Search Results

Search found 118 results on 5 pages for 'matcher'.

Page 4/5 | < Previous Page | 1 2 3 4 5  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Favorite Visual Studio 2010 Extensions, Update

    - by Scott Dorman
    With the release of the Visual Studio Pro Power Tools (and many other new extensions having been released), my list of favorite Visual Studio extensions has changed. All of these extensions are available in the Visual Studio Gallery. Here is the list of extensions that I currently have installed and find useful: Bing Start Page CodeCompare Collapse Selection In Solution Explorer Collapse Solution Color Picker Completion Extension Analyzer Find Results Highlighter Find Results Tweak (Available from CodePlex) Format Document HelpViewerKeywordIndex HighlightMultiWord Image Insertion Indentation Matcher Extension ItalicComments MoveToRegionVSX Numbered Bookmarks PowerCommands for Visual Studio 2010 Regular Expressions Margin Search Work Items for TFS 2010 Source Outliner Spell Checker Structure Adornment This also installs the following extensions: BlockTagger BlockTaggerImpl SettingsStore SettingsStoreImpl StyleCop Team Founder Server Power Tools TFS Auto Shelve Visual Studio Color Theme Editor Visual Studio Pro Power Tools VS10x Code Map VS10x Code Marker VS10x Collapse All Projects VS10x Editor View Enhancer VS10x Insert Debug Names VS10x Selection Popup VS10x Super Copy Paste VSCommands 2010 Word Wrap with Auto-Indent   Technorati Tags: Visual Studio,Extensions

    Read the article

  • Regular expressions and the question mark

    - by James P.
    I'm having trouble finding a regular expression that matches the following String. Korben;http://feeds.feedburner.com/KorbensBlog-UpgradeYourMind?format=xml;1 One problem is escaping the question mark. Java's pattern matcher doesn't seem to accept \? as a valid escape sequence but it also fails to work with the tester at myregexp.com. Here's what I have so far: ([a-zA-Z0-9])+;http://([a-zA-Z0-9./-]+);[0-9]+ Any suggestions?

    Read the article

  • Java regex return after first match

    - by user216915
    hi how do i return after the first match of regular expression? (does the Matcher.find() method do that? ) say I have a string "abcdefgeee". I want to ask the regex engine stop finding immediately after it finds the first match of "e" for example. I am writing a method to return true/false if the pattern is found and i don't want to find the whole string for "e". (I am looking for a regex solution ) thanks

    Read the article

  • Regular expressions and matching question marks in URLs

    - by James P.
    I'm having trouble finding a regular expression that matches the following String. Korben;http://feeds.feedburner.com/KorbensBlog-UpgradeYourMind?format=xml;1 One problem is escaping the question mark. Java's pattern matcher doesn't seem to accept \? as a valid escape sequence but it also fails to work with the tester at myregexp.com. Here's what I have so far: ([a-zA-Z0-9])+;http://([a-zA-Z0-9./-]+);[0-9]+ Any suggestions?

    Read the article

  • Do you know why introducing jquery ui autocomplete for my dropdown boxes is also changing my listbox

    - by oo
    I am trying to change my comboboxes to use autocomplete so i leverage the code listed here (which worked perfectly for my dropdowns) The issue is that i also on the same page have a listbox with the following code: <%= Html.ListBox("Cars", Model.BodyParts.Select( x => new SelectListItem { Text = x.Name, Value = x.Id, Selected = Model.CarsSelected.Any(y => y.Id == x.Id) } ))%> and it appears that the jquery ui code is changing this to a autocomplete dropdown as well (as opposed to keeping it as a multi select list box) any idea how to prevent this from happening? i literally am just using the exact code on this page <script type="text/javascript"> (function($) { $.widget("ui.combobox", { _create: function() { var self = this; var select = this.element.hide(); var input = $("<input>") .insertAfter(select) .autocomplete({ source: function(request, response) { var matcher = new RegExp(request.term, "i"); response(select.children("option").map(function() { var text = $(this).text(); if (!request.term || matcher.test(text)) return { id: $(this).val(), label: text.replace(new RegExp("(?![^&;]+;)(?!<[^<>]*)(" + request.term.replace(/([\^\$\(\)\[\]\{\}\*\.\+\?\|\\])/gi, "\\$1") + ")(?![^<>]*>)(?![^&;]+;)", "gi"), "<strong>$1</strong>"), value: text }; })); }, delay: 0, select: function(e, ui) { if (!ui.item) { // remove invalid value, as it didn't match anything $(this).val(""); return false; } $(this).focus(); select.val(ui.item.id); self._trigger("selected", null, { item: select.find("[value='" + ui.item.id + "']") }); }, minLength: 0 }) .addClass("ui-widget ui-widget-content ui-corner-left"); $("<button>&nbsp;</button>") .insertAfter(input) .button({ icons: { primary: "ui-icon-triangle-1-s" }, text: false }).removeClass("ui-corner-all") .addClass("ui-corner-right ui-button-icon") .position({ my: "left center", at: "right center", of: input, offset: "-1 0" }).css("top", "") .click(function() { // close if already visible if (input.autocomplete("widget").is(":visible")) { input.autocomplete("close"); return; } // pass empty string as value to search for, displaying all results input.autocomplete("search", ""); input.focus(); }); } }); })(jQuery); $(function() { $("select").combobox(); }); </script>

    Read the article

  • Stuck at being unable to print a substring no more than 4679 characters

    - by Newcoder
    I have a program that does string manipulation on very large strings (around 100K). The first step in my program is to cleanup the input string so that it only contains certain characters. Here is my method for this cleanup: public static String analyzeString (String input) { String output = null; output = input.replaceAll("[-+.^:,]",""); output = output.replaceAll("(\\r|\\n)", ""); output = output.toUpperCase(); output = output.replaceAll("[^XYZ]", ""); return output; } When i print my 'input' string of length 97498, it prints successfully. My output string after cleanup is of length 94788. I can print the size using output.length() but when I try to print this in Eclipse, output is empty and i can see in eclipse output console header. Since this is not my final program, so I ignored this and proceeded to next method that does pattern matching on this 'cleaned-up' string. Here is code for pattern matching: public static List<Integer> getIntervals(String input, String regex) { List<Integer> output = new ArrayList<Integer> (); // Do pattern matching Pattern p1 = Pattern.compile(regex); Matcher m1 = p1.matcher(input); // If match found while (m1.find()) { output.add(m1.start()); output.add(m1.end()); } return output; } Based on this program, i identify the start and end intervals of my pattern match as 12351 and 87314. I tried to print this match as output.substring(12351, 87314) and only get blank output. Numerous hit and trial runs resulted in the conclusion that biggest substring that i can print is of length 4679. If i try 4680, i again get blank input. My confusion is that if i was able to print original string (97498) length, why i couldnt print the cleaned-up string (length 94788) or the substring (length 4679). Is it due to regular expression implementation which may be causing some memory issues and my system is not able to handle that? I have 4GB installed memory.

    Read the article

  • emacs: how do I use edebug on code that is defined in a macro?

    - by Cheeso
    I don't even know the proper terminology for this lisp syntax, so I don't know if the words I'm using to ask the question, make sense. But the question makes sense, I'm sure. So let me just show you. cc-mode (cc-fonts.el) has things called "matchers" which are bits of code that run to decide how to fontify a region of code. That sounds simple enough, but the matcher code is in a form I don't completely understand, with babckticks and comma-atsign and just comma and so on, and furthermore it is embedded in a c-lang-defcost, which itself is a macro. And I want to run edebug on that code. Look: (c-lang-defconst c-basic-matchers-after "Font lock matchers for various things that should be fontified after generic casts and declarations are fontified. Used on level 2 and higher." t `(;; Fontify the identifiers inside enum lists. (The enum type ;; name is handled by `c-simple-decl-matchers' or ;; `c-complex-decl-matchers' below. ,@(when (c-lang-const c-brace-id-list-kwds) `((,(c-make-font-lock-search-function (concat "\\<\\(" (c-make-keywords-re nil (c-lang-const c-brace-id-list-kwds)) "\\)\\>" ;; Disallow various common punctuation chars that can't come ;; before the '{' of the enum list, to avoid searching too far. "[^\]\[{}();,/#=]*" "{") '((c-font-lock-declarators limit t nil) (save-match-data (goto-char (match-end 0)) (c-put-char-property (1- (point)) 'c-type 'c-decl-id-start) (c-forward-syntactic-ws)) (goto-char (match-end 0))))))) I am reading up on lisp syntax to figure out what those things are and what to call them, but aside from that, how can I run edebug on the code that follows the comment that reads ;; Fontify the identifiers inside enum lists. ? I know how to run edebug on a defun - just invoke edebug-defun within the function's definition, and off I go. Is there a corresponding thing I need to do to edebug the cc-mode matcher code forms?

    Read the article

  • In Regex how to match in between the words?

    - by user828234
    I want to write the regex pattern which should match the string in between also. For example: I have writtenthe regex pattern like this ^((?!mystring).)*$ Which means match words which doesnot contain mystring. But i want regex pattern to match like this. mystringabcdfrevrgf regex matcher should return abcdfrevrgf How will i achieve this, Please help Thanks in advance. Answer: ((?!mystring)(.*))$

    Read the article

  • How to implement string matching based on a pattern

    - by Vincent Rischmann
    I was asked to build a tool that can identify if a string match a pattern. Example: {1:20} stuff t(x) {a,b,c} would match: 1 stuff tx a 20 stuff t c It is a sort of regex but with a different syntax Parentheses indicate an optional value {1:20} is a interval; I will have to check if the token is a number and if it is between 1 and 20 {a,b,c} is just an enumeration; it can be either a or b or c Right now I implemented this with a regex, and the interval stuff was a pain to do. On my own time I tried implementing some kind of matcher by hand, but it turns out it's not that easy to do. By experimenting I ended up with a function that generates a state table from the pattern and a state machine. It worked well until I tried to implement the optional value, and I got stuck and how to generate the state table. After that I searched how I could do this, and that led me to stuff like LL parser, LALR parser, recursive-descent parser, context-free grammars, etc. I never studied any of this so it's hard to know what is relevant here, but I think this is what I need: A grammar A parser which generates states from the grammar and a pattern A state machine to see if a string match the states So my first question is: Is this right ? And second question, what do you recommend I read/study to be able to implement this ?

    Read the article

  • Regex to match a whole string only if it lacks a given substring/suffix

    - by Ivan Krechetov
    I've searched for questions like this, but all the cases I found were solved in a problem-specific manner, like using !g in vi to negate the regex matches, or matching other things, without a regex negation. Thus, I'm interested in a “pure” solution to this: Having a set of strings I need to filter them with a regular expression matcher so that it only leaves (matches) the strings lacking a given substring. For example, filtering out "Foo" in: Boo Foo Bar FooBar BooFooBar Baz Would result in: Boo Bar Baz I tried constructing it with negative look aheads/behinds (?!regex)/(?<!regex), but couldn't figure it out. Is that even possible?

    Read the article

  • Poorly performing regex

    - by Kieron
    I've a really poorly performing piece of regex, currently it makes Firefox, Chrome and IE hang for a period of time. Here's the reg-ex: ^([a-zA-Z0-9]+[/]?)+[a-zA-Z0-9]+$ It's kind of a url matcher, but should only match the requested path (not starting with or ending with a slash). Valid examples: Segment Segment/Segment segment/segment/Segment (etc) Invalid examples: /Segment Segment/ Segment/Segment/ Using the regex above over all three browsers and using two or more slashes causes the browsers to hang. It's obviously a poorly formed reg-ex, but can anyone help build a better one? Thanks,

    Read the article

  • Regex for tollfree numbers in java

    - by arinte
    I have this regex to test for telephone # that should be a toll free. public static final Pattern patternTollFree = Pattern.compile("^((877)|(800)|(866)|(888))"); So I only want to get those # where the user may have left the 1 off of the front of the string, but I have tried several things and I can't get java to match. public String changeRingTo( String changedRinger ) { if ( null == changedRinger || changedRinger.length() != 10) return changedRinger; if ( patternTollFree.matcher(changedRinger).region(0, 2).matches() ) changedRinger = '1' + changedRinger; return changedRinger; } I can't get this 2nd test case below to succeed. What am I doing wrong? assertEquals( "Regex not working", "8189091000", of.changeRingTo("8189091000")); assertEquals( "Regex not working", "18769091000", of.changeRingTo("8769091000"));

    Read the article

  • FileReader vs FileInputReader. split vs Pattern

    - by abdeslam
    I'm working with a file with about 2G. I want to read the file line by line to find some specific terms. Whitch class can I better use: FileReader or FileInputStream? And how can I find the specific words efficiently. I'm just using the split() method, but may be can I use the java.util.regex.Pattern class in combination with java.util.regex.Matcher class. So the Questions are: which class can I use: the FileReader or the FileInputStream? can I use the split method or the regex classes Does someone has an answer to this questions? Thans.

    Read the article

  • SQL constructs translated to OOP

    - by python dude
    As someone who comes from the world of Object Orientation, I find it rather difficult to wrap my head around SQL. Recently, however, I realized that the classical SQL construct select X from Y where Z is basically equivalent to the following OOP construct: List<SomeType> results = db.query(new Matcher<SomeType> () { public boolean match(SomeType candidate) { return ...; // checks condition Z on candidate, returns true for match } }; So my question is: What are the OOP equivalents for other SQL constructs, such as joins?

    Read the article

  • java.util.regex.* Recursive matching

    - by amit.bhayani
    Hi Guys, I have been using the java.util.regex.* classes for Regular Expression in Java and all good so far. But today I have a different requirement. For example consider the pattern to be "aabb". Now if the input String is aa it will definitely not match, however there is still possibility that if I append bb it becomes aabb and it matches. However if I would have started with cc, no matter what I append it will never match. I have explored the Pattern and Matcher class but didn't find any way of achieving this. The input will come from user and system have to wait till pattern matches or it will never match irrespective of any input further. Any clue? Thanks.

    Read the article

  • Java RandomAccessFile - dealing with different newline styles?

    - by waitinforatrain
    Hey, I'm trying to seek through a RandomAccessFile, and as part of an algorithm I have to read a line, and then seek backwards from the end of the line E.g String line = raf.readLine(); raf.seek (raf.getFilePointer() - line.length() + m.start() + m.group().length()); //m is a Matcher for regular expressions I've been getting loads of off-by-one errors and couldn't figure out why. I just discovered it's because some files I'm reading from have UNIX-style linefeeds, \r\n, and some have just windows-style \n. Is there an easy to have the RandomAccessFile treat all linefeeds as windows-style linefeeds?

    Read the article

  • Java Regex for matching quoted string with escaped quotes

    - by kayahr
    I know there are already many questions like mine but I found no answer which works in Java. So I write a new question. I have text files with content like this: key1 = "This is a \"test\" text with escapes using '\\' characters"; key2 = 'It must work with \'single\' quotes and "double" quotes'; I need a regular expression which matches the values in the double-quotes (or single-quotes). This regular expression must support the escaped quotes and escaped backslashes. The regular expression must work with Java standard Pattern/Matcher classes.

    Read the article

  • How to find good looking font color if background color is known?

    - by Mecki
    There seem to be so many color wheel, color picker, and color matcher web apps out there, where you give one color and the they'll find a couple of other colors that will create a harmonic layout when being used in combination. However most of them focus on background colors only and any text printed on each background color (if text is printed at all in the preview) is either black or white. My problem is different. I know the background color I want to use for a text area. What I need help with is choosing a couple of colors (the more, the merrier) I can use as font colors on this background. Most important is that the color will make sure the font is readable (contrast not being too low, also maybe not being too high to avoid that eyes are stressed) and of course that the combination of foreground and background just looks good. Anyone being aware of such an application? I'd prefer a web application to anything I have to download. Thanks.

    Read the article

  • Regular expressions and matching URLs with metacharacters

    - by James P.
    I'm having trouble finding a regular expression that matches the following String. Korben;http://feeds.feedburner.com/KorbensBlog-UpgradeYourMind?format=xml;1 One problem is escaping the question mark. Java's pattern matcher doesn't seem to accept \? as a valid escape sequence but it also fails to work with the tester at myregexp.com. Here's what I have so far: ([a-zA-Z0-9])+;http://([a-zA-Z0-9./-]+);[0-9]+ Any suggestions? Edit: The original intent was to match all URLs that could be found after the first semi colon.

    Read the article

  • Java - Unknown characters passing as [a-zA-z0-9]*?

    - by Twodordan
    Hello, I'm no expert in regex but I need to parse some input I have no control over, and make sure I filter away any strings that don't have A-z and/or 0-9. When I run this, Pattern p = Pattern.compile("^[a-zA-Z0-9]*$"); //fixed typo if(!p.matcher(gottenData).matches()) System.out.println(someData); //someData contains gottenData certain spaces + an unknown symbol somehow slip through the filter (gottenData is the red rectangle): In case you're wondering, it DOES also display Text, it's not all like that. For now, I don't mind the [?] as long as it also contains some string along with it. Please help. [EDIT] as far as I can tell from the (very large) input, the [?]'s are either white spaces either nothing at all; maybe there's some sort of encoding issue, also perhaps something to do with #text nodes (input is xml)

    Read the article

  • Java replace all capturing groups

    - by Don
    Hi, If I have a regex with a capturing group, e.g. foo(g.*f). If I match this against a string and want to replace the first capturing group in all matches with baz so that foog___f blah foog________f is converted to: foobaz blah foobaz There doesn't appear to be any easy way to do this using the standard libraries, because the Matcher.replaceAll() method will only replace all matches of the entire pattern, am I missing something? Obviously I can just iterate through the matches, store the start and end index of each capturing group, then go back and replace them, but is there an easier way? Thanks, Don

    Read the article

  • replace capturing group

    - by Don
    Hi, If I have a regex with a capturing group, e.g. foo(_+f). If I match this against a string and want to replace the first capturing group in all matches with baz so that foo___f blah foo________f is converted to: foobaz blah foobaz There doesn't appear to be any easy way to do this using the standard libraries. If I use Matcher.replaceAll() this will replace all matches of the entire pattern and convert the string to baz blah baz Obviously I can just iterate through the matches, store the start and end index of each capturing group, then go back and replace them, but is there an easier way? Thanks, Don

    Read the article

  • Using Regular Expressions

    - by bebeTech
    I am having problems trying to use the regular expression that I used in JavaScript. On a web page, you may have: <b>Renewal Date:</b> 03 May 2010</td> I just want to be able to pull out the 03 May 2010, remembering that a webpage has more than just the above content. The way I currently perform this using JavaScript is: DateStr = /<b>Renewal Date:<\/b>(.+?)<\/td>/.exec(returnedHTMLPage); I tried to follow some tutorials on java.util.regex.Pattern and java.util.regex.Matcher with no luck. I can't seem to be able to translate (.+?) into something they can understand?? thanks, Noeneel

    Read the article

  • How to check whether a String fully matches a Regex in Scala?

    - by mkneissl
    Assume I have a Regex pattern I want to match many Strings to. val Digit = """\d""".r I just want to check whether a given String fully matches the Regex. What is a good and idiomatic way to do this in Scala? I know that I can pattern match on Regexes, but this is syntactically not very pleasing in this case, because I have no groups to extract: scala> "5" match { case Digit() => true case _ => false } res4: Boolean = true Or I could fall back to the underlying Java pattern: scala> Digit.pattern.matcher("5").matches res6: Boolean = true which is not elegant, either. Is there a better solution?

    Read the article

< Previous Page | 1 2 3 4 5  | Next Page >