in an unattended fashion). Allow the installation to progress... Click Next. You can save the response file if needed (e.g. in case you forgot to save it earlier!) Click Finish. That's it, you're done with the initial installation. Have a look around the ODEE_HOME that you just installed (remember we selected c:\oracle\odee_1?) and look at the files that are laid down. Don't change anything just yet! Stay tuned for the next segment where we complete and verify the installation. 

  Read the article

• Enchanted Swing in the Forest Wallpaper

  - by Asian Angel

  Magic [DesktopNexus] Latest Features How-To Geek ETC How To Make Hundreds of Complex Photo Edits in Seconds With Photoshop Actions How to Enable User-Specific Wireless Networks in Windows 7 How to Use Google Chrome as Your Default PDF Reader (the Easy Way) How To Remove People and Objects From Photographs In Photoshop Ask How-To Geek: How Can I Monitor My Bandwidth Usage? Internet Explorer 9 RC Now Available: Here’s the Most Interesting New Stuff Never Call Me at Work [Humorous Star Wars Video] Add an Image Properties Listing to the Context Menu in Chrome and Iron Add an Easy to View Notification Badge to Tabs in Firefox SpellBook Parks Bookmarklets in Chrome’s Context Menu Drag2Up Brings Multi-Source Drag and Drop Uploading to Firefox Enchanted Swing in the Forest Wallpaper

  Read the article

• how to upload & preview multiple images at single input and store in to php mysql [closed]

  - by Nilesh Sonawane

  This is nilesh , i am newcomer in this field , i need the script for when i click the upload button then uploaded images it should preview and store into db like wise i want to upload 10 images at same page using php mysql . #div { border:3px dashed #CCC; width:500px; min-height:100px; height:auto; text-align:center: } Multi-Images Uploader '.$f.''; } } } ? </div> <br> <font color='#3d3d3d' size='small'>By: Ahmed Hussein</font> this script select multiple images and then uplod , but i need to upload at a time only one image which preview and store into database like wise min 10 image user can upload .......

  Read the article

• concurrency::index<N> from amp.h

  - by Daniel Moth

  Overview C++ AMP introduces a new template class index<N>, where N can be any value greater than zero, that represents a unique point in N-dimensional space, e.g. if N=2 then an index<2> object represents a point in 2-dimensional space. This class is essentially a coordinate vector of N integers representing a position in space relative to the origin of that space. It is ordered from most-significant to least-significant (so, if the 2-dimensional space is rows and columns, the first component represents the rows). The underlying type is a signed 32-bit integer, and component values can be negative. The rank field returns N. Creating an index The default parameterless constructor returns an index with each dimension set to zero, e.g. index<3> idx; //represents point (0,0,0) An index can also be created from another index through the copy constructor or assignment, e.g. index<3> idx2(idx); //or index<3> idx2 = idx; To create an index representing something other than 0, you call its constructor as per the following 4-dimensional example: int temp[4] = {2,4,-2,0}; index<4> idx(temp); Note that there are convenience constructors (that don’t require an array argument) for creating index objects of rank 1, 2, and 3, since those are the most common dimensions used, e.g. index<1> idx(3); index<2> idx(3, 6); index<3> idx(3, 6, 12); Accessing the component values You can access each component using the familiar subscript operator, e.g. One-dimensional example: index<1> idx(4); int i = idx[0]; // i=4 Two-dimensional example: index<2> idx(4,5); int i = idx[0]; // i=4 int j = idx[1]; // j=5 Three-dimensional example: index<3> idx(4,5,6); int i = idx[0]; // i=4 int j = idx[1]; // j=5 int k = idx[2]; // k=6 Basic operations Once you have your multi-dimensional point represented in the index, you can now treat it as a single entity, including performing common operations between it and an integer (through operator overloading): -- (pre- and post- decrement), ++ (pre- and post- increment), %=, *=, /=, +=, -=,%, *, /, +, -. There are also operator overloads for operations between index objects, i.e. ==, !=, +=, -=, +, –. Here is an example (where no assertions are broken): index<2> idx_a; index<2> idx_b(0, 0); index<2> idx_c(6, 9); _ASSERT(idx_a.rank == 2); _ASSERT(idx_a == idx_b); _ASSERT(idx_a != idx_c); idx_a += 5; idx_a[1] += 3; idx_a++; _ASSERT(idx_a != idx_b); _ASSERT(idx_a == idx_c); idx_b = idx_b + 10; idx_b -= index<2>(4, 1); _ASSERT(idx_a == idx_b); Usage You'll most commonly use index<N> objects to index into data types that we'll cover in future posts (namely array and array_view). Also when we look at the new parallel_for_each function we'll see that an index<N> object is the single parameter to the lambda, representing the (multi-dimensional) thread index… In the next post we'll go beyond being able to represent an N-dimensional point in space, and we'll see how to define the N-dimensional space itself through the extent<N> class. Comments about this post by Daniel Moth welcome at the original blog.

  Read the article

• Great User Group if based near Gloucester + Links from Entity Framework 4.0 session

  - by Eric Nelson

  I had a really fun evening doing “my final” EF 4.0 session last night (26th May 2010) at GL.NET based out of Gloucester (although secretly I made it into a IronRuby and Windows Azure session). They are a great crowd and Jimmy makes for a fantastic host + it is a very nice venue (Symantec offices in Gloucester, lots of parking, good room etc) + free pizza + free SWAG + trip to pub afterwards (the topics were very varied!). What more could you ask for? The next session is June 16th and will be on multi-tenanted ASP.NET MVC and comes highly recommended. Links from my session: Entity Framework 4 Resources http://bit.ly/ef4resources Entity Framework Team Blog http://blogs.msdn.com/adonet Entity Framework Design Blog http://blogs.msdn.com/efdesign/ The must have LINQPad http://www.linqpad.net Entity Framework Profile http://efprof.com/  IronRuby info on my blog http://geekswithblogs.net/iupdateable/category/10076.aspx

  Read the article

• A Basic Thread

  - by Joe Mayo

  Most of the programs written are single-threaded, meaning that they run on the main execution thread. For various reasons such as performance, scalability, and/or responsiveness additional threads can be useful. .NET has extensive threading support, from the basic threads introduced in v1.0 to the Task Parallel Library (TPL) introduced in v4.0. To get started with threads, it's helpful to begin with the basics; starting a Thread. Why Do I Care? The scenario I'll use for needing to use a thread is writing to a file.  Sometimes, writing to a file takes a while and you don't want your user interface to lock up until the file write is done. In other words, you want the application to be responsive to the user. How Would I Go About It? The solution is to launch a new thread that performs the file write, allowing the main thread to return to the user right away.  Whenever the file writing thread completes, it will let the user know.  In the meantime, the user is free to interact with the program for other tasks. The following examples demonstrate how to do this. Show Me the Code? The code we'll use to work with threads is in the System.Threading namespace, so you'll need the following using directive at the top of the file: using System.Threading; When you run code on a thread, the code is specified via a method.  Here's the code that will execute on the thread: private static void WriteFile() { Thread.Sleep(1000); Console.WriteLine("File Written."); } The call to Thread.Sleep(1000) delays thread execution. The parameter is specified in milliseconds, and 1000 means that this will cause the program to sleep for approximately 1 second.  This method happens to be static, but that's just part of this example, which you'll see is launched from the static Main method.  A thread could be instance or static.  Notice that the method does not have parameters and does not have a return type. As you know, the way to refer to a method is via a delegate.  There is a delegate named ThreadStart in System.Threading that refers to a method without parameters or return type, shown below: ThreadStart fileWriterHandlerDelegate = new ThreadStart(WriteFile); I'll show you the whole program below, but the ThreadStart instance above goes in the Main method. The thread uses the ThreadStart instance, fileWriterHandlerDelegate, to specify the method to execute on the thread: Thread fileWriter = new Thread(fileWriterHandlerDelegate); As shown above, the argument type for the Thread constructor is the ThreadStart delegate type. The fileWriterHandlerDelegate argument is an instance of the ThreadStart delegate type. This creates an instance of a thread and what code will execute, but the new thread instance, fileWriter, isn't running yet. You have to explicitly start it, like this: fileWriter.Start(); Now, the code in the WriteFile method is executing on a separate thread. Meanwhile, the main thread that started the fileWriter thread continues on it's own.  You have two threads running at the same time. Okay, I'm Starting to Get Glassy Eyed. How Does it All Fit Together? The example below is the whole program, pulling all the previous bits together. It's followed by its output and an explanation. using System; using System.Threading; namespace BasicThread { class Program { static void Main() { ThreadStart fileWriterHandlerDelegate = new ThreadStart(WriteFile); Thread fileWriter = new Thread(fileWriterHandlerDelegate); Console.WriteLine("Starting FileWriter"); fileWriter.Start(); Console.WriteLine("Called FileWriter"); Console.ReadKey(); } private static void WriteFile() { Thread.Sleep(1000); Console.WriteLine("File Written"); } } } And here's the output: Starting FileWriter Called FileWriter File Written So, Why are the Printouts Backwards? The output above corresponds to Console.Writeline statements in the program, with the second and third seemingly reversed. In a single-threaded program, "File Written" would print before "Called FileWriter". However, this is a multi-threaded (2 or more threads) program.  In multi-threading, you can't make any assumptions about when a given thread will run.  In this case, I added the Sleep statement to the WriteFile method to greatly increase the chances that the message from the main thread will print first. Without the Thread.Sleep, you could run this on a system with multiple cores and/or multiple processors and potentially get different results each time. Interesting Tangent but What Should I Get Out of All This? Going back to the main point, launching the WriteFile method on a separate thread made the program more responsive.  The file writing logic ran for a while, but the main thread returned to the user, as demonstrated by the print out of "Called FileWriter".  When the file write finished, it let the user know via another print statement. This was a very efficient use of CPU resources that made for a more pleasant user experience. Joe

  Read the article

• Completing install of ruby 1.9.3 with Ruby for for Mac OS X 10.7.5 Leopard, Xcode 4.5.2 -- problems with rvm pkg install openssl

  - by user1848361

  First, many thanks in advance for any help. I'm a complete novice with programming and I'm trying to get started with this Ruby on Rails tutorial (http://ruby.railstutorial.org/ruby-on-rails-tutorial-book?version=3.2) I have been trying figure this out for about 7 hours now and since I don't have any hair left to pull out I'm turning to these hallowed pages. I have searched for solutions here again and again. System: Mac OS X 10.7.5 Leopard, Xcode 4.5.2 I installed homebrew and have updated it multiple times I used homebrew to install rvm and have updated it multiple times I installed git The standard ruby on the system (checking with $ ruby -v) is 1.8.7 My problem is that every time I try to use rvm to install a new version of Ruby ($ rvm install 1.9.3) I get the following error: Ruby (and needed base gems) for your selection will be installed shortly. Before it happens, please read and execute the instructions below. Please use a separate terminal to execute any additional commands. Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: : I have performed $ brew install libksba and when I try to do it again it tells me that libksba is installed already. When I type "$ rvm requirements" I get: Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: Right now Ruby requires gcc to compile, but Xcode 4.2 and later no longer ship with gcc. Instead they ship with llvm-gcc (to which gcc is a symlink) and clang, neither of which are supported for building Ruby. Xcode 4.1 was the last version to ship gcc, which was /usr/bin/gcc-4.2. Xcode 4.1 and earlier: - Ruby will build fine. Xcode 4.2 and later (including Command Line Tools for Xcode): - If you have gcc-4.2 (and friends) from an earlier Xcode version, Ruby will build fine. - If you don't have gcc-4.2, you have two options to get it: * Install apple-gcc42 from Homebrew * Install osx-gcc-installer Homebrew: If you are using Homebrew, you can install the apple-gcc42 and required libraries from homebrew/dupes: brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Xcode 4.2+ install or/and Command Line Tools for Xcode is required to provide make and other tools. osx-gcc-installer: If you don't use Homebrew, you can download and install osx-gcc-installer: https://github.com/kennethreitz/osx-gcc-installer. Warning: Installing osx-gcc-installer on top of a recent Xcode is known to cause problems, so you must uninstall Xcode before installing osx-gcc-installer. Afterwards you may install Xcode 4.2+ or Command Line Tools for Xcode if you desire. ** NOTE: Currently, Node.js is having issues building with osx-gcc-installer. The only fix is to install Xcode over osx-gcc-installer. So I assume I have to do something with brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Everything seemed to work fine until "$ rvm pkg install openssl", which returns: Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log Johns-MacBook-Pro:~ thierinvestmentservices$ rvm pkg install openssl Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log make.log reads "[2012-11-23 13:15:28] make /Users/thierinvestmentservices/.rvm/scripts/functions/utility: line 116: make: command not found" and openssl.certs.log reads "[2012-11-23 14:04:04] update_openssl_certs update_openssl_certs () { ( chpwd_functions="" builtin cd $rvm_usr_path/ssl && command curl -O http://curl.haxx.se/ca/cacert.pem && mv cacert.pem cert.pem ) } current path: /Users/thierinvestmentservices command(1): update_openssl_certs /Users/thierinvestmentservices/.rvm/scripts/functions/pkg: line 205: cd: /Users/thierinvestmentservices/.rvm/usr/ssl: No such file or directory" At this point the letters might as well be wingdings I have no idea what is going on. I have tried to install rvm make with something I saw on one forum post but I got a bunch of warnings. If anyone has any suggestions I would be deeply grateful, I am completely in over my head,

  Read the article

• Projected Results

  - by Sylvie MacKenzie, PMP

  Excerpt from PROFIT - ORACLE - by Monica Mehta Yasser Mahmud has seen a revolution in project management over the past decade. During that time, the former Primavera product strategist (who joined Oracle when his company was acquired in 2008) has not only observed a transformation in the way IT systems support corporate projects but the role project portfolio management (PPM) plays in the enterprise. “15 years ago project management was the domain of project management office (PMO),” Mahmud recalls of earlier days. “But over the course of the past decade, we've seen it transform into a mission critical enterprise discipline, that has made Primavera indispensable in the board room. Now, as a senior manager, a board member, or a C-level executive you have direct and complete visibility into what’s kind of going on in the organization—at a level of detail that you're going to consume that information.” Now serving as Oracle’s vice president of product strategy and industry marketing, Mahmud shares his thoughts on how Oracle’s Primavera solutions have evolved and how best-in-class project portfolio management systems can help businesses stay competitive. Profit: What do you feel are the market dynamics that are changing project management today? Mahmud: First, the data explosion. We're generating data at twice the rate at which we can actually store it. The same concept applies for project-intensive organizations. A lot of data is gathered, but what are we really doing with it? Are we turning data into insight? Are we using that insight and turning it into foresight with analytics tools? This is a key driver that will separate the very good companies—the very competitive companies—from those that are not as competitive. Another trend is centered on the explosion of mobile computing. By the year 2013, an estimated 35 percent of the world’s workforce is going to be mobile. That’s one billion people. So the question is not if you're going to go mobile, it’s how fast you are going to go mobile. What kind of impact does that have on how the workforce participates in projects? What worked ten to fifteen years ago is not going to work today. It requires a real rethink around the interfaces and how data is actually presented. Profit: What is the role of project management in this new landscape? Mahmud: We recently conducted a PPM study with the Economist Intelligence Unit centered to determine how important project management is considered within organizations. Our target was primarily CFOs, CIOs, and senior managers and we discovered that while 95 percent of participants believed it critical to their business, only six percent were confident that projects were delivered on time and on budget. That’s a huge gap. Most organizations are looking for efficiency, especially in these volatile financial times. But senior management can’t keep track of every project in a large organization. As a result, executives are attempting to inventory the work being conducted under their watch. What is often needed is a very high-level assessment conducted at the board level to say, “Here are the 50 initiatives that we have underway. How do they line up with our strategic drivers?” This line of questioning can provide early warning that work and strategy are out of alignment; finding the gap between what the business needs to do and the actual performance scorecard. That’s low-hanging fruit for any executive looking to increase efficiency and save money. But it can only be obtained through proper assessment of existing projects—and you need a project system of record to get that done. Over the next decade or so, project management is going to transform into holistic work management. Business leaders will want make sure key projects align with corporate strategy, but also the ability to drill down into daily activity and smaller projects to make sure they line up as well. Keeping employees from working on tasks—even for a few hours—that don’t line up with corporate goals will, in many ways, become a competitive differentiator. Profit: How do all of these market challenges and shifting trends impact Oracle’s Primavera solutions and meeting customers’ needs? Mahmud: For Primavera, it’s a transformation from being a project management application to a PPM system in the enterprise. Also making that system a mission-critical application by connecting to other key applications within the ecosystem, such as the enterprise resource planning (ERP), supply chain, and CRM systems. Analytics have also become a huge component. Business analytics have made Oracle’s Primavera applications pertinent in the boardroom. Now, as a senior manager, a board member, a CXO, CIO, or CEO, you have direct visibility into what’s going on in the organization at a level that you're able to consume that information. In addition, all of this information pairs up really well with your financials and other data. Certainly, when you're an Oracle shop, you have that visibility that you didn’t have before from a project execution perspective. Profit: What new strategies and tools are being implemented to create a more efficient workplace for users? Mahmud: We believe very strongly that just because you call something an enterprise project portfolio management system doesn’t make it so—you have to get people to want to participate in the system. This can’t be mandated down from the top. It simply doesn’t work that way. A truly adoptable solution is one that makes it super easy for all types users to participate, by providing them interfaces where they live. Keeping that in mind, a major area of development has been alternative user interfaces. This is increasingly resulting in the creation of lighter weight, targeted interfaces such as iOS applications, and smartphones interfaces such as for iPhone and Android platform. Profit: How does this translate into the development of Oracle’s Primavera solutions? Mahmud: Let me give you a few examples. We recently announced the launch of our Primavera P6 Team Member application, which is a native iOS application for the iPhone. This interface makes it easier for team members to do their jobs quickly and effectively. Similarly, we introduced the Primavera analytics application, which can be consumed via mobile devices, and when married with Oracle Spatial capabilities, users can get a geographical view of what’s going on and which projects are occurring in various locations around the world. Lastly, we introduced advanced email integration that allows project team members to status work via E-mail. This functionality leverages the fact that users are in E-mail system throughout the day and allows them to status their work without the need to launch the Primavera application. It comes back to a mantra: provide as many alternative user interfaces as possible, so you can give people the ability to work, to participate, to raise issues, to create projects, in the places where they live. Do it in such a way that it’s non-intrusive, do it in such a way that it’s easy and intuitive and they can get it done in a short amount of time. If you do that, workers can get back to doing what they're actually getting paid for.

  Read the article

• Build an ASP.NET 3.5 Guestbook using MS SQL Server and VB.NET

  One of the most important website features is a guest book. This is particularly useful if you need to know the responses and reactions of your website s visitors. With the release of ASP.NET 3.5 and Visual Web Developer Express 2 8 several web controls make it possible to create an ASP.NET application without the need to hard manually code everything including database scripts server side scripts etc. You can see how that would be helpful to writing a guest book. This is the first part of a multi-part series.... SW Deployment Automation Best Practices Free Guide for IT Leaders: Overcoming Software Distribution & Mgmt Challenges.

  Read the article

• MVC 3 Remote Validation jQuery error on submit

  - by Richard Reddy

  I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

  Read the article

• Gradle in NetBeans IDE 7.3 Beta

  - by Geertjan

  Installed Attila Kelemen's Gradle plugin in NetBeans IDE 7.3 Beta today: http://plugins.netbeans.org/plugin/44510/gradle-support Not only can existing Gradle projects now be opened, i.e., any folder with a build.gradle file: ...but single Gradle projects as well as multi module Gradle projects can be created: What you see below is the result of using the "Gradle Root Project" template once, followed by the "Gradle Subproject" twice within the folder where the root project was created: Pretty cool stuff. Where's the documentation for the plugin? Here: https://github.com/kelemen/netbeans-gradle-project Read it, some handy tips and tricks are provided there.

  Read the article

• Are your merchandise systems limiting growth? Oracle Retail's Merchandise Operations Management could be the answer

  - by user801960

  In this video, Lara Livgard, Director of Oracle Retail Strategy, introduces Oracle Retail Merchandise Operations Management (MOM), a set of integrated, modular solutions that support buying, pricing, inventory management and inventory valuation across a retailer’s channels, countries, and business models. MOM is the backbone of successful retail operations, providing timely and accurate visibility across the entire enterprise and enabling efficient supply-chain execution driven by plans and forecasts. It's modular architecture facilitates tailored and high-value implementations, giving retailers the information they need in order to offer a quality customer experience through a truly integrated multi-channel approach. Further information is available on the Oracle Retail website regarding Merchandise Operations Management.

  Read the article

• Efficient existing rating system for multiplayer?

  - by Nikolay Kuznetsov

  I would like to add a rating for online version of a board game. In this game there are many game rooms each normally having 3-4 people. So I expect that player's rating adjustments (RA) should depends on Rating of opponents in the game room Number of players in game room and final place of a player Person gets rating increase if he plays more games and more frequently If a person leaves a game room (disconnect) before the game ends he should get punished with a high rating decrease I have found two related questions in here Developing an ELO like point system for a multiplayer gaming site Simplest most effective way to rank and measure player skill in a multi-player environment? Please, let me know what would be the most appropriate existing rating model to refer.

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• My Generation Drivers DropdownList Empty

  - by hmloo

  I just installed MyGeneration 1.3.1 on my Windows Vista, and when I try to setup the default settings there are no drivers to select from. but it's OK in my Windows XP machine. At last I got the answers from search engine, it is caused by multi .Net Frameworks coexist and MyMeta.dll is registered by the .Net v2.0 while it should be registered with the .Net v4.0. So we have to manually register the dll. Please follow these steps: 1. Run Visual Studio Command Prompt (2010) with "Run as Administrator". 2. Enter the command "regasm.exe "C:\Program Files\MyGeneration13\MyMeta.dll" /tlb: MyMeta.tlb" 3. Exit Command Prompt when successfully registered. 4. Run MyGeneration and the proplem should be disapear. Hope this helps. Thanks for reading.

  Read the article

• Les grandes nouveautés de l'iPhone OS 4.0

  Comme on vous l'avait annoncé précédemment, Apple avait invité certains journalistes pour leur présenter certaines nouveautés de l'iPhone OS 4.0. Voici un tout petit résumé des nouveautés introduites dans iPhone OS 4.0 : 1500 nouvelles API à disposition des développeurs 100 nouvelles fonctionnalités proposées aux utilisateurs Parmi les nouvelles fonctionnalités proposées aux utilisateurs, Apple a mis l'accent sur 7 nouvelles fonctionnalités : Le multi-tache, mais de façon limitée (on reviendra là dessus plus tard) Les dossiers : vous pouvez maintenant avoir plus de 2000 applications réparties dans les dossiers. Au lieu de 180 auparavant. iBooks disponible également sur l'iPhone. Messagerie un...

  Read the article

• Silverlight 4 Training Course

  - by guybarrette

  A Silverlight 4 training course is now available on Channel 9.  Here’s the course description: The Silverlight 4 Training Course includes a whitepaper explaining all of the new Silverlight 4 RC features, several hands-on-labs that explain the features, and a 8 unit course for building business applications with Silverlight 4. The business applications course includes 8 modules with extensive hands on labs as well as 25 accompanying videos that walk you through key aspects of building a business application with Silverlight. Key aspects in this course are working with numerous sandboxed and elevated out of browser features, the new RichTextBox control, implicit styling, webcam, drag and drop, multi touch, validation, authentication, MEF, WCF RIA Services, right mouse click, and much more! You can download it here var addthis_pub="guybarrette";

  Read the article

• Java ME Tech Holiday Gift Idea #3: Kindle Touch Wi-Fi

  - by hinkmond

  Here's a Java ME tech-enabled device holiday gift idea: The venerable Amazon Kindle Touch with built-in Wi-Fi. Niiiice! See: Java ME Tech Gift Idea #3 Here's a quote: + Most-advanced E Ink display, now with multi-touch + New sleek design - 8% lighter, 11% smaller, holds 3,000 books + Only e-reader with text-to-speech, audiobooks and mp3 support + Built in Wi-Fi - Get books in 60 seconds If you want to give someone special a cool device, you want to give something with Java ME technology. Give only the best this holiday season! Hinkmond

  Read the article

• Problem with deleting table rows using ctrl+a for row selection

  - by Frank Nimphius

  Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} The following code is commonly shown and documented for how to access the row key of selected table rows in an ADF Faces table configured for multi row selection. public void onRemoveSelectedTableRows(ActionEvent actionEvent) {    RichTable richTable = … get access to your table instance …    CollectionModel cm =(CollectionModel)richTable.getValue();    RowKeySet rowKeySet = (RowKeySet)richTable.getSelectedRowKeys();             for (Object key : rowKeySet) {       richTable.setRowKey(key);       JUCtrlHierNodeBinding rowData = (JUCtrlHierNodeBinding)cm.getRowData();       // do something with rowData e.g.update, print, copy   }    //optional, if you changed data, refresh the table         AdfFacesContext adfFacesContext = AdfFacesContext.getCurrentInstance(); adfFacesContext.addPartialTarget(richTable);   return null; } The code shown above works for 99.5 % of all use cases that deal with multi row selection enabled ADF Faces tables, except for when users use the ctrl+a key to mark all rows for delete. Just to make sure I am clear: if you use ctrl+a to mark rows to perform any other operation on them – like bulk updating all rows for a specific attribute – then this works with the code shown above. Even for bulk row delete, any other mean of row selection (shift+click and multiple ctrl+click) works like a charm and the rows are deleted. So apparently it is the use of ctrl+a that causes the problem when deleting multiple rows of an ADF Faces table. To implement code that works for all table selection use cases, including the one to delete all table rows in one go, you use the code shown below. public void onRemoveSelectedTableRows(ActionEvent actionEvent) {   RichTable richTable = … get access to your table instance …   CollectionModel cm = (CollectionModel)richTable.getValue();   RowKeySet rowKeySet = (RowKeySet)richTable.getSelectedRowKeys();   Object[] rowKeySetArray = rowKeySet.toArray();      for (Object key : rowKeySetArray){               richTable.setRowKey(key);     JUCtrlHierNodeBinding rowData = (JUCtrlHierNodeBinding)cm.getRowData();                              rowData.getRow().remove();   }   AdfFacesContext adfFacesContext = AdfFacesContext.getCurrentInstance();          adfFacesContext.addPartialTarget(richTable); }

  Read the article

• Do you want to learn about developing Web, Mobile and beyond Oracle based applications? Join our online virtual event on November 26th

  - by JuergenKress

  Learn about the latest innovations in Oracle ADF. Our virtual event provides sessions that range from introductory to deep dive, covering Oracle’s strategic framework for developing multi-channel enterprise applications for the Oracle platforms. Multiple tracks cover every interest and every level and include live online Q&A chats with Oracle’s technical staff. For details please visit our registration page. WebLogic Partner Community For regular information become a member in the WebLogic Partner Community please visit: http://www.oracle.com/partners/goto/wls-emea ( OPN account required). If you need support with your account please contact the Oracle Partner Business Center. Blog Twitter LinkedIn Mix Forum Wiki Technorati Tags: ADF,ADF mobile,education,training,Oracle OpenWorld,WebLogic,WebLogic Community,Oracle,OPN,Jürgen Kress

  Read the article

• Deploying a very simple application

  - by vanna

  I have a very simple working console application written in C++ linked with a light static library. It is just for testing purposes. Now that the coding part is done, I would like to know the process of actually deploying the program. I wrote a very basic CMakeLists.txt that create makefiles or VS projects to build the sources. I also have a program that calls the static library in order to make some google tests. To me, the distribution of this application goes like this : to developpers : the src directory with the CMakeLists.txt file (multi-platform distribution) with a README.txt and an INSTALL.txt to users : the executable and a README.txt git repo : everything mentionned above plus the sources for testing and the gtest external lib A this point : considering the complexity of my application, am I doing it right ? Is there any reference that would formalize this deployment process so I can get better and go further ? Say I would like to add dynamic libraries that can be updated, external libraries like boost : how should I package this to deploy it in a professionnal way ?

  Read the article

• Windows Azure : suivez le streaming du Dev Camp en direct sur Developpez.com

  Le 20 juin aura lieu la journée Dev Camp consacrée à Azure. [IMG]http://i.msdn.microsoft.com/hh868108.azure-camps(fr-fr,MSDN.10).png[/IMG] Cette journée est l'occasion de découvrir tous les services Cloud d'Azure (SQL Azure, Stockage avec Windows Azure Storage, Back-end, etc.), d'apprendre comment réaliser des projets et héberger des applications ? ou des sites webs - sur la plateforme. L'Azure Dev Camp abordera également les applications multi-tiers et la manière de « migrer, intégrer et étendre votre code et vos applications existantes grâce à Windows Azure ». Cette journée abordera aussi la construction d'APIs Web pour enrichir des applications mobiles iOS, Android et bien sûr Windows Phone. Enfin, le rendez-vous...

  Read the article

• How to fix error in pdf2djvu: "Bogus memory allocation size"

  - by Tim

  I am using pdf2djvu to convert a pdf file into a djvu file, but got this error while trying to convert either bundled or indirect multi-page djvu file: $ pdf2djvu 1.pdf -o 1.djvu 1.pdf: - page #1 -> #1 Bogus memory allocation size $ pdf2djvu 1.pdf -i 1.djvu 1.pdf: - page #1 -> #1 Bogus memory allocation size I was wondering what is wrong here and how I shall fix the problem? You can suggest another application other than pdf2djvu. To convert it to djvu My pdf file can be downloaded from here , in case that you may wonder what is special about it. Thanks and regards

  Read the article

• SQL Auto Close Options

  - by Dave Noderer

  Found an interesting thing that others have run across but it is the first time I’ve seen it. A customer emailed to say that the SQL 2008 db that I had helped him with seemed to be going into recovery mode on a regular basis while watching the SQL Management Studio screen. Needless to say he was a bit nervous and about to take some drastic steps. Eventually he found that the Auto Close option was set to true. When this is set to true, the database automatically closes all connections and unlocks the mdf file after 300 milliseconds. When a new connection is made it spins backup… Great for xcopy deployment on a client machine but not a multi-user server based application. So the warning… if you have started a database with SQL express and then move it to a production SQL server, make sure you check that the Auto Close option is set to false. See options screen below:

  Read the article

• How can I set a time limit for a game?

  - by Haoda Fu

  I am learning the multi-threading and timer in C# now. But it seems I can't find a good solution. For example, I would like to see how many addition problems that I can solve within 1 min. I would like my program to have A digital clock to count for 60 seconds in the top of my Console. Print a math problem in the middle of my console wait for my input. When 60 seconds is done, stop the math problem challenges immediately (most of time, it is still waiting for my input, but we will stop it immediately). Count how many correct problems that I have solved. Two challenges of the program now. a) how can we make sure the print time and math problem do not mess up. b) how can we stop the math challenges part immediately after time is up

  Read the article

< Previous Page | 372 373 374 375 376 377 378 379 380 381 382 383  | Next Page >