Search Results

Search found 272 results on 11 pages for 'pe'.

Page 4/11 | < Previous Page | 1 2 3 4 5 6 7 8 9 10 11  | Next Page >

  • error in IIS7 but not on IIS6

    - by Brad
    I have a website that is we are now deploying to windows 2008 servers that has worked in the past on IIS6 without a problem. It is using .net 2 framework. Most of the website works. Just when we create a screen report over a certain size on the server we get this error. Event code: 3005 Event message: An unhandled exception has occurred. Event time: 6/2/2010 10:40:17 AM Event time (UTC): 6/2/2010 3:40:17 PM Event ID: 1b719ad45d444f949ecc9cbc23f49720 Event sequence: 10 Event occurrence: 1 Event detail code: 0 Application information: Application domain: /LM/W3SVC/3/ROOT-1-129199668164927170 Trust level: Full Application Virtual Path: / Application Path: c:\web\PatronAccess\ Machine name: WIN2008DEV Process information: Process ID: 4712 Process name: w3wp.exe Account name: NT AUTHORITY\NETWORK SERVICE Exception information: Exception type: HttpException Exception message: Invalid viewstate. Request information: Request URL: http://win2008dev/WebResource.axd?d=xCXKkHAeSYHWbCg.gif Request path: /WebResource.axd User host address: 172.17.2.66 User: Is authenticated: False Authentication Type: Thread account name: NT AUTHORITY\NETWORK SERVICE Thread information: Thread ID: 6 Thread account name: NT AUTHORITY\NETWORK SERVICE Is impersonating: False Stack trace: at System.Web.UI.Page.DecryptStringWithIV(String s, IVType ivType) at System.Web.Handlers.AssemblyResourceLoader.System.Web.IHttpHandler.ProcessRequest(HttpContext context) at System.Web.HttpApplication.CallHandlerExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() at System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously) Custom event details: And this one. A process serving application pool 'PatronAccess' suffered a fatal communication error with the Windows Process Activation Service. The process id was '4596'. The data field contains the error number. I have a debug of the application pool but I don't know where to go from here. * wait with pending attach Symbol search path is: Executable search path is: ModLoad: 00bd0000 00bd8000 c:\windows\system32\inetsrv\w3wp.exe ModLoad: 77380000 774a7000 C:\Windows\system32\ntdll.dll ModLoad: 75cb0000 75d8b000 C:\Windows\system32\kernel32.dll ModLoad: 75b60000 75c26000 C:\Windows\system32\ADVAPI32.dll ModLoad: 75df0000 75eb2000 C:\Windows\system32\RPCRT4.dll ModLoad: 76500000 765aa000 C:\Windows\system32\msvcrt.dll ModLoad: 76250000 762ed000 C:\Windows\system32\USER32.dll ModLoad: 75ae0000 75b2b000 C:\Windows\system32\GDI32.dll ModLoad: 75ec0000 76004000 C:\Windows\system32\ole32.dll ModLoad: 731a0000 731d6000 c:\windows\system32\inetsrv\IISUTIL.dll ModLoad: 75330000 75421000 C:\Windows\system32\CRYPT32.dll ModLoad: 75490000 754a2000 C:\Windows\system32\MSASN1.dll ModLoad: 758e0000 758fe000 C:\Windows\system32\USERENV.dll ModLoad: 758c0000 758d4000 C:\Windows\system32\Secur32.dll ModLoad: 75b30000 75b5d000 C:\Windows\system32\WS2_32.dll ModLoad: 774e0000 774e6000 C:\Windows\system32\NSI.dll ModLoad: 75ac0000 75ade000 C:\Windows\system32\IMM32.DLL ModLoad: 772b0000 77378000 C:\Windows\system32\MSCTF.dll ModLoad: 774f0000 774f9000 C:\Windows\system32\LPK.DLL ModLoad: 75c30000 75cad000 C:\Windows\system32\USP10.dll ModLoad: 74d30000 74d51000 C:\Windows\system32\NTMARTA.DLL ModLoad: 77500000 7754a000 C:\Windows\system32\WLDAP32.dll ModLoad: 75990000 75997000 C:\Windows\system32\PSAPI.DLL ModLoad: 754b0000 754c1000 C:\Windows\system32\SAMLIB.dll ModLoad: 744c0000 744ce000 c:\windows\system32\inetsrv\w3wphost.dll ModLoad: 77550000 775dd000 C:\Windows\system32\OLEAUT32.dll ModLoad: 72ec0000 72f12000 c:\windows\system32\inetsrv\nativerd.dll ModLoad: 742a0000 742cf000 C:\Windows\system32\XmlLite.dll ModLoad: 72e60000 72e90000 c:\windows\system32\inetsrv\IISRES.DLL ModLoad: 74f40000 74f7b000 C:\Windows\system32\rsaenh.dll ModLoad: 72f40000 72f86000 C:\Windows\system32\mscoree.dll ModLoad: 75d90000 75de8000 C:\Windows\system32\SHLWAPI.dll ModLoad: 74600000 7479e000 C:\Windows\WinSxS\x86_microsoft.windows.common-controls_6595b64144ccf1df_6.0.6001.18000_none_5cdbaa5a083979cc\comctl32.dll ModLoad: 72310000 728a0000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\mscorwks.dll ModLoad: 72dc0000 72e5b000 C:\Windows\WinSxS\x86_microsoft.vc80.crt_1fc8b3b9a1e18e3b_8.0.50727.3053_none_d08d7bba442a9b36\MSVCR80.dll ModLoad: 75a30000 75ab4000 C:\Windows\system32\CLBCatQ.DLL ModLoad: 728a0000 728d0000 C:\Windows\system32\mlang.dll ModLoad: 6c7d0000 6c801000 C:\Windows\system32\inetsrv\iiscore.dll ModLoad: 71fd0000 71fd7000 c:\windows\system32\inetsrv\W3TP.dll ModLoad: 74480000 74489000 c:\windows\system32\inetsrv\w3dt.dll ModLoad: 71fb0000 71fbb000 C:\Windows\system32\HTTPAPI.dll ModLoad: 752f0000 7532a000 C:\Windows\system32\slc.dll ModLoad: 6cad0000 6caf8000 C:\Windows\system32\faultrep.dll ModLoad: 75050000 75058000 C:\Windows\system32\VERSION.dll ModLoad: 74b80000 74b8f000 C:\Windows\system32\NLAapi.dll ModLoad: 75290000 752a9000 C:\Windows\system32\IPHLPAPI.DLL ModLoad: 75250000 75285000 C:\Windows\system32\dhcpcsvc.DLL ModLoad: 754d0000 754fc000 C:\Windows\system32\DNSAPI.dll ModLoad: 75240000 75247000 C:\Windows\system32\WINNSI.DLL ModLoad: 75210000 75231000 C:\Windows\system32\dhcpcsvc6.DLL ModLoad: 750b0000 750eb000 C:\Windows\System32\mswsock.dll ModLoad: 73920000 73928000 C:\Windows\System32\winrnr.dll ModLoad: 73720000 7372f000 C:\Windows\system32\napinsp.dll ModLoad: 74d00000 74d05000 C:\Windows\System32\wshtcpip.dll ModLoad: 75140000 75145000 C:\Windows\System32\wship6.dll ModLoad: 73910000 73916000 C:\Windows\system32\rasadhlp.dll ModLoad: 6ca00000 6ca06000 C:\Windows\System32\inetsrv\cachuri.dll ModLoad: 6c9f0000 6c9f8000 C:\Windows\System32\inetsrv\cachfile.dll ModLoad: 6c9e0000 6c9e6000 C:\Windows\System32\inetsrv\cachtokn.dll ModLoad: 6c9d0000 6c9de000 C:\Windows\System32\inetsrv\cachhttp.dll ModLoad: 6c960000 6c96e000 C:\Windows\System32\inetsrv\compstat.dll ModLoad: 6c930000 6c938000 C:\Windows\System32\inetsrv\defdoc.dll ModLoad: 6c910000 6c919000 C:\Windows\System32\inetsrv\dirlist.dll ModLoad: 6c6b0000 6c6b8000 C:\Windows\System32\inetsrv\protsup.dll ModLoad: 6c6a0000 6c6ad000 C:\Windows\System32\inetsrv\static.dll ModLoad: 6c690000 6c69b000 C:\Windows\System32\inetsrv\authanon.dll ModLoad: 6c680000 6c68b000 C:\Windows\System32\inetsrv\authbas.dll ModLoad: 6c630000 6c63e000 C:\Windows\System32\inetsrv\authsspi.dll ModLoad: 755b0000 75625000 C:\Windows\system32\NETAPI32.dll ModLoad: 6c620000 6c62b000 C:\Windows\System32\inetsrv\modrqflt.dll ModLoad: 6c610000 6c61d000 C:\Windows\System32\inetsrv\custerr.dll ModLoad: 6c5c0000 6c5c8000 C:\Windows\System32\inetsrv\loghttp.dll ModLoad: 6c330000 6c337000 C:\Windows\System32\inetsrv\iisreqs.dll ModLoad: 728f0000 728f7000 C:\Windows\system32\WSOCK32.dll ModLoad: 6c1f0000 6c20e000 C:\Windows\System32\inetsrv\isapi.dll ModLoad: 6c000000 6c011000 C:\Windows\System32\inetsrv\filter.dll ModLoad: 6c320000 6c328000 C:\Windows\System32\inetsrv\validcfg.dll ModLoad: 6a2a0000 6a30d000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\webengine.dll ModLoad: 60060000 60067000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\aspnet_filter.dll ModLoad: 6c310000 6c319000 C:\Windows\system32\inetsrv\wbhst_pm.dll ModLoad: 765b0000 770c0000 C:\Windows\system32\shell32.dll ModLoad: 70d10000 71807000 C:\Windows\assembly\NativeImages_v2.0.50727_32\mscorlib\17f572b09facdc5fda9431558eb7a26e\mscorlib.ni.dll ModLoad: 70580000 70d05000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System\52e1ea3c7491e05cda766d7b3ce3d559\System.ni.dll ModLoad: 03990000 044d3000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System.Web\96071d36e4d44ebb31a3b46f08fdc732\System.Web.ni.dll ModLoad: 75770000 757cf000 C:\Windows\system32\sxs.dll ModLoad: 72ac0000 72bb1000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System.Configuration\e6001d416f7c468334934a2c6a41c631\System.Configuration.ni.dll ModLoad: 71890000 71dc6000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System.Xml\7208ffa39630e9b923331f9df0947a12\System.Xml.ni.dll ModLoad: 66580000 667bc000 C:\Windows\assembly\NativeImages_v2.0.50727_32\Microsoft.JScript\1543943b86269c9bebd5cf7a3fe7f55b\Microsoft.JScript.ni.dll ModLoad: 74460000 74468000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\App_global.asax.cyzjkxpg.dll ModLoad: 65d20000 65e7c000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\10097bf6\5f9a08ec_fffcca01\PatronAccess.DLL ModLoad: 72030000 7208b000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\mscorjit.dll ModLoad: 68ab0000 68bca000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System.Web.Extensio#\3b4cb090536bf6b0dfae8cefaeeadb9f\System.Web.Extensions.ni.dll ModLoad: 64020000 64033000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\mscorsec.dll ModLoad: 73c40000 73c6d000 C:\Windows\system32\WINTRUST.dll ModLoad: 774b0000 774d9000 C:\Windows\system32\imagehlp.dll ModLoad: 73690000 73715000 C:\Windows\WinSxS\x86_microsoft.windows.common-controls_6595b64144ccf1df_5.82.6001.18000_none_886786f450a74a05\COMCTL32.dll ModLoad: 75170000 751a5000 C:\Windows\system32\ncrypt.dll ModLoad: 751b0000 751f5000 C:\Windows\system32\BCRYPT.dll ModLoad: 74d90000 74da5000 C:\Windows\system32\GPAPI.dll ModLoad: 73520000 7353b000 C:\Windows\system32\cryptnet.dll ModLoad: 73440000 73446000 C:\Windows\system32\SensApi.dll ModLoad: 73a50000 73a65000 C:\Windows\system32\Cabinet.dll ModLoad: 6ae30000 6ae3a000 C:\Windows\system32\inetsrv\gzip.dll ModLoad: 69e50000 69e6a000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\App_Web_kal6czmb.dll ModLoad: 69e10000 69e3c000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\App_Web_b1efcjqz.dll ModLoad: 69bd0000 69c26000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\e8a04837\0093847c_5153ca01\Infragistics2.WebUI.UltraWebTab.v9.2.DLL ModLoad: 5e480000 5e95e000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\719ff0ee\00c37169_5153ca01\Infragistics2.Web.v9.2.DLL ModLoad: 67c90000 67d1a000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\ba3b912a\00d19870_5153ca01\Infragistics2.WebUI.Shared.v9.2.DLL ModLoad: 656a0000 6587a000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\6470a692\14d22a05_ef2ac901\AjaxControlToolkit.DLL ModLoad: 66960000 66ae8000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System.Drawing\6312464f64727a2a50d5ce3fd73ad1bb\System.Drawing.ni.dll ModLoad: 6e690000 6ece3000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System.Data\813556b5a2722045b0ea14467fd00227\System.Data.ni.dll ModLoad: 64e70000 65144000 C:\Windows\assembly\GAC_32\System.Data\2.0.0.0__b77a5c561934e089\System.Data.dll ModLoad: 69c70000 69ca2000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\App_Web_zwtn5a73.dll ModLoad: 69e70000 69e8e000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\App_Web_qijxg7dv.dll ModLoad: 645a0000 647bf000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System.Web.Mobile\b472cb382c17ffc3cb1a91ce12d90bf1\System.Web.Mobile.ni.dll ModLoad: 69c30000 69c66000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System.Web.RegularE#\e6b57c0506ec849c6706cb5617ad7372\System.Web.RegularExpressions.ni.dll ModLoad: 6c300000 6c30a000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\App_Web__hyepzhd.dll ModLoad: 69e00000 69e08000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\5ef208f7\b68a494a_e840c901\SessionTimeoutControl.DLL ModLoad: 69d50000 69d5c000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\619d48f7\0f695f01_fdfcca01\AgNetDataPro.DLL ModLoad: 69cd0000 69ce8000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\dc1703ed\00e1c635_caeaca01\xfnlnet.DLL ModLoad: 73d50000 73efb000 C:\Windows\WinSxS\x86_microsoft.windows.gdiplus_6595b64144ccf1df_1.0.6001.18175_none_9e7bbe54c9c04bca\gdiplus.dll (16cc.14e0): Break instruction exception - code 80000003 (first chance) eax=7ffa6000 ebx=00000000 ecx=00000000 edx=7740d094 esi=00000000 edi=00000000 eip=773c7dfe esp=051ff774 ebp=051ff7a0 iopl=0 nv up ei pl zr na pe nc cs=001b ss=0023 ds=0023 es=0023 fs=003b gs=0000 efl=00000246 ntdll!DbgBreakPoint: 773c7dfe cc int 3 0:021 g (16cc.1454): Access violation - code c0000005 (first chance) First chance exceptions are reported before any exception handling. This exception may be expected and handled. eax=00000000 ebx=00000479 ecx=00000000 edx=019d21f8 esi=019d1f18 edi=019ba74c eip=013849ed esp=0499ea44 ebp=0499f15c iopl=0 nv up ei pl zr na pe nc cs=001b ss=0023 ds=0023 es=0023 fs=003b gs=0000 efl=00010246 013849ed 8b01 mov eax,dword ptr [ecx] ds:0023:00000000=???????? 0:018 g ModLoad: 65890000 65a55000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System.Web.Services\2fa835ce2dcace4fc7c0009f102efc79\System.Web.Services.ni.dll ModLoad: 6f2b0000 6f34d000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System.EnterpriseSe#\ae383808b3f5ee9287358378f9a2cad3\System.EnterpriseServices.ni.dll ModLoad: 10000000 10020000 System.EnterpriseServices.Wrapper.dll ModLoad: 00e50000 00e70000 System.EnterpriseServices.Wrapper.dll ModLoad: 66da0000 66de8000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System.EnterpriseSe#\ae383808b3f5ee9287358378f9a2cad3\System.EnterpriseServices.Wrapper.dll ModLoad: 10000000 10020000 C:\Windows\assembly\GAC_32\System.EnterpriseServices\2.0.0.0__b03f5f7f11d50a3a\System.EnterpriseServices.Wrapper.dll ModLoad: 6ab40000 6ab4c000 image6ab40000 ModLoad: 04950000 0495c000 image04950000 ModLoad: 049a0000 049c0000 image049a0000 ModLoad: 049d0000 049f0000 image049d0000 ModLoad: 049a0000 049c0000 image049a0000 ModLoad: 04a40000 04a60000 image04a40000 ModLoad: 049a0000 049c0000 image049a0000 ModLoad: 04a40000 04a60000 image04a40000 ModLoad: 049a0000 049c0000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\da3b70a0\00e9280f_c1f4c201\ICSharpCode.SharpZipLib.DLL ModLoad: 5eb40000 5f01e000 Infragistics2.Web.v9.2.dll ModLoad: 05a00000 05ede000 Infragistics2.Web.v9.2.dll ModLoad: 694d0000 694fa000 image694d0000 ModLoad: 049d0000 049fa000 image049d0000 ModLoad: 68cc0000 68cea000 image68cc0000 ModLoad: 04e40000 04e6a000 image04e40000 ModLoad: 69470000 6949a000 image69470000 ModLoad: 04e40000 04e6a000 image04e40000 ModLoad: 69470000 6949a000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\f77351ae\00582c74_5153ca01\Infragistics2.WebUI.Misc.v9.2.DLL ModLoad: 67d20000 67daa000 image67d20000 ModLoad: 04e70000 04efa000 image04e70000 ModLoad: 643e0000 64598000 Infragistics2.WebUI.UltraWebChart.v9.2.dll ModLoad: 05a00000 05bb8000 Infragistics2.WebUI.UltraWebChart.v9.2.dll ModLoad: 63ac0000 63c78000 Infragistics2.WebUI.UltraWebChart.v9.2.dll ModLoad: 05bc0000 05d78000 Infragistics2.WebUI.UltraWebChart.v9.2.dll ModLoad: 63900000 63ab8000 Infragistics2.WebUI.UltraWebChart.v9.2.dll ModLoad: 05bc0000 05d78000 Infragistics2.WebUI.UltraWebChart.v9.2.dll ModLoad: 63900000 63ab8000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\9acf477c\0030eeb6_5153ca01\Infragistics2.WebUI.UltraWebChart.v9.2.DLL ModLoad: 60570000 607b6000 image60570000 ModLoad: 05d80000 05fc6000 image05d80000 ModLoad: 64350000 64596000 image64350000 ModLoad: 05fd0000 06216000 image05fd0000 ModLoad: 5edd0000 5f016000 image5edd0000 ModLoad: 05fd0000 06216000 image05fd0000 ModLoad: 5edd0000 5f016000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\30e4a2ff\00dfbf77_5153ca01\Infragistics2.WebUI.UltraWebGrid.v9.2.DLL ModLoad: 67d50000 67da6000 image67d50000 ModLoad: 04e70000 04ec6000 image04e70000 ModLoad: 68cb0000 68ce4000 image68cb0000 ModLoad: 04e70000 04ea4000 image04e70000 ModLoad: 68790000 687c4000 image68790000 ModLoad: 04eb0000 04ee4000 image04eb0000 ModLoad: 688f0000 68924000 image688f0000 ModLoad: 04eb0000 04ee4000 image04eb0000 ModLoad: 688f0000 68924000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\2420cb22\00a1ab83_5153ca01\Infragistics2.WebUI.WebCombo.v9.2.DLL ModLoad: 66d50000 66da0000 image66d50000 ModLoad: 04f80000 04fd0000 image04f80000 ModLoad: 67d60000 67db0000 image67d60000 ModLoad: 05a00000 05a50000 image05a00000 ModLoad: 66d00000 66d50000 image66d00000 ModLoad: 05a00000 05a50000 image05a00000 ModLoad: 66d00000 66d50000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\6ceab935\00b28e76_5153ca01\Infragistics2.WebUI.WebDataInput.v9.2.DLL ModLoad: 11000000 1112e000 image11000000 ModLoad: 05a50000 05b7e000 image05a50000 ModLoad: 11000000 1112e000 image11000000 ModLoad: 05d80000 05eae000 image05d80000 ModLoad: 11000000 1112e000 image11000000 ModLoad: 05d80000 05eae000 image05d80000 ModLoad: 11000000 1112e000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\e99fdd05\00c79c09_d868c301\itextsharp.DLL ModLoad: 04df0000 04dfe000 LinkPointAPI-cs.dll ModLoad: 04e70000 04e7e000 LinkPointAPI-cs.dll ModLoad: 04df0000 04dfe000 LinkPointAPI-cs.dll ModLoad: 04e80000 04e8e000 LinkPointAPI-cs.dll ModLoad: 04df0000 04dfe000 LinkPointAPI-cs.dll ModLoad: 04e80000 04e8e000 LinkPointAPI-cs.dll ModLoad: 04df0000 04dfe000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\0e724536\00922343_54dfc701\LinkPointAPI-cs.DLL ModLoad: 04e70000 04e78000 image04e70000 ModLoad: 04e90000 04e98000 image04e90000 ModLoad: 04e70000 04e78000 image04e70000 ModLoad: 04ea0000 04ea8000 image04ea0000 ModLoad: 04e70000 04e78000 image04e70000 ModLoad: 04ea0000 04ea8000 image04ea0000 ModLoad: 04e70000 04e78000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\859797c4\00eb5fc5_bed8c401\LinkPointTransaction.DLL ModLoad: 65e80000 65fdc000 PatronAccess.dll ModLoad: 05a50000 05bac000 PatronAccess.dll ModLoad: 6ab40000 6ab48000 SessionTimeoutControl.dll ModLoad: 04e90000 04e98000 SessionTimeoutControl.dll ModLoad: 6ab80000 6ab8e000 WebServices.dll ModLoad: 04e90000 04e9e000 WebServices.dll ModLoad: 6ab40000 6ab4e000 WebServices.dll ModLoad: 04ef0000 04efe000 WebServices.dll ModLoad: 69d40000 69d4e000 WebServices.dll ModLoad: 04ef0000 04efe000 WebServices.dll ModLoad: 69d40000 69d4e000 C:\Windows\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\root\048afd31\e1f306b4\assembly\dl3\21555aa5\5f498093_fefcca01\WebServices.DLL ModLoad: 694e0000 694f8000 image694e0000 ModLoad: 04f80000 04f98000 image04f80000 ModLoad: 661c0000 6624e000 System.ServiceModel.Web.dll ModLoad: 05a50000 05ade000 System.ServiceModel.Web.dll ModLoad: 5d850000 5ddfc000 System.ServiceModel.dll ModLoad: 06220000 067cc000 System.ServiceModel.dll ModLoad: 65ef0000 65fe0000 System.Runtime.Serialization.dll ModLoad: 05eb0000 05fa0000 System.Runtime.Serialization.dll ModLoad: 694e0000 694fe000 SMDiagnostics.dll ModLoad: 04f80000 04f9e000 SMDiagnostics.dll ModLoad: 65be0000 65d1c000 System.Web.Extensions.dll ModLoad: 067d0000 0690c000 System.Web.Extensions.dll ModLoad: 67d40000 67dac000 System.IdentityModel.dll ModLoad: 05ae0000 05b4c000 System.IdentityModel.dll ModLoad: 687a0000 687c2000 System.IdentityModel.Selectors.dll ModLoad: 04fa0000 04fc2000 System.IdentityModel.Selectors.dll ModLoad: 66c90000 66cf4000 Microsoft.Transactions.Bridge.dll ModLoad: 05b50000 05bb4000 Microsoft.Transactions.Bridge.dll ModLoad: 69130000 69146000 System.Web.Abstractions.dll ModLoad: 051b0000 051c6000 System.Web.Abstractions.dll ModLoad: 65150000 651f6000 System.Core.dll ModLoad: 06910000 069b6000 System.Core.dll ModLoad: 64440000 644ea000 System.Data.Linq.dll ModLoad: 069c0000 06a6a000 System.Data.Linq.dll ModLoad: 66d50000 66d9c000 System.Data.Services.Client.dll ModLoad: 06a70000 06abc000 System.Data.Services.Client.dll ModLoad: 68cd0000 68cf0000 System.Data.Services.Design.dll ModLoad: 05210000 05230000 System.Data.Services.Design.dll ModLoad: 5eb00000 5edc2000 System.Data.Entity.dll ModLoad: 06ac0000 06d82000 System.Data.Entity.dll ModLoad: 66af0000 66b16000 System.Xml.Linq.dll ModLoad: 05fa0000 05fc6000 System.Xml.Linq.dll ModLoad: 661c0000 6624e000 C:\Windows\assembly\GAC_MSIL\System.ServiceModel.Web\3.5.0.0__31bf3856ad364e35\System.ServiceModel.Web.dll ModLoad: 64520000 6459e000 System.WorkflowServices.dll ModLoad: 06d90000 06e0e000 System.WorkflowServices.dll ModLoad: 63af0000 63c80000 System.Workflow.ComponentModel.dll ModLoad: 06e10000 06fa0000 System.Workflow.ComponentModel.dll ModLoad: 64320000 6443a000 System.Workflow.Activities.dll ModLoad: 06fa0000 070ba000 System.Workflow.Activities.dll ModLoad: 62cf0000 62d78000 System.Workflow.Runtime.dll ModLoad: 070c0000 07148000 System.Workflow.Runtime.dll ModLoad: 68cb0000 68cc6000 Microsoft.Build.Utilities.dll ModLoad: 07150000 07166000 Microsoft.Build.Utilities.dll ModLoad: 6ab80000 6ab8c000 Microsoft.Build.Framework.dll ModLoad: 05230000 0523c000 Microsoft.Build.Framework.dll ModLoad: 07170000 07214000 Microsoft.Build.Tasks.dll ModLoad: 07220000 072c4000 Microsoft.Build.Tasks.dll ModLoad: 64520000 6459e000 C:\Windows\assembly\GAC_MSIL\System.WorkflowServices\3.5.0.0__31bf3856ad364e35\System.WorkflowServices.dll ModLoad: 5d610000 5d84e000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System.Runtime.Seri#\a33b3b88fd575b703ba4212c677880ae\System.Runtime.Serialization.ni.dll ModLoad: 605a0000 606a6000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System.IdentityModel\3bfbe737873becead614d1504e7d5684\System.IdentityModel.ni.dll ModLoad: 5ab70000 5bbf7000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System.ServiceModel\7115815b53ec561932345e16fbeea968\System.ServiceModel.ni.dll ModLoad: 61440000 6201e000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System.Windows.Forms\1941d7639299344ae28fb6b23da65247\System.Windows.Forms.ni.dll ModLoad: 5d190000 5d3c4000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System.Core\a0522cb280c09b3441e1889502ca145a\System.Core.ni.dll ModLoad: 60a00000 61433000 C:\Windows\assembly\NativeImages_v2.0.50727_32\System.Design\d3fa02f8a34329c8b84c004afaea7054\System.Design.ni.dll (16cc.1454): CLR exception - code e0434f4d (first chance) (16cc.1454): Access violation - code c0000005 (first chance) First chance exceptions are reported before any exception handling. This exception may be expected and handled. eax=00000000 ebx=01776038 ecx=00000000 edx=00000000 esi=017ff314 edi=018907f8 eip=071a62fc esp=0499ee88 ebp=0499eef4 iopl=0 nv up ei pl zr na pe nc cs=001b ss=0023 ds=0023 es=0023 fs=003b gs=0000 efl=00010246 071a62fc 8b01 mov eax,dword ptr [ecx] ds:0023:00000000=???????? 0:018 g (16cc.1454): CLR exception - code e0434f4d (first chance) (16cc.1454): Access violation - code c0000005 (first chance) First chance exceptions are reported before any exception handling. This exception may be expected and handled. eax=00000000 ebx=01776038 ecx=00000000 edx=00000000 esi=017ff200 edi=0186ed04 eip=071a62fc esp=0499ee88 ebp=0499eef4 iopl=0 nv up ei pl zr na pe nc cs=001b ss=0023 ds=0023 es=0023 fs=003b gs=0000 efl=00010246 071a62fc 8b01 mov eax,dword ptr [ecx] ds:0023:00000000=???????? 0:018 g (16cc.1358): Access violation - code c0000005 (first chance) First chance exceptions are reported before any exception handling. This exception may be expected and handled. eax=00000000 ebx=01776038 ecx=00000000 edx=00000000 esi=017ff200 edi=01858380 eip=071a62fc esp=0742ee98 ebp=0742ef04 iopl=0 nv up ei pl zr na pe nc cs=001b ss=0023 ds=0023 es=0023 fs=003b gs=0000 efl=00010246 071a62fc 8b01 mov eax,dword ptr [ecx] ds:0023:00000000=???????? 0:020 g (16cc.1358): Access violation - code c0000005 (first chance) First chance exceptions are reported before any exception handling. This exception may be expected and handled. eax=00000000 ebx=017758a4 ecx=00000000 edx=00000000 esi=017fd078 edi=018b6afc eip=071a62fc esp=0742ee98 ebp=0742ef04 iopl=0 nv up ei pl zr na pe nc cs=001b ss=0023 ds=0023 es=0023 fs=003b gs=0000 efl=00010246 071a62fc 8b01 mov eax,dword ptr [ecx] ds:0023:00000000=???????? 0:020 g (16cc.1358): Stack overflow - code c00000fd (first chance) First chance exceptions are reported before any exception handling. This exception may be expected and handled. eax=00000000 ebx=020504b4 ecx=000001d1 edx=0000001b esi=020503d4 edi=073f2998 eip=6eaf0ed3 esp=073f2980 ebp=073f30ec iopl=0 nv up ei pl zr na pe nc cs=001b ss=0023 ds=0023 es=0023 fs=003b gs=0000 efl=00010246 * WARNING: Unable to verify checksum for C:\Windows\assembly\NativeImages_v2.0.50727_32\System.Data\813556b5a2722045b0ea14467fd00227\System.Data.ni.dll System_Data_ni!_bidW103 (System_Data_ni+0x460ed3): 6eaf0ed3 f3ab rep stos dword ptr es:[edi] Any help would be appricated.

    Read the article

  • Creating Wildcard Certificates with makecert.exe

    - by Shawn Cicoria
    Be nice to be able to make wildcard certificates for use in development with makecert – turns out, it’s real easy.  Just ensure that your CN=  is the wildcard string to use. The following sequence generates a CA cert, then the public/private key pair for a wildcard certificate REM make the CA makecert -pe -n "CN=*.contosotest.com" -a sha1 -len 2048 -sky exchange -eku 1.3.6.1.5.5.7.3.1 -ic CA.cer -iv CA.pvk -sp "Microsoft RSA SChannel Cryptographic Provider" -sy 12 -sv wildcard.pvk wildcard.cer pvk2pfx -pvk wildcard.pvk -spc wildcard.cer -pfx wildcard.pfx REM now make the server wildcard cert makecert -pe -n "CN=*.contosotest.com" -a sha1 -len 2048 -sky exchange -eku 1.3.6.1.5.5.7.3.1 -ic CA.cer -iv CA.pvk -sp "Microsoft RSA SChannel Cryptographic Provider" -sy 12 -sv wildcard.pvk wildcard.cer pvk2pfx -pvk wildcard.pvk -spc wildcard.cer -pfx wildcard.pfx

    Read the article

  • Secretara si seful

    - by interesante
    Un bancher discuta cu prietenul sau:- Iti inchipui, m-am indragostit de secretara mea!Ea are 20 de ani, eu 65! Ce crezi, sansele mele vor creste daca ii voi spune ca am 50?- Sansele tale vor creste daca ii vei spune ca ai 80!Vezi si alte chestii haioase pe profilul meu de pe acest siteProprietarul unu hotel era nelamurit la calcularea unei facturi. Se decide sa-si intrebe secretara.- Asa-i ca ai terminat Politehnica?- Da, ii raspunde secretara.- Bun, atunci spune-mi, daca ai avea 20.000 de dolari din care ai scadea 14%, cu ce ai mai ramane?- Cu nimic in afara de cercei!

    Read the article

  • Glume cu chelneri

    - by interesante
    La un mic restaurant, in luna decembrie:- Chelner, ce ai rece in acest moment?- Picioarele, domnule.Distreaza-te si cu alte lucruri amuzante de pe jurnalul meu haios.La un restaurant de lux, vine controlul de la Sanepid.Fac ei controlul si constata ca totul era o.k.Multumiti,din partea patronului de local,primesc si un pranz.Vine chelnerul,ii intreaba ce vin doresc sa serveasca,le aduce vinul,scoate dopul de pluta,le toarna in pahare si, ca la un local care se respecta,acesta scoase o lingurita de la pieptul sacoului si curata cu grija bucatelele de pluta din paharele mesenilor. Dupa ce inspectorii servira masa, il chemara pe chelner sa-i multumeasca si-l intrebara: - Nu va suparati! De ce purtati snur la slit? - Igiena inainte de toate! Cand ne ducem la buda, ca sa nu mai punem mana, tragem de snur si gata! - Aha! Si cum o bagati la loc? - Cu lingurita!

    Read the article

  • Hazlii cu politisti

    - by interesante
    Mor 6 politisti si se ancheteaza cazul:-Pai...Trei dintre ei erau cu barca pe lac si doi si-au aprins cate-o tigara.Unul si-a adus aminte ca a uitat sa stinga chibritul si a sarit in apa sa-l stinga si sa-necat.Al doilea uitase se-si stinga chistocul si a sarit si el si sa-necat.-Si al treilea?-Nu pornea barca si s-a dat jos s-o-mpinga si sa-necat.-Bine, dar ceilalti trei ?-Ei au murit la reconstituire.....Distreaza-te copios si cu jocuri flash de pe un site cu jocuri online.Doua sotii de politisti stau de vorba. Una zice:- Draga, sotul meu are post langa o florarie. Niciodata nu mi-a adus vreo floare...- Si ce? Al meu are post langa conservator. O conserva n-am vazut pana acum...

    Read the article

  • Coding solution to WAR installation error (Websphere Portal 6.0) ?

    - by Scott Leis
    I have a Websphere Portal application containing several portlets for which I'm currently working on some changes. A week ago, the WAR file produced by Rational Application Developer could be installed on the Portal server with no problems. Yesterday I made some seemingly minor changes to two JSP files and their associated "pagecode" Java files, and attempting to update the WAR on the server (using the Portal Administration web interface) now produces an error message. The WAR upload works, and the system shows me the correct list of portlets in the WAR file, but clicking "Finish" gives me a page with the error message "EJPAQ1319E: Cannot install the selected WAR file. View Details". Clicking the "View Details" link gives me a page with the following text: EJPAQ1319E: Cannot install the selected WAR file. com.ibm.portal.WpsException: EJPAQ1319E: Cannot install the selected WAR file. at com.ibm.wps.portlets.portletmanager.actions.DoInstallWebModuleAction.installPortletFromFormFile(DoInstallWebModuleAction.java:633) at com.ibm.wps.portlets.portletmanager.actions.DoInstallWebModuleAction.doExecute(DoInstallWebModuleAction.java:159) at com.ibm.wps.portlets.adminstruts.actions.BaseAction.execute(BaseAction.java:64) at com.ibm.wps.portlets.struts.WpsRequestProcessor.processActionPerform(WpsRequestProcessor.java:338) at org.apache.struts.action.RequestProcessor.process(RequestProcessor.java:274) at com.ibm.wps.portlets.struts.WpsStrutsPortlet.processActionPerformed(WpsStrutsPortlet.java:1947) at com.ibm.wps.portlets.struts.WpsStrutsPortlet.actionPerformed(WpsStrutsPortlet.java:1637) at com.ibm.wps.portlets.adminstruts.WpsAdminStrutsPortlet.actionPerformed(WpsAdminStrutsPortlet.java:261) at com.ibm.wps.pe.pc.legacy.SPIPortletInterceptorImpl.handleEvents(SPIPortletInterceptorImpl.java:323) EJPPE0020E: It is not allowed to install a JSR 168 compliant over a 4.x portlet application. com.ibm.wps.command.applications.AppWarFileException: EJPPE0020E: It is not allowed to install a JSR 168 compliant over a 4.x portlet application. WrappedException is: com.ibm.wps.pe.mgr.exceptions.InvalidWarFileException: EJPPE0020E: It is not allowed to install a JSR 168 compliant over a 4.x portlet application. at com.ibm.wps.command.applications.AbstractApplicationsCommand.throwAppMgrException(AbstractApplicationsCommand.java:492) at com.ibm.wps.command.applications.UpdatePortletApplicationCommand.execute(UpdatePortletApplicationCommand.java:165) at com.ibm.wps.portlets.portletmanager.actions.DoInstallWebModuleAction.installPortletFromFormFile(DoInstallWebModuleAction.java:510) at com.ibm.wps.portlets.portletmanager.actions.DoInstallWebModuleAction.doExecute(DoInstallWebModuleAction.java:159) at com.ibm.wps.portlets.adminstruts.actions.BaseAction.execute(BaseAction.java:64) at com.ibm.wps.portlets.struts.WpsRequestProcessor.processActionPerform(WpsRequestProcessor.java:338) at org.apache.struts.action.RequestProcessor.process(RequestProcessor.java:274) at com.ibm.wps.portlets.struts.WpsStrutsPortlet.processActionPerformed(WpsStrutsPortlet.java:1947) EJPPE0020E: It is not allowed to install a JSR 168 compliant over a 4.x portlet application. com.ibm.wps.pe.mgr.exceptions.InvalidWarFileException: EJPPE0020E: It is not allowed to install a JSR 168 compliant over a 4.x portlet application. at com.ibm.wps.pe.mgr.AbstractApplicationManagerImpl.updateWebModule(AbstractApplicationManagerImpl.java:1338) at com.ibm.wps.pe.mgr.AbstractApplicationManagerImpl.updateWebModule(AbstractApplicationManagerImpl.java:1255) at com.ibm.wps.command.applications.UpdatePortletApplicationCommand.execute(UpdatePortletApplicationCommand.java:135) at com.ibm.wps.portlets.portletmanager.actions.DoInstallWebModuleAction.installPortletFromFormFile(DoInstallWebModuleAction.java:510) at com.ibm.wps.portlets.portletmanager.actions.DoInstallWebModuleAction.doExecute(DoInstallWebModuleAction.java:159) at com.ibm.wps.portlets.adminstruts.actions.BaseAction.execute(BaseAction.java:64) at com.ibm.wps.portlets.struts.WpsRequestProcessor.processActionPerform(WpsRequestProcessor.java:338) at org.apache.struts.action.RequestProcessor.process(RequestProcessor.java:274) at com.ibm.wps.portlets.struts.WpsStrutsPortlet.processActionPerformed(WpsStrutsPortlet.java:1947) All I've been able to find about this error via Google is the following in the Websphere Portal documentation: EJPPE0020E: It is not allowed to install a {0} over a {1} portlet application. Explanation: A portlet application containing legacy portlets can only be updated with another portlet application that contains legacy portlets. The same is true for standard portlet applications. User Response: Modify the portlet.xml of the application such that it matches the original API type, standard or legacy and try again. However, the "portlet.xml" file has not changed in about a month, and I've done several WAR updates for this application in that time with no problems. The problem seems to be caused by the code changes I did yesterday, but I have no clue why a few lines of code would do this. Any ideas?

    Read the article

  • route propogation using OSPF in a network

    - by liv2hak
    I am using Juniper J-series routers to emulate a small telco and VPN customer.The internal routing will be configured with OSPF,MPLS including a default and backup path,RSVP for distributing labels withing the telco,OSPF for distributing routes from the customer edge (CE) routers to the VRF's in the adjacent PE's and finally iBGP for distributing customer routes between VRF's in different PEs. The topology of the network is shown below. The Addressing scheme for the network is as follows. UOW-TAU ******* ge-0/0/0 192.168.3.1 TAU-PE1 ******* ge-0/0/0 10.0.1.0 ge-0/0/1 10.0.2.0 ge-0/0/2 192.168.3.2 TAU-P1 ****** ge-0/0/0 172.16.1.0 ge-0/0/1 172.16.3.1 ge-0/0/2 10.0.2.2 HAM-P1 ****** ge-0/0/0 172.16.3.2 ge-0/0/1 172.16.2.1 ge-0/0/3 10.0.3.2 ACK-P1 ****** ge-0/0/0 172.16.1.2 ge-0/0/2 172.16.2.2 ge-0/0/3 10.0.1.2 HAM-PE1 ******* ge-0/0/0 10.0.3.1 ge-0/0/2 192.168.4.2 UOW-HAM ******* ge-0/0/0 192.168.4.1 I also set up loopback address for each node. I want to setup OSPF so that path to each internal subnet and router loopback address is propogated to all PE and P nodes.I also want to select a single area for PE and P nodes,and on each node I should add each interface that should be propogated. How do I accomplish this.? With my understanding below is the procedure to achieve this.Is the below explanation correct? I set up OSPF on UOW-TAU ge-0/0/0 interface and ge-0/0/1 interface and UOW-HAM ge-0/0/0 interface and ge-0/0/1 interface. let me call this Area 100. Once I have done this I should be able to reach each node from others using ping and traceroute. Any help is highly appreciated.

    Read the article

  • Lambda Expression to be used in Select() query

    - by jameschinnock
    Hi, I am trying to build a lambda expression, containing two assignments (as shown further down), that I can then pass to a Queryable.Select() method. I am trying to pass a string variable into a method and then use that variable to build up the lambda expression so that I can use it in a LINQ Select query. My reasoning behind it is that I have a SQL Server datasource with many column names, I am creating a charting application that will allow the user to select, say by typing in the column name, the actual column of data they want to view in the y-axis of my chart, with the x-axis always being the DateTime. Therefore, they can essentially choose what data they chart against the DateTime value (it’s a data warehouse type app). I have, for example, a class to store the retrieved data in, and hence use as the chart source of: public class AnalysisChartSource { public DateTime Invoicedate { get; set; } public Decimal yValue { get; set; } } I have (purely experimentaly) built an expression tree for the Where clause using the String value and that works fine: public void GetData(String yAxis) { using (DataClasses1DataContext db = new DataClasses1DataContext()) { var data = this.FunctionOne().AsQueryable<AnalysisChartSource>(); //just to get some temp data in.... ParameterExpression pe = Expression.Parameter(typeof(AnalysisChartSource), "p"); Expression left = Expression.MakeMemberAccess(pe, typeof(AnalysisChartSource).GetProperty(yAxis)); Expression right = Expression.Constant((Decimal)16); Expression e2 = Expression.LessThan(left, right); Expression expNew = Expression.New(typeof(AnalysisChartSource)); LambdaExpression le = Expression.Lambda(left, pe); MethodCallExpression whereCall = Expression.Call( typeof(Queryable), "Where", new Type[] { data.ElementType }, data.Expression, Expression.Lambda<Func<AnalysisChartSource, bool>>(e2, new ParameterExpression[] { pe })); } } However……I have tried a similar approach for the Select statement, but just can’t get it to work as I need the Select() to populate both X and Y values of the AnalysisChartSource class, like this: .Select(c => new AnalysisChartSource { Invoicedate = c.Invoicedate, yValue = c.yValue}).AsEnumerable(); How on earth can I build such an expression tree….or….possibly more to the point…..is there an easier way that I have missed entirely?

    Read the article

  • Is Export table contains all entries of Win32 Exe functions?

    - by Usman
    Hello, I need to know that all Win32 Exe functions or class's member functions contained inside Export table of that Win 32 exe(PE File)? If not then from how and where I would be able to get all these information? (I know PE file format and all sections of it and know what those sections contained but still help required how to proceeed?) Regards Muhammad Usman

    Read the article

  • svn:externals a sub-folder of a git project

    - by dgaspar
    Hi, is there a way to get only a part (ex: a sub-folder called /library) of a github.com project and use it in svn:externals? What I'm doing now is $svn pe svn:externals . SomeLibrary http://svn.github.com/myuser/myproject.git But I don't want everything from the project... I need something like: $svn pe svn:externals . SomeLibrary http://svn.github.com/myuser/myproject.git/library

    Read the article

  • Building elf within Eclipse

    - by BSchlinker
    Hey guys, I'm having trouble building an Elf file within Eclipse. It seems that everytime I build, a PE / portable executable for windows is created. I've gone into the Binary Parser section and checked Elf Parser while making sure that everything else is unchecked. However, I continue to end up with a PE which I cannot run on Linux. Any ideas? Thanks

    Read the article

  • PropertyGrid control issue in Windows7

    - by Mahesh
    I have an issue with the Windows Forms PropertyGrid control. I have customized the PropertyGrid control and override only OnPaint function. protected override void OnPaint(PaintEventArgs pe) { base.OnPaint(pe); } In my application I have few more controls (treeview, custom control and few form controls). When I mouseclick on the PropertyGrid control, the paint function in all the controls in the screen are being called continuously and the treeview starts flickering. This happens only in mouseclick event.

    Read the article

  • volume group disappeared after xfs_check run

    - by John P
    EDIT** I have a volume group consisting of 5 RAID1 devices grouped together into a lvm and formatted with xfs. The 5th RAID device lost its RAID config (cat /proc/mdstat does not show anything). The two drives are still present (sdj and sdk), but they have no partitions. The LVM appeared to be happily using sdj up until recently. (doing a pvscan showed the first 4 RAID1 devices + /dev/sdj) I removed the LVM from the fstab, rebooted, then ran xfs_check on the LV. It ran for about half an hour, then stopped with an error. I tried rebooting again, and this time when it came up, the logical volume was no longer there. It is now looking for /dev/md5, which is gone (though it had been using /dev/sdj earlier). /dev/sdj was having read errors, but after replacing the SATA cable, those went away, so the drive appears to be fine for now. Can I modify the /etc/lvm/backup/dedvol, change the device to /dev/sdj and do a vgcfgrestore? I could try doing a pvcreate --uuid KZron2-pPTr-ZYeQ-PKXX-4Woq-6aNc-AG4rRJ /dev/sdj to make it recognize it, but I'm afraid that would erase the data on the drive UPDATE: just changing the pv to point to /dev/sdj did not work vgcfgrestore --file /etc/lvm/backup/dedvol dedvol Couldn't find device with uuid 'KZron2-pPTr-ZYeQ-PKXX-4Woq-6aNc-AG4rRJ'. Cannot restore Volume Group dedvol with 1 PVs marked as missing. Restore failed. pvscan /dev/sdj: read failed after 0 of 4096 at 0: Input/output error Couldn't find device with uuid 'KZron2-pPTr-ZYeQ-PKXX-4Woq-6aNc-AG4rRJ'. Couldn't find device with uuid 'KZron2-pPTr-ZYeQ-PKXX-4Woq-6aNc-AG4rRJ'. Couldn't find device with uuid 'KZron2-pPTr-ZYeQ-PKXX-4Woq-6aNc-AG4rRJ'. Couldn't find device with uuid 'KZron2-pPTr-ZYeQ-PKXX-4Woq-6aNc-AG4rRJ'. PV /dev/sdd2 VG VolGroup00 lvm2 [74.41 GB / 0 free] PV /dev/md2 VG dedvol lvm2 [931.51 GB / 0 free] PV /dev/md3 VG dedvol lvm2 [931.51 GB / 0 free] PV /dev/md0 VG dedvol lvm2 [931.51 GB / 0 free] PV /dev/md4 VG dedvol lvm2 [931.51 GB / 0 free] PV unknown device VG dedvol lvm2 [1.82 TB / 63.05 GB free] Total: 6 [5.53 TB] / in use: 6 [5.53 TB] / in no VG: 0 [0 ] vgscan Reading all physical volumes. This may take a while... /dev/sdj: read failed after 0 of 4096 at 0: Input/output error /dev/sdj: read failed after 0 of 4096 at 2000398843904: Input/output error Found volume group "VolGroup00" using metadata type lvm2 Found volume group "dedvol" using metadata type lvm2 vgdisplay dedvol --- Volume group --- VG Name dedvol System ID Format lvm2 Metadata Areas 5 Metadata Sequence No 10 VG Access read/write VG Status resizable MAX LV 0 Cur LV 1 Open LV 0 Max PV 0 Cur PV 5 Act PV 5 VG Size 5.46 TB PE Size 4.00 MB Total PE 1430796 Alloc PE / Size 1414656 / 5.40 TB Free PE / Size 16140 / 63.05 GB VG UUID o1U6Ll-5WH8-Pv7Z-Rtc4-1qYp-oiWA-cPD246 dedvol { id = "o1U6Ll-5WH8-Pv7Z-Rtc4-1qYp-oiWA-cPD246" seqno = 10 status = ["RESIZEABLE", "READ", "WRITE"] flags = [] extent_size = 8192 # 4 Megabytes max_lv = 0 max_pv = 0 physical_volumes { pv0 { id = "Msiee7-Zovu-VSJ3-Y2hR-uBVd-6PaT-Ho9v95" device = "/dev/md2" # Hint only status = ["ALLOCATABLE"] flags = [] dev_size = 1953519872 # 931.511 Gigabytes pe_start = 384 pe_count = 238466 # 931.508 Gigabytes } pv1 { id = "ZittCN-0x6L-cOsW-v1v4-atVN-fEWF-e3lqUe" device = "/dev/md3" # Hint only status = ["ALLOCATABLE"] flags = [] dev_size = 1953519872 # 931.511 Gigabytes pe_start = 384 pe_count = 238466 # 931.508 Gigabytes } pv2 { id = "NRNo0w-kgGr-dUxA-mWnl-bU5v-Wld0-XeKVLD" device = "/dev/md0" # Hint only status = ["ALLOCATABLE"] flags = [] dev_size = 1953519872 # 931.511 Gigabytes pe_start = 384 pe_count = 238466 # 931.508 Gigabytes } pv3 { id = "2EfLFr-JcRe-MusW-mfAs-WCct-u4iV-W0pmG3" device = "/dev/md4" # Hint only status = ["ALLOCATABLE"] flags = [] dev_size = 1953519872 # 931.511 Gigabytes pe_start = 384 pe_count = 238466 # 931.508 Gigabytes } pv4 { id = "KZron2-pPTr-ZYeQ-PKXX-4Woq-6aNc-AG4rRJ" device = "/dev/md5" # Hint only status = ["ALLOCATABLE"] flags = [] dev_size = 3907028992 # 1.81935 Terabytes pe_start = 384 pe_count = 476932 # 1.81935 Terabytes } }

    Read the article

  • Dynamic Linq Property Converting to Sql

    - by Matthew Hood
    I am trying to understand dynamic linq and expression trees. Very basically trying to do an equals supplying the column and value as strings. Here is what I have so far private IQueryable<tblTest> filterTest(string column, string value) { TestDataContext db = new TestDataContext(); // The IQueryable data to query. IQueryable<tblTest> queryableData = db.tblTests.AsQueryable(); // Compose the expression tree that represents the parameter to the predicate. ParameterExpression pe = Expression.Parameter(typeof(tblTest), "item"); Expression left = Expression.Property(pe, column); Expression right = Expression.Constant(value); Expression e1 = Expression.Equal(left, right); MethodCallExpression whereCallExpression = Expression.Call( typeof(Queryable), "Where", new Type[] { queryableData.ElementType }, queryableData.Expression, Expression.Lambda<Func<tblTest, bool>>(e1, new ParameterExpression[] { pe })); // Create an executable query from the expression tree. IQueryable<tblTest> results = queryableData.Provider.CreateQuery<tblTest>(whereCallExpression); return results; } That works fine for columns in the DB. But fails for properties in my code eg public partial class tblTest { public string name_test { get { return name; } } } Giving an error cannot be that it cannot be converted into SQL. I have tried rewriting the property as a Expression<Func but with no luck, how can I convert simple properties so they can be used with linq in this dynamic way? Many Thanks

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • How to open the built-in task manager when it's replaced by Process Explorer?

    - by AgreeOrNot
    I want to open the built-in task manager with Process Explorer's Replace Task Manager option checked. I've tried: Running taskmgr.exe from the run dialog. PE was opened instead. Creating a copy of taskmgr.exe in the same folder. Then run it. The built-in task manager was opened, but not working properly(its window was blank). Creating a symbolic link (using mklink) of taskmgr.exe in the same folder. Then run it. PE was opened instead. Is there any other method I can try? Thanks.

    Read the article

  • Leveraging .Net 4.0 Framework Tools For Encrypting Web Configuration Sections

    - by Sam Abraham
    I would like to share a few points with regards to encrypting web configuration sections in .Net 4.0. This information is also applicable to .Net 3.5 and 2.0. Two methods can work perfectly for encrypting connection strings in a Web project configuration file:   1-Do It All Yourself! In this approach, helper functions for encrypting/decrypting configuration file content are implemented. Program would explicitly retrieve appropriate content from configuration file then decrypt it appropriately.  Disadvantages of this implementation would be the added overhead for maintaining the encryption/decryption code as well the burden of always ensuring sections are appropriately decrypted before use and encrypted appropriately whenever edited.   2- Leverage the .Net 4.0 Framework (The Way to go!) Fortunately, all needed tools for protecting configuration files are built-in to the .Net 2.0/3.5/4.0 versions with very little setup needed. To encrypt connection strings, one can use the ASP.Net IIS Registration Tool (Aspnet_regiis.exe). Note that a 64-bit version of the tool also exists under the Framework64 folder for 64-bit systems. The command we need to encrypt our web.config file connection strings is simply the following:   Aspnet_regiis –pe “connectionstrings” –app “/sampleApplication” –prov “RsaProtectedConfigurationProvider”   To later decrypt this configuration section:   Aspnet_regiis –pd “connectionstrings” –app “/SampleApplication”   The following is a brief description of the command line options used in the example above. Aspnet_regiis supports many more options which you can read about in the links provided for reference below.   Option Description -pe  Section name to encrypt -pd  Section name to decrypt -app  Web application name -prov  Encryption/Decryption provider   ASP.Net automatically decrypts the content of the Web.Config file at runtime so no programming changes are needed.   Another tool, aspnet_setreg.exe is to be used if certain configuration file sections pertinent to the .Net runtime are to be encrypted. For more information on when and how to use aspnet_setreg, please refer to the references below.   Hope this helps!   Some great references concerning the topic:   http://msdn.microsoft.com/en-us/library/ff650037.aspx http://msdn.microsoft.com/en-us/library/zhhddkxy.aspx http://msdn.microsoft.com/en-us/library/dtkwfdky.aspx http://msdn.microsoft.com/en-us/library/68ze1hb2.aspx

    Read the article

  • The Incremental Architect&acute;s Napkin - #2 - Balancing the forces

    - by Ralf Westphal
    Originally posted on: http://geekswithblogs.net/theArchitectsNapkin/archive/2014/06/02/the-incremental-architectacutes-napkin---2---balancing-the-forces.aspxCategorizing requirements is the prerequisite for ecconomic architectural decisions. Not all requirements are created equal. However, to truely understand and describe the requirement forces pulling on software development, I think further examination of the requirements aspects is varranted. Aspects of Functionality There are two sides to Functionality requirements. It´s about what a software should do. I call that the Operations it implements. Operations are defined by expressions and control structures or calls to frameworks of some sort, i.e. (business) logic statements. Operations calculate, transform, aggregate, validate, send, receive, load, store etc. Operations are about behavior; they take input and produce output by considering state. I´m not using the term “function” here, because functions - or methods or sub-programs - are not necessary to implement Operations. Functions belong to a different sub-aspect of requirements (see below). Operations alone are not enough, though, to make a customer happy with regard to his/her Functionality requirements. Only correctly implemented Operations provide full value. This should make clear, why testing is so important. And not just manual tests during development of some operational feature, but automated tests. Because only automated tests scale when over time the number of operations increases. Without automated tests there is no guarantee formerly correct operations are still correct after more got added. To retest all previous operations manually is infeasible. So whoever relies just on manual tests is not really balancing the two forces Operations and Correctness. With manual tests more weight is put on the side of the scale of Operations. That might be ok for a short period of time - but in the long run it will bite you. You need to plan for Correctness in the long run from the first day of your project on. Aspects of Quality As important as Functionality is, it´s not the driver for software development. No software has ever been written to just implement some operation in code. We don´t need computers just to do something. All computers can do with software we can do without them. Well, at least given enough time and resources. We could calculate the most complex formulas without computers. We could do auctions with millions of people without computers. The only reason we want computers to help us with this and a million other Operations is… We don´t want to wait for the results very long. Or we want less errors. Or we want easier accessability to complicated solutions. So the main reason for customers to buy/order software is some Quality. They want some Functionality with a higher Quality (e.g. performance, scalability, usability, security…) than without the software. But Qualities come in at least two flavors: Most important are Primary Qualities. That´s the Qualities software truely is written for. Take an online auction website for example. Its Primary Qualities are performance, scalability, and usability, I´d say. Auctions should come within reach of millions of people; setting up an auction should be very easy; finding a suitable auction and bidding on it should be as fast as possible. Only if those Qualities have been implemented does security become relevant. A secure auction website is important - but not as important as a fast auction website. Nobody would want to use the most secure auction website if it was unbearably slow. But there would be people willing to use the fastest auction website even it was lacking security. That´s why security - with regard to online auction software - is not a Primary Quality, but just a Secondary Quality. It´s a supporting quality, so to speak. It does not deliver value by itself. With a password manager software this might be different. There security might be a Primary Quality. Please get me right: I don´t want to denigrate any Quality. There´s a long list of non-functional requirements at Wikipedia. They are all created equal - but that does not mean they are equally important for all software projects. When confronted with Quality requirements check with the customer which are primary and which are secondary. That will help to make good economical decisions when in a crunch. Resources are always limited - but requirements are a bottomless ocean. Aspects of Security of Investment Functionality and Quality are traditionally the requirement aspects cared for most - by customers and developers alike. Even today, when pressure rises in a project, tunnel vision will focus on them. Any measures to create and hold up Security of Investment (SoI) will be out of the window pretty quickly. Resistance to customers and/or management is futile. As long as SoI is not placed on equal footing with Functionality and Quality it´s bound to suffer under pressure. To look closer at what SoI means will help to become more conscious about it and make customers and management aware of the risks of neglecting it. SoI to me has two facets: Production Efficiency (PE) is about speed of delivering value. Customers like short response times. Short response times mean less money spent. So whatever makes software development faster supports this requirement. This must not lead to duct tape programming and banging out features by the dozen, though. Because customers don´t just want Operations and Quality, but also Correctness. So if Correctness gets compromised by focussing too much on Production Efficiency it will fire back. Customers want PE not just today, but over the whole course of a software´s lifecycle. That means, it´s not just about coding speed, but equally about code quality. If code quality leads to rework the PE is on an unsatisfactory level. Also if code production leads to waste it´s unsatisfactory. Because the effort which went into waste could have been used to produce value. Rework and waste cost money. Rework and waste abound, however, as long as PE is not addressed explicitly with management and customers. Thanks to the Agile and Lean movements that´s increasingly the case. Nevertheless more could and should be done in many teams. Each and every developer should keep in mind that Production Efficiency is as important to the customer as Functionality and Quality - whether he/she states it or not. Making software development more efficient is important - but still sooner or later even agile projects are going to hit a glas ceiling. At least as long as they neglect the second SoI facet: Evolvability. Delivering correct high quality functionality in short cycles today is good. But not just any software structure will allow this to happen for an indefinite amount of time.[1] The less explicitly software was designed the sooner it´s going to get stuck. Big ball of mud, monolith, brownfield, legacy code, technical debt… there are many names for software structures that have lost the ability to evolve, to be easily changed to accomodate new requirements. An evolvable code base is the opposite of a brownfield. It´s code which can be easily understood (by developers with sufficient domain expertise) and then easily changed to accomodate new requirements. Ideally the costs of adding feature X to an evolvable code base is independent of when it is requested - or at least the costs should only increase linearly, not exponentially.[2] Clean Code, Agile Architecture, and even traditional Software Engineering are concerned with Evolvability. However, it seems no systematic way of achieving it has been layed out yet. TDD + SOLID help - but still… When I look at the design ability reality in teams I see much room for improvement. As stated previously, SoI - or to be more precise: Evolvability - can hardly be measured. Plus the customer rarely states an explicit expectation with regard to it. That´s why I think, special care must be taken to not neglect it. Postponing it to some large refactorings should not be an option. Rather Evolvability needs to be a core concern for every single developer day. This should not mean Evolvability is more important than any of the other requirement aspects. But neither is it less important. That´s why more effort needs to be invested into it, to bring it on par with the other aspects, which usually are much more in focus. In closing As you see, requirements are of quite different kinds. To not take that into account will make it harder to understand the customer, and to make economic decisions. Those sub-aspects of requirements are forces pulling in different directions. To improve performance might have an impact on Evolvability. To increase Production Efficiency might have an impact on security etc. No requirement aspect should go unchecked when deciding how to allocate resources. Balancing should be explicit. And it should be possible to trace back each decision to a requirement. Why is there a null-check on parameters at the start of the method? Why are there 5000 LOC in this method? Why are there interfaces on those classes? Why is this functionality running on the threadpool? Why is this function defined on that class? Why is this class depending on three other classes? These and a thousand more questions are not to mean anything should be different in a code base. But it´s important to know the reason behind all of these decisions. Because not knowing the reason possibly means waste and having decided suboptimally. And how do we ensure to balance all requirement aspects? That needs practices and transparency. Practices means doing things a certain way and not another, even though that might be possible. We´re dealing with dangerous tools here. Like a knife is a dangerous tool. Harm can be done if we use our tools in just any way at the whim of the moment. Over the centuries rules and practices have been established how to use knifes. You don´t put them in peoples´ legs just because you´re feeling like it. You hand over a knife with the handle towards the receiver. You might not even be allowed to cut round food like potatos or eggs with it. The same should be the case for dangerous tools like object-orientation, remote communication, threads etc. We need practices to use them in a way so requirements are balanced almost automatically. In addition, to be able to work on software as a team we need transparency. We need means to share our thoughts, to work jointly on mental models. So far our tools are focused on working with code. Testing frameworks, build servers, DI containers, intellisense, refactoring support… That´s all nice and well. I don´t want to miss any of that. But I think it´s not enough. We´re missing mental tools, tools for making thinking and talking about software (independently of code) easier. You might think, enough of such tools already exist like all those UML diagram types or Flow Charts. But then, isn´t it strange, hardly any team is using them to design software? Or is that just due to a lack of education? I don´t think so. It´s a matter value/weight ratio: the current mental tools are too heavy weight compared to the value they deliver. So my conclusion is, we need lightweight tools to really be able to balance requirements. Software development is complex. We need guidance not to forget important aspects. That´s like with flying an airplane. Pilots don´t just jump in and take off for their destination. Yes, there are times when they are “flying by the seats of their pants”, when they are just experts doing thing intuitively. But most of the time they are going through honed practices called checklist. See “The Checklist Manifesto” for very enlightening details on this. Maybe then I should say it like this: We need more checklists for the complex businss of software development.[3] But that´s what software development mostly is about: changing software over an unknown period of time. It needs to be corrected in order to finally provide promised operations. It needs to be enhanced to provide ever more operations and qualities. All this without knowing when it´s going to stop. Probably never - until “maintainability” hits a wall when the technical debt is too large, the brownfield too deep. Software development is not a sprint, is not a marathon, not even an ultra marathon. Because to all this there is a foreseeable end. Software development is like continuously and foreever running… ? And sometimes I dare to think that costs could even decrease over time. Think of it: With each feature a software becomes richer in functionality. So with each additional feature the chance of there being already functionality helping its implementation increases. That should lead to less costs of feature X if it´s requested later than sooner. X requested later could stand on the shoulders of previous features. Alas, reality seems to be far from this despite 20+ years of admonishing developers to think in terms of reusability.[1] ? Please don´t get me wrong: I don´t want to bog down the “art” of software development with heavyweight practices and heaps of rules to follow. The framework we need should be lightweight. It should not stand in the way of delivering value to the customer. It´s purpose is even to make that easier by helping us to focus and decreasing waste and rework. ?

    Read the article

  • Writing a Compiler for .net - IL or Bytecode?

    - by Michael Stum
    I'm currently diving into the inner workings of .net, which means IL. As an exercise, I want to build a brainf..k compiler for .net (yes, they already exist, but as said it's for learning purposes). For the moment I'm just writing some text files that contain .il and compile them with ilasm, which works. But I wonder if I could/should go one level deeper and write bytecode directly? My "concern" is the Windows PE Stuff when compiling an EXE - instead of ilasm I would need some sort of Bytecode linker that would take my MSIL/CIL bytecode and generate the PE Stuff for it? Or do compilers "only" compile their language to IL and execute ilasm? Is there a managed version of it that I can call/embed from my compiler?

    Read the article

  • Building elf within Eclipse within Windows

    - by BSchlinker
    Hey guys, I'm having trouble building an Elf file within Eclipse within Windows. It seems that everytime I build, a PE / portable executable for windows is created. I've gone into the Binary Parser section and checked Elf Parser while making sure that everything else is unchecked. However, I continue to end up with a PE which I cannot run on Linux. For clarification, I'm using the Linux GCC toolchain within Eclipse. I've attempted a reinstall of Cygwin -- still experiencing the same issues. Any ideas? Thanks

    Read the article

  • Custom Control Overriding Command Button

    - by pm_2
    I am trying to create a custom command button that defaults width and height to specific settings. I have the following code: public partial class myCommandButton : Button { public magCommandButton() { InitializeComponent(); } [DefaultValue(840)] public override int Width { get { return base.Width; } set { base.Width = value; } } [DefaultValue(340)] public override int Height { get { return base.Height; } set { base.Height = value; } } protected override void OnPaint(PaintEventArgs pe) { base.OnPaint(pe); } } However, it won't compile because it tells me that I can not override Width or Height. Can anyone tell me if I'm approaching this wrongly, or if there's a way around this?

    Read the article

  • Using the windows api and C++, how could I load an exe from the hard drive and run it in its own thread?

    - by returneax
    For the sake of learning I'm trying to do what the OS does when launching a program ie. parsing a PE file and giving it a thread of execution. If I have two exe's one called foo.exe and the other bar.exe, how could I have foo.exe load the contents of bar.exe into memory then have it execute from there in its own thread? I know how to get it into memory using MapViewOfFile or by simple loading the contents on the hard drive into a buffer. I'm assuming simply copying the contents of bar.exe on disk into its own suspended thread and running it wouldn't work. I am semi-familiar with PE file internals. All help is very much appreciated, of course :)

    Read the article

  • Parallelism in .NET – Part 5, Partitioning of Work

    - by Reed
    When parallelizing any routine, we start by decomposing the problem.  Once the problem is understood, we need to break our work into separate tasks, so each task can be run on a different processing element.  This process is called partitioning. Partitioning our tasks is a challenging feat.  There are opposing forces at work here: too many partitions adds overhead, too few partitions leaves processors idle.  Trying to work the perfect balance between the two extremes is the goal for which we should aim.  Luckily, the Task Parallel Library automatically handles much of this process.  However, there are situations where the default partitioning may not be appropriate, and knowledge of our routines may allow us to guide the framework to making better decisions. First off, I’d like to say that this is a more advanced topic.  It is perfectly acceptable to use the parallel constructs in the framework without considering the partitioning taking place.  The default behavior in the Task Parallel Library is very well-behaved, even for unusual work loads, and should rarely be adjusted.  I have found few situations where the default partitioning behavior in the TPL is not as good or better than my own hand-written partitioning routines, and recommend using the defaults unless there is a strong, measured, and profiled reason to avoid using them.  However, understanding partitioning, and how the TPL partitions your data, helps in understanding the proper usage of the TPL. I indirectly mentioned partitioning while discussing aggregation.  Typically, our systems will have a limited number of Processing Elements (PE), which is the terminology used for hardware capable of processing a stream of instructions.  For example, in a standard Intel i7 system, there are four processor cores, each of which has two potential hardware threads due to Hyperthreading.  This gives us a total of 8 PEs – theoretically, we can have up to eight operations occurring concurrently within our system. In order to fully exploit this power, we need to partition our work into Tasks.  A task is a simple set of instructions that can be run on a PE.  Ideally, we want to have at least one task per PE in the system, since fewer tasks means that some of our processing power will be sitting idle.  A naive implementation would be to just take our data, and partition it with one element in our collection being treated as one task.  When we loop through our collection in parallel, using this approach, we’d just process one item at a time, then reuse that thread to process the next, etc.  There’s a flaw in this approach, however.  It will tend to be slower than necessary, often slower than processing the data serially. The problem is that there is overhead associated with each task.  When we take a simple foreach loop body and implement it using the TPL, we add overhead.  First, we change the body from a simple statement to a delegate, which must be invoked.  In order to invoke the delegate on a separate thread, the delegate gets added to the ThreadPool’s current work queue, and the ThreadPool must pull this off the queue, assign it to a free thread, then execute it.  If our collection had one million elements, the overhead of trying to spawn one million tasks would destroy our performance. The answer, here, is to partition our collection into groups, and have each group of elements treated as a single task.  By adding a partitioning step, we can break our total work into small enough tasks to keep our processors busy, but large enough tasks to avoid overburdening the ThreadPool.  There are two clear, opposing goals here: Always try to keep each processor working, but also try to keep the individual partitions as large as possible. When using Parallel.For, the partitioning is always handled automatically.  At first, partitioning here seems simple.  A naive implementation would merely split the total element count up by the number of PEs in the system, and assign a chunk of data to each processor.  Many hand-written partitioning schemes work in this exactly manner.  This perfectly balanced, static partitioning scheme works very well if the amount of work is constant for each element.  However, this is rarely the case.  Often, the length of time required to process an element grows as we progress through the collection, especially if we’re doing numerical computations.  In this case, the first PEs will finish early, and sit idle waiting on the last chunks to finish.  Sometimes, work can decrease as we progress, since previous computations may be used to speed up later computations.  In this situation, the first chunks will be working far longer than the last chunks.  In order to balance the workload, many implementations create many small chunks, and reuse threads.  This adds overhead, but does provide better load balancing, which in turn improves performance. The Task Parallel Library handles this more elaborately.  Chunks are determined at runtime, and start small.  They grow slowly over time, getting larger and larger.  This tends to lead to a near optimum load balancing, even in odd cases such as increasing or decreasing workloads.  Parallel.ForEach is a bit more complicated, however. When working with a generic IEnumerable<T>, the number of items required for processing is not known in advance, and must be discovered at runtime.  In addition, since we don’t have direct access to each element, the scheduler must enumerate the collection to process it.  Since IEnumerable<T> is not thread safe, it must lock on elements as it enumerates, create temporary collections for each chunk to process, and schedule this out.  By default, it uses a partitioning method similar to the one described above.  We can see this directly by looking at the Visual Partitioning sample shipped by the Task Parallel Library team, and available as part of the Samples for Parallel Programming.  When we run the sample, with four cores and the default, Load Balancing partitioning scheme, we see this: The colored bands represent each processing core.  You can see that, when we started (at the top), we begin with very small bands of color.  As the routine progresses through the Parallel.ForEach, the chunks get larger and larger (seen by larger and larger stripes). Most of the time, this is fantastic behavior, and most likely will out perform any custom written partitioning.  However, if your routine is not scaling well, it may be due to a failure in the default partitioning to handle your specific case.  With prior knowledge about your work, it may be possible to partition data more meaningfully than the default Partitioner. There is the option to use an overload of Parallel.ForEach which takes a Partitioner<T> instance.  The Partitioner<T> class is an abstract class which allows for both static and dynamic partitioning.  By overriding Partitioner<T>.SupportsDynamicPartitions, you can specify whether a dynamic approach is available.  If not, your custom Partitioner<T> subclass would override GetPartitions(int), which returns a list of IEnumerator<T> instances.  These are then used by the Parallel class to split work up amongst processors.  When dynamic partitioning is available, GetDynamicPartitions() is used, which returns an IEnumerable<T> for each partition.  If you do decide to implement your own Partitioner<T>, keep in mind the goals and tradeoffs of different partitioning strategies, and design appropriately. The Samples for Parallel Programming project includes a ChunkPartitioner class in the ParallelExtensionsExtras project.  This provides example code for implementing your own, custom allocation strategies, including a static allocator of a given chunk size.  Although implementing your own Partitioner<T> is possible, as I mentioned above, this is rarely required or useful in practice.  The default behavior of the TPL is very good, often better than any hand written partitioning strategy.

    Read the article

  • Visual Dumpbin - A C# Visual GUI for Dumpbin

    Visual Dumpbin provides a visual GUI for dumpbin, the Microsoft utility for dumping PE files. The right-click menu lets you copy the output, and you can optionally undecorate C++ function names found in DLLs, and generate a C# wrapper class.

    Read the article

< Previous Page | 1 2 3 4 5 6 7 8 9 10 11  | Next Page >