Search Results

Search found 93 results on 4 pages for 'filewriter'.

Page 4/4 | < Previous Page | 1 2 3 4 

  • Android - Persist file when app closes.

    - by Donal Rafferty
    I am creating a file in my Android application as follows: HEADINGSTRING = new String("Android Debugging " + "\n" "XML test Debugging"); } public void setUpLogging(Context context){ Log.d("LOGGING", "Setting up logging....."); try { // catches IOException below FileOutputStream fOut = context.openFileOutput(FILE_NAME,Context.MODE_APPEND); OutputStreamWriter osw = new OutputStreamWriter(fOut); // Write the string to the file osw.write(HEADINGSTRING); /* ensure that everything is * really written out and close */ osw.flush(); osw.close(); } catch (FileNotFoundException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } finally{ Log.d("LOGGING", "Finished logging setup....."); } } And I write to the file during the running of the app as follows: public void addToLog(File file, String text) throws IOException { BufferedWriter bw = new BufferedWriter (new FileWriter(file, true)); bw.write ("\n" + text); bw.newLine(); bw.flush(); bw.close(); } This works fine but when my app closes the file gets deleted and when the app is run again all the information I wrote to it is gone. How can I make sure the file persists even after closure of the app? Update: I have changed MODE_PRIVATE to MODE_APPEND but the problem still remains.

    Read the article

  • Loading velocity template inside a jar file

    - by Rafael
    I have a project where I want to load a velocity template to complete it with parameters. The whole application is packaged as a jar file. What I initially thought of doing was this: VelocityEngine ve = new VelocityEngine(); URL url = this.getClass().getResource("/templates/"); File file = new File(url.getFile()); ve = new VelocityEngine(); ve.setProperty(RuntimeConstants.RESOURCE_LOADER, "file"); ve.setProperty(RuntimeConstants.FILE_RESOURCE_LOADER_PATH, file.getAbsolutePath()); ve.setProperty(RuntimeConstants.FILE_RESOURCE_LOADER_CACHE, "true"); ve.init(); VelocityContext context = new VelocityContext(); if (properties != null) { stringfyNulls(properties); for (Map.Entry<String, Object> property : properties.entrySet()) { context.put(property.getKey(), property.getValue()); } } final String templatePath = templateName + ".vm"; Template template = ve.getTemplate(templatePath, "UTF-8"); String outFileName = File.createTempFile("p2d_report", ".html").getAbsolutePath(); BufferedWriter writer = new BufferedWriter(new FileWriter(new File(outFileName))); template.merge(context, writer); writer.flush(); writer.close(); And this works fine when I run it in eclipse. However, once I package the program and try to run it using the command line I get an error because the file could not be found. I imagine the problem is in this line: ve.setProperty(RuntimeConstants.FILE_RESOURCE_LOADER_PATH, file.getAbsolutePath()); Because in a jar the absolute file does not exist, since it's inside a zip, but I couldn't yet find a better way to do it. Anyone has any ideas?

    Read the article

  • JAVA - Download PDF file from Webserver

    - by Augusto Picciani
    I need to download a pdf file from a webserver to my pc and save it locally. I used Httpclient to connect to webserver and get the content body: HttpEntity entity=response.getEntity(); InputStream in=entity.getContent(); String stream = CharStreams.toString(new InputStreamReader(in)); int size=stream.length(); System.out.println("stringa html page LENGTH:"+stream.length()); System.out.println(stream); SaveToFile(stream); Then i save content in a file: //check CRLF (i don't know if i need to to this) String[] fix=stream.split("\r\n"); File file=new File("C:\\Users\\augusto\\Desktop\\progetti web\\test\\test2.pdf"); PrintWriter out = new PrintWriter(new FileWriter(file)); for (int i = 0; i < fix.length; i++) { out.print(fix[i]); out.print("\n"); } out.close(); I also tried to save a String content to file directly: OutputStream out=new FileOutputStream("pathPdfFile"); out.write(stream.getBytes()); out.close(); But the result is always the same: I can open pdf file but i can see white pages only. Does the mistake is around pdf stream and endstream charset encoding? Does pdf content between stream and endStream need to be manipulate in some others way?

    Read the article

  • how to execute two thread simultaneously in java swing?

    - by jcrshankar
    My aim is to select all the files named with MANI.txt which is present in their respective folders and then load path of the MANI.txt files different location in table. After I load the path in the table,I used to select needed path and modifiying those. To load the MANI.txt files taking more time,because it may present more than 30 times in my workspace or etc. until load the files I want to give alarm to the user with help of ProgessBar.Once the list size has been populated I need to disable ProgressBar. Could anyone please help me out on this? import java.awt.*; import javax.swing.*; import javax.swing.table.*; import java.awt.event.*; import java.io.BufferedReader; import java.io.File; import java.io.FileNotFoundException; import java.io.FileReader; import java.io.FileWriter; import java.io.IOException; import java.io.PrintWriter; public class JTableHeaderCheckBox extends JFrame implements ActionListener { Object colNames[] = {"", "Path"}; Object[][] data = {}; DefaultTableModel dtm; JTable table; JButton but; java.util.List list; public void buildGUI() { dtm = new DefaultTableModel(data,colNames); table = new JTable(dtm); table.setAutoResizeMode(JTable.AUTO_RESIZE_OFF); int vColIndex = 0; TableColumn col = table.getColumnModel().getColumn(vColIndex); int width = 10; col.setPreferredWidth(width); int vColIndex1 = 1; TableColumn col1 = table.getColumnModel().getColumn(vColIndex1); int width1 = 500; col1.setPreferredWidth(width1); JFileChooser chooser = new JFileChooser(); //chooser.setCurrentDirectory(new java.io.File(".")); chooser.setDialogTitle("Choose workSpace Path"); chooser.setFileSelectionMode(JFileChooser.DIRECTORIES_ONLY); chooser.setAcceptAllFileFilterUsed(false); if (chooser.showOpenDialog(this) == JFileChooser.APPROVE_OPTION){ System.out.println("getCurrentDirectory(): " + chooser.getCurrentDirectory()); System.out.println("getSelectedFile() : " + chooser.getSelectedFile().getAbsolutePath()); } String path= chooser.getSelectedFile().getAbsolutePath(); File folder = new File(path); Here I need progress bar GatheringFiles ob = new GatheringFiles(); list=ob.returnlist(folder); for(int x = 0; x < list.size(); x++) { dtm.addRow(new Object[]{new Boolean(false),list.get(x).toString()}); } JPanel pan = new JPanel(); JScrollPane sp = new JScrollPane(table); TableColumn tc = table.getColumnModel().getColumn(0); tc.setCellEditor(table.getDefaultEditor(Boolean.class)); tc.setCellRenderer(table.getDefaultRenderer(Boolean.class)); tc.setHeaderRenderer(new CheckBoxHeader(new MyItemListener())); but = new JButton("REMOVE"); JFrame f = new JFrame(); pan.add(sp); but.move(650, 50); but.addActionListener(this); pan.add(but); f.add(pan); f.setSize(700, 100); f.pack(); f.setLocationRelativeTo(null); f.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); f.setVisible(true); } class MyItemListener implements ItemListener { public void itemStateChanged(ItemEvent e) { Object source = e.getSource(); if (source instanceof AbstractButton == false) return; boolean checked = e.getStateChange() == ItemEvent.SELECTED; for(int x = 0, y = table.getRowCount(); x < y; x++) { table.setValueAt(new Boolean(checked),x,0); } } } public static void main (String[] args) { SwingUtilities.invokeLater(new Runnable(){ public void run(){ new JTableHeaderCheckBox().buildGUI(); } }); } public void actionPerformed(ActionEvent e) { // TODO Auto-generated method stub if(e.getSource()==but) { System.err.println("table.getRowCount()"+table.getRowCount()); for(int x = 0, y = table.getRowCount(); x < y; x++) { if("true".equals(table.getValueAt(x, 0).toString())) { System.err.println(table.getValueAt(x, 0)); System.err.println(list.get(x).toString()); delete(list.get(x).toString()); } } } } public void delete(String a) { String delete = "C:"; System.err.println(a); try { File inFile = new File(a); if (!inFile.isFile()) { System.out.println("Parameter is not an existing file"); return; } //Construct the new file that will later be renamed to the original filename. File tempFile = new File(inFile.getAbsolutePath() + ".tmp"); BufferedReader br = new BufferedReader(new FileReader(inFile)); PrintWriter pw = new PrintWriter(new FileWriter(tempFile)); String line = null; //Read from the original file and write to the new //unless content matches data to be removed. while ((line = br.readLine()) != null) { System.err.println(line); line = line.replace(delete, " "); pw.println(line); pw.flush(); } pw.close(); br.close(); //Delete the original file if (!inFile.delete()) { System.out.println("Could not delete file"); return; } //Rename the new file to the filename the original file had. if (!tempFile.renameTo(inFile)) System.out.println("Could not rename file"); } catch (FileNotFoundException ex) { ex.printStackTrace(); } catch (IOException ex) { ex.printStackTrace(); } } } class CheckBoxHeader extends JCheckBox implements TableCellRenderer, MouseListener { protected CheckBoxHeader rendererComponent; protected int column; protected boolean mousePressed = false; public CheckBoxHeader(ItemListener itemListener) { rendererComponent = this; rendererComponent.addItemListener(itemListener); } public Component getTableCellRendererComponent( JTable table, Object value, boolean isSelected, boolean hasFocus, int row, int column) { if (table != null) { JTableHeader header = table.getTableHeader(); if (header != null) { rendererComponent.setForeground(header.getForeground()); rendererComponent.setBackground(header.getBackground()); rendererComponent.setFont(header.getFont()); header.addMouseListener(rendererComponent); } } setColumn(column); rendererComponent.setText("Check All"); setBorder(UIManager.getBorder("TableHeader.cellBorder")); return rendererComponent; } protected void setColumn(int column) { this.column = column; } public int getColumn() { return column; } protected void handleClickEvent(MouseEvent e) { if (mousePressed) { mousePressed=false; JTableHeader header = (JTableHeader)(e.getSource()); JTable tableView = header.getTable(); TableColumnModel columnModel = tableView.getColumnModel(); int viewColumn = columnModel.getColumnIndexAtX(e.getX()); int column = tableView.convertColumnIndexToModel(viewColumn); if (viewColumn == this.column && e.getClickCount() == 1 && column != -1) { doClick(); } } } public void mouseClicked(MouseEvent e) { handleClickEvent(e); ((JTableHeader)e.getSource()).repaint(); } public void mousePressed(MouseEvent e) { mousePressed = true; } public void mouseReleased(MouseEvent e) { } public void mouseEntered(MouseEvent e) { } public void mouseExited(MouseEvent e) { } } ****************** import java.io.File; import java.util.*; public class GatheringFiles { public static List returnlist(File folder) { List<File> list = new ArrayList<File>(); List<File> list1 = new ArrayList<File>(); getFiles(folder, list); return list; } private static void getFiles(File folder, List<File> list) { folder.setReadOnly(); File[] files = folder.listFiles(); for(int j = 0; j < files.length; j++) { if( "MANI.txt".equals(files[j].getName())) { list.add(files[j]); } if(files[j].isDirectory()) getFiles(files[j], list); } } }

    Read the article

  • Cant render a .avi file

    - by Manish
    Hi, This is my 3rd post regarding this issue of cropping a file into smaller (same format files) .Please some one help me with this.Here is my code : CoInitialize(NULL); //Create the FGM CoCreateInstance(CLSID_FilterGraph,NULL,CLSCTX_INPROC_SERVER,IID_IGraphBuilder,(void**)(&pGraphBuilder)); //Query the Interfaces pGraphBuilder->QueryInterface(IID_IMediaControl,(void**)&pMediaControl); pGraphBuilder->QueryInterface(IID_IMediaEvent,(void**)&pMediaEvent); pGraphBuilder->QueryInterface(IID_IMediaPosition,(void**)&pMediaPosition); //Adding a Filewriter before calling the renderfile IBaseFilter *pWriter=NULL; IFileSinkFilter *pSink=NULL; CoCreateInstance(CLSID_FileWriter,NULL,CLSCTX_INPROC_SERVER,IID_PPV_ARGS(&pWriter)); pWriter->QueryInterface(IID_IFileSinkFilter,(void**)&pSink); pSink->SetFileName(OUTFILE,NULL); //Create a source filter IBaseFilter* pSource=NULL; HRESULT hr11=pGraphBuilder->AddSourceFilter(FILENAME,L"Source",&pSource); //Create a AVI mux IBaseFilter *pAVImux; CoCreateInstance(CLSID_AviDest,NULL,CLSCTX_INPROC_SERVER,IID_PPV_ARGS(&pAVImux)); pGraphBuilder->AddFilter(pAVImux,L"AVI Mux"); pGraphBuilder->AddFilter(pWriter,L"File Writer"); //Connect Source and Mux IEnumPins* pEnum1=NULL; IPin* pPin1=NULL; IEnumPins *pEnum2=NULL; IPin *pPin2=NULL; pSource->EnumPins(&pEnum1); pEnum1->Next(1,&pPin1,NULL); HRESULT hr1=ConnectFilters(pGraphBuilder,pPin1,pAVImux); //Mux to Writer HRESULT hr4=ConnectFilters(pGraphBuilder,pAVImux,pWriter); //Render the input file HRESULT hr3=pGraphBuilder->RenderFile(FILENAME,NULL); //Set Display times pMediaPosition->put_CurrentPosition(0); pMediaPosition->put_StopTime(2); //Run the graph HRESULT hr=pMediaControl->Run(); On running no video is shown. All the hresults return S_OK .A .avi file( larger than original is created) and I cannot play that file.

    Read the article

  • Search a string in a file and write the matched lines to another file in Java

    - by Geeta
    For searching a string in a file and writing the lines with matched string to another file it takes 15 - 20 mins for a single zip file of 70MB(compressed state). Is there any ways to minimise it. my source code: getting Zip file entries zipFile = new ZipFile(source_file_name); entries = zipFile.entries(); while (entries.hasMoreElements()) { ZipEntry entry = (ZipEntry)entries.nextElement(); if (entry.isDirectory()) { continue; } searchString(Thread.currentThread(),entry.getName(), new BufferedInputStream (zipFile.getInputStream(entry)), Out_File, search_string, stats); } zipFile.close(); Searching String public void searchString(Thread CThread, String Source_File, BufferedInputStream in, File outfile, String search, String stats) throws IOException { int count = 0; int countw = 0; int countl = 0; String s; String[] str; BufferedReader br2 = new BufferedReader(new InputStreamReader(in)); System.out.println(CThread.currentThread()); while ((s = br2.readLine()) != null) { str = s.split(search); count = str.length - 1; countw += count; //word count if (s.contains(search)) { countl++; //line count WriteFile(CThread,s, outfile.toString(), search); } } br2.close(); in.close(); } -------------------------------------------------------------------------------- public void WriteFile(Thread CThread,String line, String out, String search) throws IOException { BufferedWriter bufferedWriter = null; System.out.println("writre thread"+CThread.currentThread()); bufferedWriter = new BufferedWriter(new FileWriter(out, true)); bufferedWriter.write(line); bufferedWriter.newLine(); bufferedWriter.flush(); } Please help me. Its really taking 40 mins for 10 files using threads and 15 - 20 mins for a single file of 70MB after being compressed. Any ways to minimise the time.

    Read the article

  • Java variables across methods

    - by NardCake
    I'm making a basic text editor, and I have 2 methods the first one is triggered when a user click 'Open' and it prompts the user to pick a file and it opens the file fine. I just want to access the same file path which is in a variable in the method that is triggered when the user clicks save. My methods are public, Iv'e tried accessing it through a class, still no. Please help! Code: public void open(){ try{ //Open file JFileChooser fc = new JFileChooser(); fc.showOpenDialog(null); File file = fc.getSelectedFile(); String haha = file.getPath(); BufferedReader br = new BufferedReader(new FileReader(file.getPath())); String line; while((line = br.readLine()) != null){ text.append(line + "\n"); } } catch (FileNotFoundException e){ e.printStackTrace(); }catch (IOException e){ } } public void save(){ try { BufferedWriter bw = new BufferedWriter(new FileWriter(file.filePath)); bw.write(text.getText()); bw.close(); } catch (IOException e) { e.printStackTrace(); } }

    Read the article

  • Merging two XML files into one XML file using Java

    - by dmurali
    I am stuck with how to proceed with combining two different XML files(which has the same structure). When I was doing some research on it, people say that XML parsers like DOM or StAX will have to be used. But cant I do it with the regular IOStream? I am currently trying to do with the help of IOStream but this is not solving my purpose, its being more complex. For example, What I have tried is; public class GUI { public static void main(String[] args) throws Exception { // Creates file to write to Writer output = null; output = new BufferedWriter(new FileWriter("C:\\merged.xml")); String newline = System.getProperty("line.separator"); output.write(""); // Read in xml file 1 FileInputStream in = new FileInputStream("C:\\1.xml"); BufferedReader br = new BufferedReader(new InputStreamReader(in)); String strLine; while ((strLine = br.readLine()) != null) { if (strLine.contains("<MemoryDump>")){ strLine = strLine.replace("<MemoryDump>", "xmlns:xsi"); } if (strLine.contains("</MemoryDump>")){ strLine = strLine.replace("</MemoryDump>", "xmlns:xsd"); } output.write(newline); output.write(strLine); System.out.println(strLine); } // Read in xml file 2 FileInputStream in = new FileInputStream("C:\\2.xml"); BufferedReader br1 = new BufferedReader(new InputStreamReader(in)); String strLine1; while ((strLine1 = br1.readLine()) != null) { if (strLine1.contains("<MemoryDump>")){ strLine1 = strLine1.replace("<MemoryDump>", ""); } if (strLine1.contains("</MemoryDump>")){ strLine1 = strLine1.replace("</MemoryDump>", ""); } output.write(newline); output.write(strLine1); I request you to kindly let me know how do I proceed with merging two XML files by adding additional content as well. It would be great if you could provide me some example links as well..! Thank You in Advance..! System.out.println(strLine1); } }

    Read the article

  • closing MQ connection

    - by OakvilleWork
    Good afternoon, I wrote a project to Get Park Queue Info from the IBM MQ, it has producing an error when attempting to close the connection though. It is written in java. Under application in Event Viewer on the MQ machine it displays two errors. They are: “Channel program ended abnormally. Channel program ‘system.def.surconn’ ended abnormally. Look at previous error messages for channel program ‘system.def.surconn’ in the error files to determine the cause of the failure. The other message states: “Error on receive from host rnanaj (10.10.12.34) An error occurred receiving data from rnanaj (10.10.12.34) over tcp/ip. This may be due to a communications failure. The return code from tcp/ip recv() call was 10054 (X’2746’). Record these values.” This must be something how I try to connect or close the connection, below I have my code to connect and close, any ideas?? Connect: _logger.info("Start"); File outputFile = new File(System.getProperty("PROJECT_HOME"), "run/" + this.getClass().getSimpleName() + "." + System.getProperty("qmgr") + ".txt"); FileUtils.mkdirs(outputFile.getParentFile()); Connection jmsConn = null; Session jmsSession = null; QueueBrowser queueBrowser = null; BufferedWriter commandsBw = null; try { // get queue connection MQConnectionFactory MQConn = new MQConnectionFactory(); MQConn.setHostName(System.getProperty("host")); MQConn.setPort(Integer.valueOf(System.getProperty("port"))); MQConn.setQueueManager(System.getProperty("qmgr")); MQConn.setChannel("SYSTEM.DEF.SVRCONN"); MQConn.setTransportType(JMSC.MQJMS_TP_CLIENT_MQ_TCPIP); jmsConn = (Connection) MQConn.createConnection(); jmsSession = jmsConn.createSession(false, Session.AUTO_ACKNOWLEDGE); Queue jmsQueue = jmsSession.createQueue("PARK"); // browse thru messages queueBrowser = jmsSession.createBrowser(jmsQueue); Enumeration msgEnum = queueBrowser.getEnumeration(); commandsBw = new BufferedWriter(new FileWriter(outputFile)); // String line = "DateTime\tMsgID\tOrigMsgID\tCorrelationID\tComputerName\tSubsystem\tDispatcherName\tProcessor\tJobID\tErrorMsg"; commandsBw.write(line); commandsBw.newLine(); while (msgEnum.hasMoreElements()) { Message message = (Message) msgEnum.nextElement(); line = dateFormatter.format(new Date(message.getJMSTimestamp())) + "\t" + message.getJMSMessageID() + "\t" + message.getStringProperty("pkd_orig_jms_msg_id") + "\t" + message.getJMSCorrelationID() + "\t" + message.getStringProperty("pkd_computer_name") + "\t" + message.getStringProperty("pkd_subsystem") + "\t" + message.getStringProperty("pkd_dispatcher_name") + "\t" + message.getStringProperty("pkd_processor") + "\t" + message.getStringProperty("pkd_job_id") + "\t" + message.getStringProperty("pkd_sysex_msg"); _logger.info(line); commandsBw.write(line); commandsBw.newLine(); } } Close: finally { IO.close(commandsBw); if (queueBrowser != null) { try { queueBrowser.close();} catch (Exception ignore) {}} if (jmsSession != null) { try { jmsSession.close();} catch (Exception ignore) {}} if (jmsConn != null) { try { jmsConn.stop();} catch (Exception ignore) {}} }

    Read the article

  • How to display specific data from a file

    - by user1067332
    My program is supposed to ask the user for firstname, lastname, and phone number till the users stops. Then when to display it asks for the first name and does a search in the text file to find all info with the same first name and display lastname and phones of the matches. import java.util.*; import java.io.*; import java.util.Scanner; public class WritePhoneList { public static void main(String[] args)throws IOException { BufferedWriter output = new BufferedWriter(new FileWriter(new File( "PhoneFile.txt"), true)); String name, lname, age; int pos,choice; try { do { Scanner input = new Scanner(System.in); System.out.print("Enter First name, last name, and phone number "); name = input.nextLine(); output.write(name); output.newLine(); System.out.print("Would you like to add another? yes(1)/no(2)"); choice = input.nextInt(); }while(choice == 1); output.close(); } catch(Exception e) { System.out.println("Message: " + e); } } } Here is the display code, when i search for a name, it finds a match but displays the last name and phone number of the same name 3 times, I want it to display all of the possible matches with the first name. import java.util.*; import java.io.*; import java.util.Scanner; public class DisplaySelectedNumbers { public static void main(String[] args)throws IOException { String name; String strLine; try { FileInputStream fstream = new FileInputStream("PhoneFile.txt"); // Get the object of DataInputStream DataInputStream in = new DataInputStream(fstream); BufferedReader br = new BufferedReader(new InputStreamReader(in)); Scanner input = new Scanner(System.in); System.out.print("Enter a first name"); name = input.nextLine(); strLine= br.readLine(); String[] line = strLine.split(" "); String part1 = line[0]; String part2 = line[1]; String part3 = line[2]; //Read File Line By Line while ((strLine= br.readLine()) != null) { if(name.equals(part1)) { // Print the content on the console System.out.print("\n" + part2 + " " + part3); } } }catch (Exception e) {//Catch exception if any System.out.println("Error: " + e.getMessage()); } } }

    Read the article

  • Running a graph returns E_FAIL

    - by Manish
    Hi, I have been struggling for a while now to get my filter graph to run .I am trying to crop a .wmv file into smaller duration .wmv files .It looks quite a simple task I dont know why its is getting so complicated.I follow this Source- SampleGrabber-WMA sf writer. Here is my code IBaseFilter* pASFWriter; ICaptureGraphBuilder2 * pBuilder=NULL; CoCreateInstance(CLSID_CaptureGraphBuilder2,NULL,CLSCTX_INPROC_SERVER,IID_ICaptureGraphBuilder2,(LPVOID*)&pBuilder); pBuilder-SetFiltergraph(pGraphBuilder); pBuilder-SetOutputFileName(&MEDIASUBTYPE_Asf,OUTFILE,&pASFWriter,NULL); IConfigAsfWriter *pConfig=NULL; HRESULT hr80 = pASFWriter-QueryInterface(IID_IConfigAsfWriter, (void**)&pConfig); if (SUCCEEDED(hr80)) { // Configure the ASF Writer filter. pConfig-Release(); } IBaseFilter *pSource=NULL; pGraphBuilder->AddSourceFilter(FILENAME,L"Source",&pSource); IBaseFilter *pGrabberF2=NULL; ISampleGrabber *pGrabber2=NULL; CoCreateInstance(CLSID_SampleGrabber,NULL,CLSCTX_INPROC_SERVER,IID_PPV_ARGS(&pGrabberF2)); pGraphBuilder->AddFilter(pGrabberF2,L"Sample Grabber2"); AM_MEDIA_TYPE mt1; ZeroMemory(&mt1,sizeof(mt1)); mt1.majortype=MEDIATYPE_Video; mt1.subtype=MEDIASUBTYPE_RGB24; pGrabberF2->QueryInterface(IID_ISampleGrabber,(void**)(&pGrabber2)); pGrabber2->SetBufferSamples(TRUE); pGrabber2->SetOneShot(FALSE); pGrabber->SetMediaType(&mt1); pSource->EnumPins(&pEnum2); pEnum2->Next(1,&pPin2,NULL); HRESULT hr108=ConnectFilters(pGraphBuilder,pPin2,pGrabberF2);//Source to Grabber pGrabberF2->EnumPins(&pEnum3); IEnumPins *pEnum4=NULL; pASFWriter->EnumPins(&pEnum4); IPin* pPin4=NULL; while (S_OK==pEnum3->Next(1,&pPin3,NULL)&& S_OK==pEnum4->Next(1,&pPin4,NULL)){ pGraphBuilder->Connect(pPin3,pPin4);//Grabber to FileWriter } pGraphBuilder->RenderFile(FILENAME,NULL);//FILENAME=INPUTFILENAME (.wmv format) pMediaPosition->put_CurrentPosition(start); pMediaPosition->put_StopTime(stop); HRESULT test1=pMediaControl->Run(); All of it runs fine(returns S_OK) .But test1 returns E_FAIL and no file is created.Can somebody help?

    Read the article

  • Servlet Filter: Socket need to be referenced in doFilter()

    - by Craig m
    Right now I have a filter that has the sockets opened in the init and for some reason when I open them in doFilter() it doesn't work with the server app right so I have no choice but to put it in the init I need to be able to reference the outSide.println("test"); in doFilter() so I can send that to my server app every time the if statement it in is is tripped. Heres my code: import java.net.*; import java.io.*; import java.util.*; import javax.servlet.*; import javax.servlet.http.*; public final class IEFilter implements Filter { public void doFilter(ServletRequest request, ServletResponse response, FilterChain chain) throws IOException, ServletException { String browser = ""; String blockInfo; String address = request.getRemoteAddr(); if(((HttpServletRequest)request).getHeader ("User-Agent").indexOf("MSIE") >= 0) { browser = "Internet Explorer"; } if(browser.equals("Internet Explorer")) { BufferedWriter fW = new BufferedWriter(new FileWriter("C://logs//IElog.rtf")); blockInfo = "Blocked IE user from:" + address; response.setContentType("text/html"); PrintWriter out = response.getWriter(); out.println("<HTML>"); out.println("<HEAD>"); out.println("<TITLE>"); out.println("This page is not available - JNetProtect"); out.println("</TITLE>"); out.println("</HEAD>"); out.println("<BODY>"); out.println("<center><H1>Error 403</H1>"); out.println("<br>"); out.println("<br>"); out.println("<H1>Access Denied</H1>"); out.println("<br>"); out.println("Sorry, that resource may not be accessed now."); out.println("<br>"); out.println("<br>"); out.println("<hr />"); out.println("<i>Page Filtered By JNetProtect</i>"); out.println("</BODY>"); out.println("</HTML>"); //init.outSide.println("Blocked and Internet Explorer user"); fW.write(blockInfo); fW.newLine(); fW.close(); } else { chain.doFilter(request, response); } } public void destroy() { outsocket.close(); outSide.close(); } public void init(FilterConfig filterConfig) { try { ServerSocket fs; Socket outsocket; PrintWriter outSide ; outsocket = new Socket("Localhost", 1337); outSide = new PrintWriter(outsocket.getOutputStream(), true); }catch (Exception e){ System.out.println("error with this connection"); e.printStackTrace();} } }

    Read the article

  • ScrollPanel in java does not appear JTextarea resizes instead

    - by Casper Marcussen
    Hello everyone My program is finished, but testing it out, i found out that the scrollpanel does not appear, it just resizes the JTextarea instead. The code is provided below: package javaapplication15; import java.awt.Container; import java.awt.FlowLayout; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.io.*; import java.io.IOException; import javax.swing.*; public class Tekstprogram extends JFrame { public Tekstprogram() { setSize(400, 600); setDefaultCloseOperation(EXIT_ON_CLOSE); setResizable(false); Container Indhold = getContentPane(); Indhold.setLayout(new FlowLayout()); JButton openButton = new JButton("Open"); JButton saveButton = new JButton("Save"); final JLabel statusbar = new JLabel("Output of your selection will go here"); final JTextArea TekstOmråde = new JTextArea(29, 30); JScrollPane scrollText = new JScrollPane(TekstOmråde); openButton.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent ae) { JFileChooser chooser = new JFileChooser(); chooser.setMultiSelectionEnabled(true); int option = chooser.showOpenDialog(Tekstprogram.this); if (option == JFileChooser.APPROVE_OPTION) { File[] sf = chooser.getSelectedFiles(); String filelist = "nothing"; if (sf.length > 0) { filelist = sf[0].getName(); } for (int i = 1; i < sf.length; i++) { filelist = filelist + ", " + sf[i].getName(); } try { String strLine; File selectedFile = chooser.getSelectedFile(); FileInputStream in = new FileInputStream(selectedFile); BufferedReader br = new BufferedReader(new InputStreamReader(in)); while ((strLine = br.readLine()) != null) { TekstOmråde.append(strLine + "\n"); } } catch (Exception e) { System.out.println("En fejl opstod ved" + e); } } } }); saveButton.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent ae) { JFileChooser chooser = new JFileChooser(); int option = chooser.showSaveDialog(Tekstprogram.this); if (option == JFileChooser.APPROVE_OPTION) { File file = chooser.getSelectedFile(); try { BufferedWriter out = new BufferedWriter(new FileWriter(file)); out.write(TekstOmråde.getText()); out.close(); } catch (IOException e) { System.out.println("IOException fejl opstod :"); e.printStackTrace(); } } } }); Indhold.add(openButton); Indhold.add(saveButton); Indhold.add(TekstOmråde); Indhold.add(scrollText); Indhold.add(statusbar); } public static void main(String args[]) { Tekstprogram sfc = new Tekstprogram(); sfc.setVisible(true); } } Is there anyway to make the JTexarea static?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Generating 8000 text files from xml files

    - by Ray
    Hi all, i need to generate the same number of text files as the xml files i have. Within the text files, i need the title and maybe some other tags of it. I can generate text files with the elements i wanted but not all xml files can be generated. Only some of them are generated. Something might be wrong with my parser so help out please thanks. This is my code. Please have a look and give me suggestions. Thanks in advance. import java.io.File; import javax.xml.parsers.DocumentBuilder; import javax.xml.parsers.DocumentBuilderFactory; import org.w3c.dom.*; import java.io.*; public class AccessingXmlFile1 { public static void main(String argv[]) { try { //File file = new File("C:\\MyFile.xml"); // create a file that is really a directory File aDirectory = new File("C:/Documents and Settings/I2R/Desktop/test"); // get a listing of all files in the directory String[] filesInDir = aDirectory.list(); System.out.println(""+filesInDir.length); // sort the list of files (optional) // Arrays.sort(filesInDir); //////////////////////////////////////////////////////////////////////////////////// //////////////////////////////////////////////////////////////////////////////////// // have everything i need, just print it now for ( int a=0; a<filesInDir.length; a++ ) { String xmlFile = filesInDir[a]; String newLine = System.getProperty("line.separator"); File file = new File(xmlFile); DocumentBuilderFactory dbf = DocumentBuilderFactory.newInstance(); DocumentBuilder db = dbf.newDocumentBuilder(); Document document = db.parse(file); document.getDocumentElement().normalize(); //System.out.println("Root element " + document.getDocumentElement().getNodeName()); NodeList node = document.getElementsByTagName("metadata"); System.out.println("Information of Xml File"); System.out.println(xmlFile.substring(0, xmlFile.length() - 4)); //////////////////////////////////////////////////////////////////////////////////// String titleStoreText = ""; String descriptionStoreText = ""; String collectionStoreText = ""; String textToWrite = ""; //////////////////////////////////////////////////////////////////////////////////// for (int i = 0; i < node.getLength(); i++) { Node firstNode = node.item(i); if (firstNode.getNodeType() == Node.ELEMENT_NODE) { Element element = (Element) firstNode; NodeList titleElementList = element.getElementsByTagName("title"); Element titleElement = (Element) titleElementList.item(0); NodeList title = titleElement.getChildNodes(); //////////////////////////////////////////////////////////////////////////////////// if(titleElement == null) titleStoreText = " There is no title for this file."+ newLine; else titleStoreText = titleStoreText+((Node) title.item(0)).getNodeValue() + newLine; //titleStoreText = titleStoreText+((Node) title.item(0)).getNodeValue()+ newLine; //////////////////////////////////////////////////////////////////////////////////// System.out.println("Title : " + titleStoreText); NodeList collectionElementList = element.getElementsByTagName("collection"); Element collectionElement = (Element) collectionElementList.item(0); NodeList collection = collectionElement.getChildNodes(); //////////////////////////////////////////////////////////////////////////////////// if(collectionElement == null) collectionStoreText = " There is no collection for this file."+ newLine; else collectionStoreText = collectionStoreText+((Node) collection.item(0)).getNodeValue() + newLine; //collectionStoreText = collectionStoreText+((Node) collection.item(0)).getNodeValue()+ newLine; //////////////////////////////////////////////////////////////////////////////////// System.out.println("Collection : " + collectionStoreText); NodeList descriptionElementList = element.getElementsByTagName("description"); Element descriptionElement = (Element) descriptionElementList.item(0); NodeList description = descriptionElement.getChildNodes(); //////////////////////////////////////////////////////////////////////////////////// if(descriptionElement == null) descriptionStoreText = " There is no description for this file."+ newLine; else descriptionStoreText = descriptionStoreText+((Node) description.item(0)).getNodeValue() + newLine; //descriptionStoreText = descriptionStoreText+((Node) description.item(0)).getNodeValue() + newLine; //////////////////////////////////////////////////////////////////////////////////// System.out.println("Description : " + descriptionStoreText); //////////////////////////////////////////////////////////////////////////////////// textToWrite = "=====Title=====" + newLine + titleStoreText + newLine + "=====Collection=====" + newLine + collectionStoreText + newLine + "=====Description=====" + newLine + descriptionStoreText;// + newLine + "=====Subject=====" + newLine + subjectStoreText; //////////////////////////////////////////////////////////////////////////////////// } } ///////////////////////////////////////////write to file part is here///////////////////////////////////////// Writer output = null; File file2 = new File(xmlFile.substring(0, xmlFile.length() - 4)+".txt"); output = new BufferedWriter(new FileWriter(file2)); output.write(textToWrite); output.close(); System.out.println("Your file has been written"); //////////////////////////////////////////////////////////////////////////////////// } } catch (Exception e) { e.printStackTrace(); } } }

    Read the article

  • The Clocks on USACO

    - by philip
    I submitted my code for a question on USACO titled "The Clocks". This is the link to the question: http://ace.delos.com/usacoprob2?a=wj7UqN4l7zk&S=clocks This is the output: Compiling... Compile: OK Executing... Test 1: TEST OK [0.173 secs, 13928 KB] Test 2: TEST OK [0.130 secs, 13928 KB] Test 3: TEST OK [0.583 secs, 13928 KB] Test 4: TEST OK [0.965 secs, 13928 KB] Run 5: Execution error: Your program (`clocks') used more than the allotted runtime of 1 seconds (it ended or was stopped at 1.584 seconds) when presented with test case 5. It used 13928 KB of memory. ------ Data for Run 5 ------ 6 12 12 12 12 12 12 12 12 ---------------------------- Your program printed data to stdout. Here is the data: ------------------- time:_0.40928452 ------------------- Test 5: RUNTIME 1.5841 (13928 KB) I wrote my program so that it will print out the time taken (in seconds) for the program to complete before it exits. As can be seen, it took 0.40928452 seconds before exiting. So how the heck did the runtime end up to be 1.584 seconds? What should I do about it? This is the code if it helps: import java.io.; import java.util.; class clocks { public static void main(String[] args) throws IOException { long start = System.nanoTime(); // Use BufferedReader rather than RandomAccessFile; it's much faster BufferedReader f = new BufferedReader(new FileReader("clocks.in")); // input file name goes above PrintWriter out = new PrintWriter(new BufferedWriter(new FileWriter("clocks.out"))); // Use StringTokenizer vs. readLine/split -- lots faster int[] clock = new int[9]; for (int i = 0; i < 3; i++) { StringTokenizer st = new StringTokenizer(f.readLine()); // Get line, break into tokens clock[i * 3] = Integer.parseInt(st.nextToken()); clock[i * 3 + 1] = Integer.parseInt(st.nextToken()); clock[i * 3 + 2] = Integer.parseInt(st.nextToken()); } ArrayList validCombination = new ArrayList();; for (int i = 1; true; i++) { ArrayList combination = getPossibleCombinations(i); for (int j = 0; j < combination.size(); j++) { if (tryCombination(clock, (int[]) combination.get(j))) { validCombination.add(combination.get(j)); } } if (validCombination.size() > 0) { break; } } int [] min = (int[])validCombination.get(0); if (validCombination.size() > 1){ String minS = ""; for (int i=0; i<min.length; i++) minS += min[i]; for (int i=1; i<validCombination.size(); i++){ String tempS = ""; int [] temp = (int[])validCombination.get(i); for (int j=0; j<temp.length; j++) tempS += temp[j]; if (tempS.compareTo(minS) < 0){ minS = tempS; min = temp; } } } for (int i=0; i<min.length-1; i++) out.print(min[i] + " "); out.println(min[min.length-1]); out.close(); // close the output file long end = System.nanoTime(); System.out.println("time: " + (end-start)/1000000000.0); System.exit(0); // don't omit this! } static boolean tryCombination(int[] clock, int[] steps) { int[] temp = Arrays.copyOf(clock, clock.length); for (int i = 0; i < steps.length; i++) transform(temp, steps[i]); for (int i=0; i<temp.length; i++) if (temp[i] != 12) return false; return true; } static void transform(int[] clock, int n) { if (n == 1) { int[] clocksToChange = {0, 1, 3, 4}; add3(clock, clocksToChange); } else if (n == 2) { int[] clocksToChange = {0, 1, 2}; add3(clock, clocksToChange); } else if (n == 3) { int[] clocksToChange = {1, 2, 4, 5}; add3(clock, clocksToChange); } else if (n == 4) { int[] clocksToChange = {0, 3, 6}; add3(clock, clocksToChange); } else if (n == 5) { int[] clocksToChange = {1, 3, 4, 5, 7}; add3(clock, clocksToChange); } else if (n == 6) { int[] clocksToChange = {2, 5, 8}; add3(clock, clocksToChange); } else if (n == 7) { int[] clocksToChange = {3, 4, 6, 7}; add3(clock, clocksToChange); } else if (n == 8) { int[] clocksToChange = {6, 7, 8}; add3(clock, clocksToChange); } else if (n == 9) { int[] clocksToChange = {4, 5, 7, 8}; add3(clock, clocksToChange); } } static void add3(int[] clock, int[] position) { for (int i = 0; i < position.length; i++) { if (clock[position[i]] != 12) { clock[position[i]] += 3; } else { clock[position[i]] = 3; } } } static ArrayList getPossibleCombinations(int size) { ArrayList l = new ArrayList(); int[] current = new int[size]; for (int i = 0; i < current.length; i++) { current[i] = 1; } int[] end = new int[size]; for (int i = 0; i < end.length; i++) { end[i] = 9; } l.add(Arrays.copyOf(current, size)); while (!Arrays.equals(current, end)) { incrementWithoutRepetition(current, current.length - 1); l.add(Arrays.copyOf(current, size)); } int [][] combination = new int[l.size()][size]; for (int i=0; i<l.size(); i++) combination[i] = (int[])l.get(i); return l; } static int incrementWithoutRepetition(int[] n, int index) { if (n[index] != 9) { n[index]++; return n[index]; } else { n[index] = incrementWithoutRepetition(n, index - 1); return n[index]; } } static void p(int[] n) { for (int i = 0; i < n.length; i++) { System.out.print(n[i] + " "); } System.out.println(""); } }

    Read the article

  • Traditional IO vs memory-mapped

    - by Senne
    I'm trying to illustrate the difference in performance between traditional IO and memory mapped files in java to students. I found an example somewhere on internet but not everything is clear to me, I don't even think all steps are nececery. I read a lot about it here and there but I'm not convinced about a correct implementation of neither of them. The code I try to understand is: public class FileCopy{ public static void main(String args[]){ if (args.length < 1){ System.out.println(" Wrong usage!"); System.out.println(" Correct usage is : java FileCopy <large file with full path>"); System.exit(0); } String inFileName = args[0]; File inFile = new File(inFileName); if (inFile.exists() != true){ System.out.println(inFileName + " does not exist!"); System.exit(0); } try{ new FileCopy().memoryMappedCopy(inFileName, inFileName+".new" ); new FileCopy().customBufferedCopy(inFileName, inFileName+".new1"); }catch(FileNotFoundException fne){ fne.printStackTrace(); }catch(IOException ioe){ ioe.printStackTrace(); }catch (Exception e){ e.printStackTrace(); } } public void memoryMappedCopy(String fromFile, String toFile ) throws Exception{ long timeIn = new Date().getTime(); // read input file RandomAccessFile rafIn = new RandomAccessFile(fromFile, "rw"); FileChannel fcIn = rafIn.getChannel(); ByteBuffer byteBuffIn = fcIn.map(FileChannel.MapMode.READ_WRITE, 0,(int) fcIn.size()); fcIn.read(byteBuffIn); byteBuffIn.flip(); RandomAccessFile rafOut = new RandomAccessFile(toFile, "rw"); FileChannel fcOut = rafOut.getChannel(); ByteBuffer writeMap = fcOut.map(FileChannel.MapMode.READ_WRITE,0,(int) fcIn.size()); writeMap.put(byteBuffIn); long timeOut = new Date().getTime(); System.out.println("Memory mapped copy Time for a file of size :" + (int) fcIn.size() +" is "+(timeOut-timeIn)); fcOut.close(); fcIn.close(); } static final int CHUNK_SIZE = 100000; static final char[] inChars = new char[CHUNK_SIZE]; public static void customBufferedCopy(String fromFile, String toFile) throws IOException{ long timeIn = new Date().getTime(); Reader in = new FileReader(fromFile); Writer out = new FileWriter(toFile); while (true) { synchronized (inChars) { int amountRead = in.read(inChars); if (amountRead == -1) { break; } out.write(inChars, 0, amountRead); } } long timeOut = new Date().getTime(); System.out.println("Custom buffered copy Time for a file of size :" + (int) new File(fromFile).length() +" is "+(timeOut-timeIn)); in.close(); out.close(); } } When exactly is it nececary to use RandomAccessFile? Here it is used to read and write in the memoryMappedCopy, is it actually nececary just to copy a file at all? Or is it a part of memorry mapping? In customBufferedCopy, why is synchronized used here? I also found a different example that -should- test the performance between the 2: public class MappedIO { private static int numOfInts = 4000000; private static int numOfUbuffInts = 200000; private abstract static class Tester { private String name; public Tester(String name) { this.name = name; } public long runTest() { System.out.print(name + ": "); try { long startTime = System.currentTimeMillis(); test(); long endTime = System.currentTimeMillis(); return (endTime - startTime); } catch (IOException e) { throw new RuntimeException(e); } } public abstract void test() throws IOException; } private static Tester[] tests = { new Tester("Stream Write") { public void test() throws IOException { DataOutputStream dos = new DataOutputStream( new BufferedOutputStream( new FileOutputStream(new File("temp.tmp")))); for(int i = 0; i < numOfInts; i++) dos.writeInt(i); dos.close(); } }, new Tester("Mapped Write") { public void test() throws IOException { FileChannel fc = new RandomAccessFile("temp.tmp", "rw") .getChannel(); IntBuffer ib = fc.map( FileChannel.MapMode.READ_WRITE, 0, fc.size()) .asIntBuffer(); for(int i = 0; i < numOfInts; i++) ib.put(i); fc.close(); } }, new Tester("Stream Read") { public void test() throws IOException { DataInputStream dis = new DataInputStream( new BufferedInputStream( new FileInputStream("temp.tmp"))); for(int i = 0; i < numOfInts; i++) dis.readInt(); dis.close(); } }, new Tester("Mapped Read") { public void test() throws IOException { FileChannel fc = new FileInputStream( new File("temp.tmp")).getChannel(); IntBuffer ib = fc.map( FileChannel.MapMode.READ_ONLY, 0, fc.size()) .asIntBuffer(); while(ib.hasRemaining()) ib.get(); fc.close(); } }, new Tester("Stream Read/Write") { public void test() throws IOException { RandomAccessFile raf = new RandomAccessFile( new File("temp.tmp"), "rw"); raf.writeInt(1); for(int i = 0; i < numOfUbuffInts; i++) { raf.seek(raf.length() - 4); raf.writeInt(raf.readInt()); } raf.close(); } }, new Tester("Mapped Read/Write") { public void test() throws IOException { FileChannel fc = new RandomAccessFile( new File("temp.tmp"), "rw").getChannel(); IntBuffer ib = fc.map( FileChannel.MapMode.READ_WRITE, 0, fc.size()) .asIntBuffer(); ib.put(0); for(int i = 1; i < numOfUbuffInts; i++) ib.put(ib.get(i - 1)); fc.close(); } } }; public static void main(String[] args) { for(int i = 0; i < tests.length; i++) System.out.println(tests[i].runTest()); } } I more or less see whats going on, my output looks like this: Stream Write: 653 Mapped Write: 51 Stream Read: 651 Mapped Read: 40 Stream Read/Write: 14481 Mapped Read/Write: 6 What is makeing the Stream Read/Write so unbelievably long? And as a read/write test, to me it looks a bit pointless to read the same integer over and over (if I understand well what's going on in the Stream Read/Write) Wouldn't it be better to read int's from the previously written file and just read and write ints on the same place? Is there a better way to illustrate it? I've been breaking my head about a lot of these things for a while and I just can't get the whole picture..

    Read the article

  • Java :Interface for this code

    - by ibrahim
    Please i neeed help to make interface for this code: package com.ejada.alinma.edh.xsdtransform; import java.io.File; import java.io.FileReader; import java.io.FileWriter; import java.io.StringWriter; import java.text.SimpleDateFormat; import java.util.ArrayList; import java.util.Date; import java.util.HashMap; import java.util.Iterator; import java.util.Properties; import java.util.StringTokenizer; import javax.xml.parsers.DocumentBuilder; import javax.xml.parsers.DocumentBuilderFactory; import javax.xml.transform.Result; import javax.xml.transform.Source; import javax.xml.transform.Transformer; import javax.xml.transform.TransformerFactory; import javax.xml.transform.dom.DOMSource; import javax.xml.transform.stream.StreamResult; /*import org.apache.log4j.Logger;*/ import org.apache.log4j.PropertyConfigurator; import org.w3c.dom.Document; import org.w3c.dom.DocumentFragment; import org.w3c.dom.Element; import org.w3c.dom.Node; import org.w3c.dom.NodeList; import com.sun.org.apache.xml.internal.serialize.OutputFormat; import com.sun.org.apache.xml.internal.serialize.XMLSerializer; /** * An XSD Transformer that replaces the "name" attribute's value in T24 XSDs * with the "shortname" attribute's value * * @author ahusseiny * */ public class XSDTransformer { /** * constants representing the XSD tags and attributes' names used in the parse process */ public static final String TAG_SCHEMA = "xsd:schema"; public static final String TAG_TEXT = "#text"; public static final String TAG_COMPLEX_TYPE = "xsd:complexType"; public static final String TAG_SIMPLE_TYPE = "xsd:simpleType"; public static final String TAG_SEQUENCE = "xsd:sequence"; public static final String TAG_ATTRIBUTE = "xsd:attribute"; public static final String TAG_ELEMENT = "xsd:element"; public static final String TAG_ANNOTATION = "xsd:annotation"; public static final String TAG_APP_INFO = "xsd:appinfo"; public static final String TAG_HAS_PROPERTY = "xsd:hasProperty"; public static final String TAG_RESTRICTION = "xsd:restriction"; public static final String TAG_MAX_LENGTH = "xsd:maxLength"; public static final String ATTR_NAME = "name"; public static final String ATTR_VALUE = "value"; public static final String ATTR_TYPE = "type"; public static final String ATTR_MIXED = "mixed"; public static final String ATTR_USE = "use"; public static final String ATTR_REF = "ref"; public static final String ATTR_MAX_OCCURS = "maxOccurs"; /** * constants representing specific XSD attributes' values used in the parse process */ public static final String FIELD_TAG = "fieldtag"; public static final String FIELD_NUMBER = "fieldnumber"; public static final String FIELD_DATA_TYPE = "fielddatatype"; public static final String FIELD_FMT = "fieldfmt"; public static final String FIELD_LEN = "fieldlen"; public static final String FIELD_INPUT_LEN = "fieldinputlen"; public static final String FIELD_GROUP_NUMBER = "fieldgroupnumber"; public static final String FIELD_MV_GROUP_NUMBER = "fieldmvgroupnumber"; public static final String FIELD_SHORT_NAME = "fieldshortname"; public static final String FIELD_NAME = "fieldname"; public static final String FIELD_COLUMN_NAME = "fieldcolumnname"; public static final String FIELD_GROUP_NAME = "fieldgroupname"; public static final String FIELD_MV_GROUP_NAME = "fieldmvgroupname"; public static final String FIELD_JUSTIFICATION = "fieldjustification"; public static final String FIELD_TYPE = "fieldtype"; public static final String FIELD_SINGLE_OR_MULTI = "singleormulti"; public static final String DELIMITER_COLUMN_TYPE = "#"; public static final String COLUMN_FK_ROW = "FK_ROW"; public static final String COLUMN_XPK_ROW = "XPK_ROW"; public static final int SQL_VIEW_MULTI = 1; public static final int SQL_VIEW_SINGLE = 2; public static final String DATA_TYPE_XSD_NUMERIC = "numeric"; public static final String DATA_TYPE_XSD_DECIMAL = "decimal"; public static final String DATA_TYPE_XSD_STRING = "string"; public static final String DATA_TYPE_XSD_DATE = "date"; /** * application configuration properties */ public static final String PROP_LOG4J_CONFIG_FILE = "log4j_config"; public static final String PROP_MAIN_VIEW_NAME_SINGLE = "view_name_single"; public static final String PROP_MAIN_VIEW_NAME_MULTI = "view_name_multi"; public static final String PROP_MAIN_TABLE_NAME = "main_edh_table_name"; public static final String PROP_SUB_TABLE_PREFIX = "sub_table_prefix"; public static final String PROP_SOURCE_XSD_FULLNAME = "source_xsd_fullname"; public static final String PROP_RESULTS_PATH = "results_path"; public static final String PROP_NEW_XSD_FILENAME = "new_xsd_filename"; public static final String PROP_CSV_FILENAME = "csv_filename"; /** * static holders for application-level utilities */ private static Properties appProps; private static Logger appLogger; /** * */ private StringBuffer sqlViewColumnsSingle = null; private StringBuffer sqlViewSelectSingle = null; private StringBuffer columnsCSV = null; private ArrayList<String> singleValueTableColumns = null; private HashMap<String, String> multiValueTablesSQL = null; private HashMap<Object, HashMap<String, Object>> groupAttrs = null; public XSDTransformer(String appConfigPropsPath) { if (appProps == null) { appProps = new Properties(); } try { init(appConfigPropsPath); } catch (Exception e) { appLogger.error(e.getMessage()); } } /** * initialization */ private void init(String appConfigPropsPath) throws Exception { // init the properties object FileReader in = new FileReader(appConfigPropsPath); appProps.load(in); // init the logger if ((appProps.getProperty(XSDTransformer.PROP_LOG4J_CONFIG_FILE) != null) && (!appProps.getProperty(XSDTransformer.PROP_LOG4J_CONFIG_FILE).equals(""))) { PropertyConfigurator.configure(appProps.getProperty(XSDTransformer.PROP_LOG4J_CONFIG_FILE)); if (appLogger == null) { appLogger = Logger.getLogger(XSDTransformer.class.getName()); } appLogger.info("Application initialization successful."); } sqlViewColumnsSingle = new StringBuffer(); sqlViewSelectSingle = new StringBuffer(); columnsCSV = new StringBuffer(XSDTransformer.FIELD_TAG + "," + XSDTransformer.FIELD_NUMBER + "," + XSDTransformer.FIELD_DATA_TYPE + "," + XSDTransformer.FIELD_FMT + "," + XSDTransformer.FIELD_LEN + "," + XSDTransformer.FIELD_INPUT_LEN + "," + XSDTransformer.FIELD_GROUP_NUMBER + "," + XSDTransformer.FIELD_MV_GROUP_NUMBER + "," + XSDTransformer.FIELD_SHORT_NAME + "," + XSDTransformer.FIELD_NAME + "," + XSDTransformer.FIELD_COLUMN_NAME + "," + XSDTransformer.FIELD_GROUP_NAME + "," + XSDTransformer.FIELD_MV_GROUP_NAME + "," + XSDTransformer.FIELD_JUSTIFICATION + "," + XSDTransformer.FIELD_TYPE + "," + XSDTransformer.FIELD_SINGLE_OR_MULTI + System.getProperty("line.separator")); singleValueTableColumns = new ArrayList<String>(); singleValueTableColumns.add(XSDTransformer.COLUMN_XPK_ROW + XSDTransformer.DELIMITER_COLUMN_TYPE + XSDTransformer.DATA_TYPE_XSD_NUMERIC); multiValueTablesSQL = new HashMap<String, String>(); groupAttrs = new HashMap<Object, HashMap<String, Object>>(); } /** * initialize the <code>DocumentBuilder</code> and read the XSD file * * @param docPath * @return the <code>Document</code> object representing the read XSD file */ private Document retrieveDoc(String docPath) { Document xsdDoc = null; File file = new File(docPath); try { DocumentBuilder builder = DocumentBuilderFactory.newInstance().newDocumentBuilder(); xsdDoc = builder.parse(file); } catch (Exception e) { appLogger.error(e.getMessage()); } return xsdDoc; } /** * perform the iteration/modification on the document * iterate to the level which contains all the elements (Single-Value, and Groups) and start processing each * * @param xsdDoc * @return */ private Document transformDoc(Document xsdDoc) { ArrayList<Object> newElementsList = new ArrayList<Object>(); HashMap<String, Object> docAttrMap = new HashMap<String, Object>(); Element sequenceElement = null; Element schemaElement = null; // get document's root element NodeList nodes = xsdDoc.getChildNodes(); for (int i = 0; i < nodes.getLength(); i++) { if (XSDTransformer.TAG_SCHEMA.equals(nodes.item(i).getNodeName())) { schemaElement = (Element) nodes.item(i); break; } } // process the document (change single-value elements, collect list of new elements to be added) for (int i1 = 0; i1 < schemaElement.getChildNodes().getLength(); i1++) { Node childLevel1 = (Node) schemaElement.getChildNodes().item(i1); // <ComplexType> element if (childLevel1.getNodeName().equals(XSDTransformer.TAG_COMPLEX_TYPE)) { // first, get the main attributes and put it in the csv file for (int i6 = 0; i6 < childLevel1.getChildNodes().getLength(); i6++) { Node child6 = childLevel1.getChildNodes().item(i6); if (XSDTransformer.TAG_ATTRIBUTE.equals(child6.getNodeName())) { if (child6.getAttributes().getNamedItem(XSDTransformer.ATTR_NAME) != null) { String attrName = child6.getAttributes().getNamedItem(XSDTransformer.ATTR_NAME).getNodeValue(); if (((Element) child6).getElementsByTagName(XSDTransformer.TAG_SIMPLE_TYPE).getLength() != 0) { Node simpleTypeElement = ((Element) child6).getElementsByTagName(XSDTransformer.TAG_SIMPLE_TYPE) .item(0); if (((Element) simpleTypeElement).getElementsByTagName(XSDTransformer.TAG_RESTRICTION).getLength() != 0) { Node restrictionElement = ((Element) simpleTypeElement).getElementsByTagName( XSDTransformer.TAG_RESTRICTION).item(0); if (((Element) restrictionElement).getElementsByTagName(XSDTransformer.TAG_MAX_LENGTH).getLength() != 0) { Node maxLengthElement = ((Element) restrictionElement).getElementsByTagName( XSDTransformer.TAG_MAX_LENGTH).item(0); HashMap<String, String> elementProperties = new HashMap<String, String>(); elementProperties.put(XSDTransformer.FIELD_TAG, attrName); elementProperties.put(XSDTransformer.FIELD_NUMBER, "0"); elementProperties.put(XSDTransformer.FIELD_DATA_TYPE, XSDTransformer.DATA_TYPE_XSD_STRING); elementProperties.put(XSDTransformer.FIELD_FMT, ""); elementProperties.put(XSDTransformer.FIELD_NAME, attrName); elementProperties.put(XSDTransformer.FIELD_SHORT_NAME, attrName); elementProperties.put(XSDTransformer.FIELD_COLUMN_NAME, attrName); elementProperties.put(XSDTransformer.FIELD_SINGLE_OR_MULTI, "S"); elementProperties.put(XSDTransformer.FIELD_LEN, maxLengthElement.getAttributes().getNamedItem( XSDTransformer.ATTR_VALUE).getNodeValue()); elementProperties.put(XSDTransformer.FIELD_INPUT_LEN, maxLengthElement.getAttributes() .getNamedItem(XSDTransformer.ATTR_VALUE).getNodeValue()); constructElementRow(elementProperties); // add the attribute as a column in the single-value table singleValueTableColumns.add(attrName + XSDTransformer.DELIMITER_COLUMN_TYPE + XSDTransformer.DATA_TYPE_XSD_STRING + XSDTransformer.DELIMITER_COLUMN_TYPE + maxLengthElement.getAttributes().getNamedItem(XSDTransformer.ATTR_VALUE).getNodeValue()); // add the attribute as a column in the single-values view sqlViewColumnsSingle.append(System.getProperty("line.separator") + attrName + ", "); sqlViewSelectSingle.append(System.getProperty("line.separator") + attrName + ", "); appLogger.debug("added attribute: " + attrName); } } } } } } // now, loop on the elements and process them for (int i2 = 0; i2 < childLevel1.getChildNodes().getLength(); i2++) { Node childLevel2 = (Node) childLevel1.getChildNodes().item(i2); // <Sequence> element if (childLevel2.getNodeName().equals(XSDTransformer.TAG_SEQUENCE)) { sequenceElement = (Element) childLevel2; for (int i3 = 0; i3 < childLevel2.getChildNodes().getLength(); i3++) { Node childLevel3 = (Node) childLevel2.getChildNodes().item(i3); // <Element> element if (childLevel3.getNodeName().equals(XSDTransformer.TAG_ELEMENT)) { // check if single element or group if (isGroup(childLevel3)) { processGroup(childLevel3, true, null, docAttrMap, xsdDoc, newElementsList); // insert a new comment node with the contents of the group tag sequenceElement.insertBefore(xsdDoc.createComment(serialize(childLevel3)), childLevel3); // remove the group tag sequenceElement.removeChild(childLevel3); } else { processElement(childLevel3); } } } } } } } // add new elements // this step should be after finishing processing the whole document. when you add new elements to the document // while you are working on it, those new elements will be included in the processing. We don't need that! for (int i = 0; i < newElementsList.size(); i++) { sequenceElement.appendChild((Element) newElementsList.get(i)); } // write the new required attributes to the schema element Iterator<String> attrIter = docAttrMap.keySet().iterator(); while(attrIter.hasNext()) { Element attr = (Element) docAttrMap.get(attrIter.next()); Element newAttrElement = xsdDoc.createElement(XSDTransformer.TAG_ATTRIBUTE); appLogger.debug("appending attr. [" + attr.getAttribute(XSDTransformer.ATTR_NAME) + "]..."); newAttrElement.setAttribute(XSDTransformer.ATTR_NAME, attr.getAttribute(XSDTransformer.ATTR_NAME)); newAttrElement.setAttribute(XSDTransformer.ATTR_TYPE, attr.getAttribute(XSDTransformer.ATTR_TYPE)); schemaElement.appendChild(newAttrElement); } return xsdDoc; } /** * check if the <code>element</code> sent is single-value element or group * element. the comparison depends on the children of the element. if found one of type * <code>ComplexType</code> then it's a group element, and if of type * <code>SimpleType</code> then it's a single-value element * * @param element * @return <code>true</code> if the element is a group element, * <code>false</code> otherwise */ private boolean isGroup(Node element) { for (int i = 0; i < element.getChildNodes().getLength(); i++) { Node child = (Node) element.getChildNodes().item(i); if (child.getNodeName().equals(XSDTransformer.TAG_COMPLEX_TYPE)) { // found a ComplexType child (Group element) return true; } else if (child.getNodeName().equals(XSDTransformer.TAG_SIMPLE_TYPE)) { // found a SimpleType child (Single-Value element) return false; } } return false; /* String attrName = null; if (element.getAttributes() != null) { Node attribute = element.getAttributes().getNamedItem(XSDTransformer.ATTR_NAME); if (attribute != null) { attrName = attribute.getNodeValue(); } } if (attrName.startsWith("g")) { // group element return true; } else { // single element return false; } */ } /** * process a group element. recursively, process groups till no more group elements are found * * @param element * @param isFirstLevelGroup * @param attrMap * @param docAttrMap * @param xsdDoc * @param newElementsList */ private void processGroup(Node element, boolean isFirstLevelGroup, Node parentGroup, HashMap<String, Object> docAttrMap, Document xsdDoc, ArrayList<Object> newElementsList) { String elementName = null; HashMap<String, Object> groupAttrMap = new HashMap<String, Object>(); HashMap<String, Object> parentGroupAttrMap = new HashMap<String, Object>(); if (element.getAttributes().getNamedItem(XSDTransformer.ATTR_NAME) != null) { elementName = element.getAttributes().getNamedItem(XSDTransformer.ATTR_NAME).getNodeValue(); } appLogger.debug("processing group [" + elementName + "]..."); // get the attributes if a non-first-level-group // attributes are: groups's own attributes + parent group's attributes if (!isFirstLevelGroup) { // get the current element (group) attributes for (int i1 = 0; i1 < element.getChildNodes().getLength(); i1++) { if (XSDTransformer.TAG_COMPLEX_TYPE.equals(element.getChildNodes().item(i1).getNodeName())) { Node complexTypeNode = element.getChildNodes().item(i1); for (int i2 = 0; i2 < complexTypeNode.getChildNodes().getLength(); i2++) { if (XSDTransformer.TAG_ATTRIBUTE.equals(complexTypeNode.getChildNodes().item(i2).getNodeName())) { appLogger.debug("add group attr: " + ((Element) complexTypeNode.getChildNodes().item(i2)).getAttribute(XSDTransformer.ATTR_NAME)); groupAttrMap.put(((Element) complexTypeNode.getChildNodes().item(i2)).getAttribute(XSDTransformer.ATTR_NAME), complexTypeNode.getChildNodes().item(i2)); docAttrMap.put(((Element) complexTypeNode.getChildNodes().item(i2)).getAttribute(XSDTransformer.ATTR_NAME), complexTypeNode.getChildNodes().item(i2)); } } } } // now, get the parent's attributes parentGroupAttrMap = groupAttrs.get(parentGroup); if (parentGroupAttrMap != null) { Iterator<String> iter = parentGroupAttrMap.keySet().iterator(); while (iter.hasNext()) { String attrName = iter.next(); groupAttrMap.put(attrName, parentGroupAttrMap.get(attrName)); } } // put the attributes in the attributes map groupAttrs.put(element, groupAttrMap); } for (int i = 0; i < element.getChildNodes().getLength(); i++) { Node childLevel1 = (Node) element.getChildNodes().item(i); if (childLevel1.getNodeName().equals(XSDTransformer.TAG_COMPLEX_TYPE)) { for (int j = 0; j < childLevel1.getChildNodes().getLength(); j++) { Node childLevel2 = (Node) childLevel1.getChildNodes().item(j); if (childLevel2.getNodeName().equals(XSDTransformer.TAG_SEQUENCE)) { for (int k = 0; k < childLevel2.getChildNodes().getLength(); k++) { Node childLevel3 = (Node) childLevel2.getChildNodes().item(k); if (childLevel3.getNodeName().equals(XSDTransformer.TAG_ELEMENT)) { // check if single element or group if (isGroup(childLevel3)) { // another group element.. // unfortunately, a recursion is // needed here!!! :-( processGroup(childLevel3, false, element, docAttrMap, xsdDoc, newElementsList); } else { // reached a single-value element.. copy it under the // main sequence and apply the name-shorname // replacement processGroupElement(childLevel3, element, isFirstLevelGroup, xsdDoc, newElementsList); } } } } } } } appLogger.debug("finished processing group [" + elementName + "]."); } /** * process the sent <code>element</code> to extract/modify required * information: * 1. replace the <code>name</code> attribute with the <code>shortname</code>. * * @param element */ private void processElement(Node element) { String fieldShortName = null; String fieldColumnName = null; String fieldDataType = null; String fieldFormat = null; String fieldInputLength = null; String elementName = null; HashMap<String, String> elementProperties = new HashMap<String, String>(); if (element.getAttributes().getNamedItem(XSDTransformer.ATTR_NAME) != null) { elementName = element.getAttributes().getNamedItem(XSDTransformer.ATTR_NAME).getNodeValue(); } appLogger.debug("processing element [" + elementName + "]..."); for (int i = 0; i < element.getChildNodes().getLength(); i++) { Node childLevel1 = (Node) element.getChildNodes().item(i); if (childLevel1.getNodeName().equals(XSDTransformer.TAG_ANNOTATION)) { for (int j = 0; j < childLevel1.getChildNodes().getLength(); j++) { Node childLevel2 = (Node) childLevel1.getChildNodes().item(j); if (childLevel2.getNodeName().equals(XSDTransformer.TAG_APP_INFO)) { for (int k = 0; k < childLevel2.getChildNodes().getLength(); k++) { Node childLevel3 = (Node) childLevel2.getChildNodes().item(k); if (childLevel3.getNodeName().equals(XSDTransformer.TAG_HAS_PROPERTY)) { if (childLevel3.getAttributes() != null) { String attrName = null; Node attribute = childLevel3.getAttributes().getNamedItem(XSDTransformer.ATTR_NAME); if (attribute != null) { attrName = attribute.getNodeValue(); elementProperties.put(attrName, childLevel3.getAttributes().getNamedItem(XSDTransformer.ATTR_VALUE) .getNodeValue()); if (attrName.equals(XSDTransformer.FIELD_SHORT_NAME)) { fieldShortName = childLevel3.getAttributes().getNamedItem(XSDTransformer.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(XSDTransformer.FIELD_COLUMN_NAME)) { fieldColumnName = childLevel3.getAttributes().getNamedItem(XSDTransformer.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(XSDTransformer.FIELD_DATA_TYPE)) { fieldDataType = childLevel3.getAttributes().getNamedItem(XSDTransformer.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(XSDTransformer.FIELD_FMT)) { fieldFormat = childLevel3.getAttributes().getNamedItem(XSDTransformer.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(XSDTransformer.FIELD_INPUT_LEN)) { fieldInputLength = childLevel3.getAttributes().getNamedItem(XSDTransformer.ATTR_VALUE) .getNodeValue(); } } } } } } } } } if (element.getAttributes().getNamedItem(XSDTransformer.ATTR_NAME) != null) { element.getAttributes().getNamedItem(XSDTransformer.ATTR_NAME).setNodeValue(fieldShortName); } sqlViewColumnsSingle.append(System.getProperty("line.separator") + fieldColumnName + ", "); sqlViewSelectSingle.append(System.getProperty("line.separator") + fieldShortName + ", "); elementProperties.put(XSDTransformer.FIELD_SINGLE_OR_MULTI, "S"); constructElementRow(elementProperties); singleValueTableColumns.add(fieldShortName + XSDTransformer.DELIMITER_COLUMN_TYPE + fieldDataType + fieldFormat + XSDTransformer.DELIMITER_COLUMN_TYPE + fieldInputLength); appLogger.debug("finished processing element [" + elementName + "]."); } /** * process the sent <code>element</code> to extract/modify required * information: * 1. copy the element under the main sequence * 2. replace the <code>name</code> attribute with the <code>shortname</code>. * 3. add the attributes of the parent groups (if non-first-level-group) * * @param element */ private void processGroupElement(Node element, Node parentGroup, boolean isFirstLevelGroup, Document xsdDoc, ArrayList<Object> newElementsList) { String fieldShortName = null; String fieldColumnName = null; String fieldDataType = null; String fieldFormat = null; String fieldInputLength = null; String elementName = null; Element newElement = null; HashMap<String, String> elementProperties = new HashMap<String, String>(); ArrayList<String> tableColumns = new ArrayList<String>(); HashMap<String, Object> groupAttrMap = null; if (element.getAttributes().getNamedItem(XSDTransformer.ATTR_NAME) != null) { elementName = element.getAttributes().getNamedItem(XSDTransformer.ATTR_NAME).getNodeValue(); } appLogger.debug("processing element [" + elementName + "]..."); // 1. copy the element newElement = (Element) element.cloneNode(true); newElement.setAttribute(XSDTransformer.ATTR_MAX_OCCURS, "unbounded"); // 2. if non-first-level-group, replace the element's SimpleType tag with a ComplexType tag if (!isFirstLevelGroup) { if (((Element) newElement).getElementsByTagName(XSDTransformer.TAG_SIMPLE_TYPE).getLength() != 0) { // there should be only one tag of SimpleType Node simpleTypeNode = ((Element) newElement).getElementsByTagName(XSDTransformer.TAG_SIMPLE_TYPE).item(0); // create the new ComplexType element Element complexTypeNode = xsdDoc.createElement(XSDTransformer.TAG_COMPLEX_TYPE); complexTypeNode.setAttribute(XSDTransformer.ATTR_MIXED, "true"); // get the list of attributes for the parent group groupAttrMap = groupAttrs.get(parentGroup); Iterator<String> attrIter = groupAttrMap.keySet().iterator(); while(attrIter.hasNext()) { Element attr = (Element) groupAttrMap.get(attrIter.next()); Element newAttrElement = xsdDoc.createElement(XSDTransformer.TAG_ATTRIBUTE); appLogger.debug("adding attr. [" + attr.getAttribute(XSDTransformer.ATTR_NAME) + "]..."); newAttrElement.setAttribute(XSDTransformer.ATTR_REF, attr.getAttribute(XSDTransformer.ATTR_NAME)); newAttrElement.setAttribute(XSDTransformer.ATTR_USE, "optional"); complexTypeNode.appendChild(newAttrElement); } // replace the old SimpleType node with the new ComplexType node newElement.replaceChild(complexTypeNode, simpleTypeNode); } } // 3. replace the name with the shortname in the new element for (int i = 0; i < newElement.getChildNodes().getLength(); i++) { Node childLevel1 = (Node) newElement.getChildNodes().item(i); if (childLevel1.getNodeName().equals(XSDTransformer.TAG_ANNOTATION)) { for (int j = 0; j < childLevel1.getChildNodes().getLength(); j++) { Node childLevel2 = (Node) childLevel1.getChildNodes().item(j); if (childLevel2.getNodeName().equals(XSDTransformer.TAG_APP_INFO)) { for (int k = 0; k < childLevel2.getChildNodes().getLength(); k++) { Node childLevel3 = (Node) childLevel2.getChildNodes().item(k); if (childLevel3.getNodeName().equals(XSDTransformer.TAG_HAS_PROPERTY)) { if (childLevel3.getAttributes() != null) { String attrName = null; Node attribute = childLevel3.getAttributes().getNamedItem(XSDTransformer.ATTR_NAME); if (attribute != null) { attrName = attribute.getNodeValue(); elementProperties.put(attrName, childLevel3.getAttributes().getNamedItem(XSDTransformer.ATTR_VALUE) .getNodeValue()); if (attrName.equals(XSDTransformer.FIELD_SHORT_NAME)) { fieldShortName = childLevel3.getAttributes().getNamedItem(XSDTransformer.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(XSDTransformer.FIELD_COLUMN_NAME)) { fieldColumnName = childLevel3.getAttributes().getNamedItem(XSDTransformer.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(XSDTransformer.FIELD_DATA_TYPE)) { fieldDataType = childLevel3.getAttributes().getNamedItem(XSDTransformer.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(XSDTransformer.FIELD_FMT)) { fieldFormat = childLevel3.getAttributes().getNamedItem(XSDTransformer.ATTR_VALUE)

    Read the article

< Previous Page | 1 2 3 4