Search Results

Search found 36132 results on 1446 pages for 'line height'.

Page 421/1446 | < Previous Page | 417 418 419 420 421 422 423 424 425 426 427 428  | Next Page >

  • Full-text Indexing Books Online

    - by Most Valuable Yak (Rob Volk)
    While preparing for a recent SQL Saturday presentation, I was struck by a crazy idea (shocking, I know): Could someone import the content of SQL Server Books Online into a database and apply full-text indexing to it?  The answer is yes, and it's really quite easy to do. The first step is finding the installed help files.  If you have SQL Server 2012, BOL is installed under the Microsoft Help Library.  You can find the install location by opening SQL Server Books Online and clicking the gear icon for the Help Library Manager.  When the new window pops up click the Settings link, you'll get the following: You'll see the path under Library Location. Once you navigate to that path you'll have to drill down a little further, to C:\ProgramData\Microsoft\HelpLibrary\content\Microsoft\store.  This is where the help file content is kept if you downloaded it for offline use. Depending on which products you've downloaded help for, you may see a few hundred files.  Fortunately they're named well and you can easily find the "SQL_Server_Denali_Books_Online_" files.  We are interested in the .MSHC files only, and can skip the Installation and Developer Reference files. Despite the .MHSC extension, these files are compressed with the standard Zip format, so your favorite archive utility (WinZip, 7Zip, WinRar, etc.) can open them.  When you do, you'll see a few thousand files in the archive.  We are only interested in the .htm files, but there's no harm in extracting all of them to a folder.  7zip provides a command-line utility and the following will extract to a D:\SQLHelp folder previously created: 7z e –oD:\SQLHelp "C:\ProgramData\Microsoft\HelpLibrary\content\Microsoft\store\SQL_Server_Denali_Books_Online_B780_SQL_110_en-us_1.2.mshc" *.htm Well that's great Rob, but how do I put all those files into a full-text index? I'll tell you in a second, but first we have to set up a few things on the database side.  I'll be using a database named Explore (you can certainly change that) and the following setup is a fragment of the script I used in my presentation: USE Explore; GO CREATE SCHEMA help AUTHORIZATION dbo; GO -- Create default fulltext catalog for later FT indexes CREATE FULLTEXT CATALOG FTC AS DEFAULT; GO CREATE TABLE help.files(file_id int not null IDENTITY(1,1) CONSTRAINT PK_help_files PRIMARY KEY, path varchar(256) not null CONSTRAINT UNQ_help_files_path UNIQUE, doc_type varchar(6) DEFAULT('.xml'), content varbinary(max) not null); CREATE FULLTEXT INDEX ON help.files(content TYPE COLUMN doc_type LANGUAGE 1033) KEY INDEX PK_help_files; This will give you a table, default full-text catalog, and full-text index on that table for the content you're going to insert.  I'll be using the command line again for this, it's the easiest method I know: for %a in (D:\SQLHelp\*.htm) do sqlcmd -S. -E -d Explore -Q"set nocount on;insert help.files(path,content) select '%a', cast(c as varbinary(max)) from openrowset(bulk '%a', SINGLE_CLOB) as c(c)" You'll need to copy and run that as one line in a command prompt.  I'll explain what this does while you run it and watch several thousand files get imported: The "for" command allows you to loop over a collection of items.  In this case we want all the .htm files in the D:\SQLHelp folder.  For each file it finds, it will assign the full path and file name to the %a variable.  In the "do" clause, we'll specify another command to be run for each iteration of the loop.  I make a call to "sqlcmd" in order to run a SQL statement.  I pass in the name of the server (-S.), where "." represents the local default instance. I specify -d Explore as the database, and -E for trusted connection.  I then use -Q to run a query that I enclose in double quotes. The query uses OPENROWSET(BULK…SINGLE_CLOB) to open the file as a data source, and to treat it as a single character large object.  In order for full-text indexing to work properly, I have to convert the text content to varbinary. I then INSERT these contents along with the full path of the file into the help.files table created earlier.  This process continues for each file in the folder, creating one new row in the table. And that's it! 5 SQL Statements and 2 command line statements to unzip and import SQL Server Books Online!  In case you're wondering why I didn't use FILESTREAM or FILETABLE, it's simply because I haven't learned them…yet. I may return to this blog after I figure that out and update it with the steps to do so.  I believe that will make it even easier. In the spirit of exploration, I'll leave you to work on some fulltext queries of this content.  I also recommend playing around with the sys.dm_fts_xxxx DMVs (I particularly like sys.dm_fts_index_keywords, it's pretty interesting).  There are additional example queries in the download material for my presentation linked above. Many thanks to Kevin Boles (t) for his advice on (re)checking the content of the help files.  Don't let that .htm extension fool you! The 2012 help files are actually XML, and you'd need to specify '.xml' in your document type column in order to extract the full-text keywords.  (You probably noticed this in the default definition for the doc_type column.)  You can query sys.fulltext_document_types to get a complete list of the types that can be full-text indexed. I also need to thank Hilary Cotter for giving me the original idea. I believe he used MSDN content in a full-text index for an article from waaaaaaaaaaay back, that I can't find now, and had forgotten about until just a few days ago.  He is also co-author of Pro Full-Text Search in SQL Server 2008, which I highly recommend.  He also has some FTS articles on Simple Talk: http://www.simple-talk.com/sql/learn-sql-server/sql-server-full-text-search-language-features/ http://www.simple-talk.com/sql/learn-sql-server/sql-server-full-text-search-language-features,-part-2/

    Read the article

  • How can unrealscript halt event handler execution after an arbitrary number of lines with no return or error?

    - by Dan Cowell
    I have created a class that extends TcpLink and is instantiated in a custom Kismet Sequence Action. It is being instantiated correctly and is making the GET HTTP request that I need it to (I have checked my access log in apache) and Apache is responding to the request with the appropriate content. The problem I have is that I'm using the event receive mode and it appears that somehow the handler for the Opened event is halted after a specific number of lines of code have executed. Here is my code for the Opened event: event Opened() { // A connection was established WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] event opened"); WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Sending simple HTTP query"); //The HTTP GET request //char(13) and char(10) are carrage returns and new lines requesttext = "userId="$userId$"&apartmentId="$apartmentId; SendText("GET /"$path$"?"$requesttext$" HTTP/1.0"); SendText(chr(13)$chr(10)); SendText("Host: "$TargetHost); SendText(chr(13)$chr(10)); SendText("Connection: Close"); SendText(chr(13)$chr(10)$chr(13)$chr(10)); //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Sent request: "$requesttext); //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] end HTTP query"); //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] LinkState: "$LinkState); //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] LinkMode: "$LinkMode); WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] ReceiveMode: "$ReceiveMode); WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Error: "$string(GetLastError())); } As you can see, a number of the Broadcast calls have been commented out. Initially, only the lines up to the Broadcast containing "[DNomad_TcpLinkClient] Sent request: " were being executed and none of the Broadcasts were commented out. After commenting out that line, the next Broadcast was successful and so on and so forth. As a test, I commented out the very first Broadcast to see if the connection closing had any effect: // A connection was established //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] event opened"); WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Sending simple HTTP query"); Upon doing that, an additional Broadcast at the end of the function executed. Thus the inference that there is an upper limit to the number of lines executed. Additionally, my ReceivedText handler is never called, despite Apache returning the correct HTTP 200 response with a body. My working hypothesis is that somehow after the Sequence Action finishes executing the garbage collector cleans up the TcpLinkClient instance. My biggest source of confusion with that is how on earth it does it during the execution of an event handler. Has anyone ever seen anything like this before? My full TcpLinkClient class is below: /* * TcpLinkClient based on an example usage of the TcpLink class by Michiel 'elmuerte' Hendriks for Epic Games, Inc. * */ class DNomad_TcpLinkClient extends TcpLink; var PlayerController PC; var string TargetHost; var int TargetPort; var string path; var string requesttext; var string userId; var string apartmentId; var string statusCode; var string responseData; event PostBeginPlay() { super.PostBeginPlay(); } function DoTcpLinkRequest(string uid, string id) //removes having to send a host { userId = uid; apartmentId = id; Resolve(targethost); } function string GetStatus() { return statusCode; } event Resolved( IpAddr Addr ) { // The hostname was resolved succefully WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] "$TargetHost$" resolved to "$ IpAddrToString(Addr)); // Make sure the correct remote port is set, resolving doesn't set // the port value of the IpAddr structure Addr.Port = TargetPort; //dont comment out this log because it rungs the function bindport WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Bound to port: "$ BindPort() ); if (!Open(Addr)) { WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Open failed"); } } event ResolveFailed() { WorldInfo.Game.Broadcast(self, "[TcpLinkClient] Unable to resolve "$TargetHost); // You could retry resolving here if you have an alternative // remote host. //send failed message to scaleform UI //JunHud(JunPlayerController(PC).myHUD).JunMovie.CallSetHTML("Failed"); } event Opened() { // A connection was established //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] event opened"); WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Sending simple HTTP query"); //The HTTP GET request //char(13) and char(10) are carrage returns and new lines requesttext = "userId="$userId$"&apartmentId="$apartmentId; SendText("GET /"$path$"?"$requesttext$" HTTP/1.0"); SendText(chr(13)$chr(10)); SendText("Host: "$TargetHost); SendText(chr(13)$chr(10)); SendText("Connection: Close"); SendText(chr(13)$chr(10)$chr(13)$chr(10)); //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Sent request: "$requesttext); //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] end HTTP query"); //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] LinkState: "$LinkState); //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] LinkMode: "$LinkMode); WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] ReceiveMode: "$ReceiveMode); WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Error: "$string(GetLastError())); } event Closed() { // In this case the remote client should have automatically closed // the connection, because we requested it in the HTTP request. WorldInfo.Game.Broadcast(self, "Connection closed."); // After the connection was closed we could establish a new // connection using the same TcpLink instance. } event ReceivedText( string Text ) { WorldInfo.Game.Broadcast(self, "Received Text: "$Text); //we dont want the header info, so we split the string after two new lines Text = Split(Text, chr(13)$chr(10)$chr(13)$chr(10), true); WorldInfo.Game.Broadcast(self, "Split Text: "$Text); statusCode = Text; } event ReceivedLine( string Line ) { WorldInfo.Game.Broadcast(self, "Received Line: "$Line); } event ReceivedBinary( int Count, byte B[255] ) { WorldInfo.Game.Broadcast(self, "Received Binary of length: "$Count); } defaultproperties { TargetHost="127.0.0.1" TargetPort=80 //default for HTTP LinkMode=MODE_Text ReceiveMode=RMODE_Event path = "dnomad/datafeed.php" userId = "0"; apartmentId = "0"; statusCode = ""; send = false; }

    Read the article

  • CodePlex Daily Summary for Monday, June 02, 2014

    CodePlex Daily Summary for Monday, June 02, 2014Popular ReleasesPortable Class Library for SQLite: Portable Class Library for SQLite - 3.8.4.4: This pull request from mattleibow addresses an issue with custom function creation (define functions in C# code and invoke them from SQLite as id they where regular SQL functions). Impact: Xamarin iOSTweetinvi a friendly Twitter C# API: Tweetinvi 0.9.3.x: Timelines- Added all the parameters available from the Timeline Endpoints in Tweetinvi. - This is available for HomeTimeline, UserTimeline, MentionsTimeline // Simple query var tweets = Timeline.GetHomeTimeline(); // Create a parameter for queries with specific parameters var timelineParameter = Timeline.GenerateHomeTimelineRequestParameter(); timelineParameter.ExcludeReplies = true; timelineParameter.TrimUser = true; var tweets = Timeline.GetHomeTimeline(timelineParameter); Tweets- Add mis...Sandcastle Help File Builder: Help File Builder and Tools v2014.5.31.0: General InformationIMPORTANT: On some systems, the content of the ZIP file is blocked and the installer may fail to run. Before extracting it, right click on the ZIP file, select Properties, and click on the Unblock button if it is present in the lower right corner of the General tab in the properties dialog. This release completes removal of the branding transformations and implements the new VS2013 presentation style that utilizes the new lightweight website format. Several breaking cha...Tooltip Web Preview: ToolTip Web Preview: Version 1.0Database Helper: Release 1.0.0.0: First Release of Database HelperCoMaSy: CoMaSy1.0.2: !Contact Management SystemImage View Slider: Image View Slider: This is a .NET component. We create this using VB.NET. Here you can use an Image Viewer with several properties to your application form. We wish somebody to improve freely. Try this out! Author : Steven Renaldo Antony Yustinus Arjuna Purnama Putra Andre Wijaya P Martin Lidau PBK GENAP 2014 - TI UKDWAspose for Apache POI: Missing Features of Apache POI WP - v 1.1: Release contain the Missing Features in Apache POI WP SDK in Comparison with Aspose.Words for dealing with Microsoft Word. What's New ?Following Examples: Insert Picture in Word Document Insert Comments Set Page Borders Mail Merge from XML Data Source Moving the Cursor Feedback and Suggestions Many more examples are yet to come here. Keep visiting us. Raise your queries and suggest more examples via Aspose Forums or via this social coding site.SEToolbox: 01.032.014 Release 1: Added fix when loading game Textures for icons causing 'Unable to read beyond the end of the stream'. Added new Resource Report, that displays all in game resources in a concise report. Added in temp directory cleaner, to keep excess files from building up. Fixed use of colors on the windows, to work better with desktop schemes. Adding base support for multilingual resources. This will allow loading of the Space Engineers resources to show localized names, and display localized date a...ClosedXML - The easy way to OpenXML: ClosedXML 0.71.2: More memory and performance improvements. Fixed an issue with pivot table field order.Vi-AIO SearchBar: Vi – AIO Search Bar: Version 1.0Top Verses ( Ayat Emas ): Binary Top Verses: This one is the bin folder of the component. the .dll component is inside.Traditional Calendar Component: Traditional Calender Converter: Duta Wacana Christian University This file containing Traditional Calendar Component and Demo Aplication that using Traditional Calendar Component. This component made with .NET Framework 4 and the programming language is C# .SQLSetupHelper: 1.0.0.0: First Stable Version of SQL SetupComposite Iconote: Composite Iconote: This is a composite has been made by Microsoft Visual Studio 2013. Requirement: To develop this composite or use this component in your application, your computer must have .NET framework 4.5 or newer.Magick.NET: Magick.NET 6.8.9.101: Magick.NET linked with ImageMagick 6.8.9.1. Breaking changes: - Int/short Set methods of WritablePixelCollection are now unsigned. - The Q16 build no longer uses HDRI, switch to the new Q16-HDRI build if you need HDRI.fnr.exe - Find And Replace Tool: 1.7: Bug fixes Refactored logic for encoding text values to command line to handle common edge cases where find/replace operation works in GUI but not in command line Fix for bug where selection in Encoding drop down was different when generating command line in some cases. It was reported in: https://findandreplace.codeplex.com/workitem/34 Fix for "Backslash inserted before dot in replacement text" reported here: https://findandreplace.codeplex.com/discussions/541024 Fix for finding replacing...VG-Ripper & PG-Ripper: VG-Ripper 2.9.59: changes NEW: Added Support for 'GokoImage.com' links NEW: Added Support for 'ViperII.com' links NEW: Added Support for 'PixxxView.com' links NEW: Added Support for 'ImgRex.com' links NEW: Added Support for 'PixLiv.com' links NEW: Added Support for 'imgsee.me' links NEW: Added Support for 'ImgS.it' linksToolbox for Dynamics CRM 2011/2013: XrmToolBox (v1.2014.5.28): XrmToolbox improvement XrmToolBox updates (v1.2014.5.28)Fix connecting to a connection with custom authentication without saved password Tools improvement New tool!Solution Components Mover (v1.2014.5.22) Transfer solution components from one solution to another one Import/Export NN relationships (v1.2014.3.7) Allows you to import and export many to many relationships Tools updatesAttribute Bulk Updater (v1.2014.5.28) Audit Center (v1.2014.5.28) View Layout Replicator (v1.2014.5.28) Scrip...Microsoft Ajax Minifier: Microsoft Ajax Minifier 5.10: Fix for Issue #20875 - echo switch doesn't work for CSS CSS should honor the SASS source-file comments JS should allow multi-line comment directivesNew Projects[ISEN] Rendu de projet Naughty3Dogs - Pong3D: Pong3D est un jeu qui reprend le principe classique du Pong en le portant dans un environnement 3D à l'aide du langage c# et du moteur Unity3DBootstrap for MVC: Bootstrap for MVC.F. A. Q. - Najczesciej zadawane pytania: FAQForuMvc: Technifutur short projecthomework456: no.iStoody: Studies organize solution, available through app for Windows and Windows Phone.liaoliao: ???????????Price Tracker: Allows a user to track prices based on parsed emailsRoslynEval: RoslynRx Hub: Rx Hub provides server side computation which initiate by subscriber requestSharepoint Online AppCache Reset: We are an IT resource company providing Virtual IT services and custom and opensource programs for everyday needs. UnitConversionLib : Smart Unit Conversion Library in C#: Conversion of units, arithmetic operation and parsing quantities with their units on run time. Smart unit converter and conversion lib for physical quantities,

    Read the article

  • Oracle Enterprise Manager Ops Center : Using Operational Profiles to Install Packages and other Content

    - by LeonShaner
    Oracle Enterprise Manager Ops Center provides numerous ways to deploy content, such as through OS Update Profiles, or as part of an OS Provisioning plan or combinations of those and other "Install Software" capabilities of Deployment Plans.  This short "how-to" blog will highlight an alternative way to deploy content using Operational Profiles. Usually we think of Operational Profiles as a way to execute a simple "one-time" script to perform a basic system administration function, which can optionally be based on user input; however, Operational Profiles can be much more powerful than that.  There is often more to performing an action than merely running a script -- sometimes configuration files, packages, binaries, and other scripts, etc. are needed to perform the action, and sometimes the user would like to leave such content on the system for later use. For shell scripts and other content written to be generic enough to work on any flavor of UNIX, converting the same scripts and configuration files into Solaris 10 SVR4 package, Solaris 11 IPS package, and/or a Linux RPM's might be seen as three times the work, for little appreciable gain.   That is where using an Operational Profile to deploy simple scripts and other generic content can be very helpful.  The approach is so powerful, that pretty much any kind of content can be deployed using an Operational Profile, provided the files involved are not overly large, and it is not necessary to convert the content into UNIX variant-specific formats. The basic formula for deploying content with an Operational Profile is as follows: Begin with a traditional script header, which is a UNIX shell script that will be responsible for decoding and extracting content, copying files into the right places, and executing any other scripts and commands needed to install and configure that content. Include steps to make the script platform-aware, to do the right thing for a given UNIX variant, or a "sorry" message if the operator has somehow tried to run the Operational Profile on a system where the script is not designed to run.  Ops Center can constrain execution by target type, so such checks at this level are an added safeguard, but also useful with the generic target type of "Operating System" where the admin wants the script to "do the right thing," whatever the UNIX variant. Include helpful output to show script progress, and any other informational messages that can help the admin determine what has gone wrong in the case of a problem in script execution.  Such messages will be shown in the job execution log. Include necessary "clean up" steps for normal and error exit conditions Set non-zero exit codes when appropriate -- a non-zero exit code will cause an Operational Profile job to be marked failed, which is the admin's cue to look into the job details for diagnostic messages in the output from the script. That first bullet deserves some explanation.  If Operational Profiles are usually simple "one-time" scripts and binary content is not allowed, then how does the actual content, packages, binaries, and other scripts get delivered along with the script?  More specifically, how does one include such content without needing to first create some kind of traditional package?   All that is required is to simply encode the content and append it to the end of the Operational Profile.  The header portion of the Operational Profile will need to contain the commands to decode the embedded content that has been appended to the bottom of the script.  The header code can do whatever else is needed, and finally clean up any intermediate files that were created during the decoding and extraction of the content. One way to encode binary and other content for inclusion in a script is to use the "uuencode" utility to convert the content into simple base64 ASCII text -- a form that is suitable to be appended to an Operational Profile.   The behavior of the "uudecode" utility is such that it will skip over any parts of the input that do not fit the uuencoded "begin" and "end" clauses.  For that reason, your header script will be skipped over, and uudecode will find your embedded content, that you will uuencode and paste at the end of the Operational Profile.  You can have as many "begin" / "end" clauses as you need -- just separate each embedded file by an empty line between "begin" and "end" clauses. Example:  Install SUNWsneep and set the system serial number Script:  deploySUNWsneep.sh ( <- right-click / save to download) Highlights: #!/bin/sh # Required variables: OC_SERIAL="$OC_SERIAL" # The user-supplied serial number for the asset ... Above is a good practice, showing right up front what kind of input the Operational Profile will require.   The right-hand side where $OC_SERIAL appears in this example will be filled in by Ops Center based on the user input at deployment time. The script goes on to restrict the use of the program to the intended OS type (Solaris 10 or older, in this example, but other content might be suitable for Solaris 11, or Linux -- it depends on the content and the script that will handle it). A temporary working directory is created, and then we have the command that decodes the embedded content from "self" which in scripting terms is $0 (a variable that expands to the name of the currently executing script): # Pass myself through uudecode, which will extract content to the current dir uudecode $0 At that point, whatever content was appended in uuencoded form at the end of the script has been written out to the current directory.  In this example that yields a file, SUNWsneep.7.0.zip, which the rest of the script proceeds to unzip, and pkgadd, followed by running "/opt/SUNWsneep/bin/sneep -s $OC_SERIAL" which is the command that stores the system serial for future use by other programs such as Explorer.   Don't get hung up on the example having used a pkgadd command.  The content started as a zip file and it could have been a tar.gz, or any other file.  This approach simply decodes the file.  The header portion of the script has to make sense of the file and do the right thing (e.g. it's up to you). The script goes on to clean up after itself, whether or not the above was successful.  Errors are echo'd by the script and a non-zero exit code is set where appropriate. Second to last, we have: # just in case, exit explicitly, so that uuencoded content will not cause error OPCleanUP exit # The rest of the script is ignored, except by uudecode # # UUencoded content follows # # e.g. for each file needed, #  $ uuencode -m {source} {source} > {target}.uu5 # then paste the {target}.uu5 files below # they will be extracted into the workding dir at $TDIR # The commentary above also describes how to encode the content. Finally we have the uuencoded content: begin-base64 444 SUNWsneep.7.0.zip UEsDBBQAAAAIAPsRy0Di3vnukAAAAMcAAAAKABUAcmVhZG1lLnR4dFVUCQADOqnVT7up ... VXgAAFBLBQYAAAAAAgACAJEAAADTNwEAAAA= ==== That last line of "====" is the base64 uuencode equivalent of a blank line, followed by "end" and as mentioned you can have as many begin/end clauses as you need.  Just separate each embedded file by a blank line after each ==== and before each begin-base64. Deploying the example Operational Profile looks like this (where I have pasted the system serial number into the required field): The job succeeded, but here is an example of the kind of diagnostic messages that the example script produces, and how Ops Center displays them in the job details: This same general approach could be used to deploy Explorer, and other useful utilities and scripts. Please let us know what you think?  Until next time...\Leon-- Leon Shaner | Senior IT/Product ArchitectSystems Management | Ops Center Engineering @ Oracle The views expressed on this [blog; Web site] are my own and do not necessarily reflect the views of Oracle. For more information, please go to Oracle Enterprise Manager  web page or  follow us at :  Twitter | Facebook | YouTube | Linkedin | Newsletter

    Read the article

  • PASS: The Budget Process

    - by Bill Graziano
    Every fiscal year PASS creates a detailed budget.  This helps us set priorities and communicate to our members what we’re going to do in the upcoming year.  You can review the current budget on the PASS Governance page.  That page currently requires you to login but I’m talking with HQ to see if there are any legal issues with opening that up. The Accounting Team The PASS accounting team is two people.  The Executive Vice-President of Finance (“EVP”) and the PASS Accounting Manager.  Sandy Cherry is the accounting manager and works at PASS HQ.  Sandy has been with PASS since we switched management companies in 2007.  Throughout this document when I talk about any actual work related to the budget that’s all Sandy :)  She’s the glue that gets us through this process.  Last year we went through 32 iterations of the budget before the Board approved so it’s a pretty busy time for her us – well, mostly her. Fiscal Year The PASS fiscal year runs from July 1st through June 30th the following year.  Right now we’re in fiscal year 2011.  Our 2010 Summit actually occurred in FY2011.  We switched to this schedule from a calendar year in 2006.  Our goal was to have the Summit occur early in our fiscal year.  That gives us the rest of the year to handle any significant financial impact from the Summit.  If registrations are down we can reduce spending.  If registrations are up we can decide how much to increase our reserves and how much to spend.  Keep in mind that the Summit is budgeted to generate 82% of our revenue this year.  How it performs has a significant impact on our financials.  The other benefit of this fiscal year is that it matches the Microsoft fiscal year.  We sign an annual sponsorship agreement with Microsoft and it’s very helpful that our fiscal years match. This year our budget process will probably start in earnest in March or April.  I’d like to be done in early June so we can publish before July 1st.  I was late publishing it this year and I’m trying not to repeat that. Our Budget Our actual budget is an Excel spreadsheet with 36 sheets.  We remove some of those when we publish it since they include salary information.  The budget is broken up into various portfolios or departments.  We have 20 portfolios.  They include chapters, marketing, virtual chapters, marketing, etc.  Ideally each portfolio is assigned to a Board member.  Each portfolio also typically has a staff person assigned to it.  Portfolios that aren’t assigned to a Board member are monitored by HQ and the ExecVP-Finance (me).  These are typically smaller portfolios such as deferred membership or Summit futures.  (More on those in a later post.)  All portfolios are reviewed by all Board members during the budget approval process, when interim financials are released internally and at year-end. The Process Our first step is to budget revenues.  The Board determines a target attendee number.  We have formulas based on historical performance that convert that to an overall attendee revenue number.  Other revenue projections (such as vendor sponsorships) come from different parts of the organization.  I hope to have another post with more details on how we project revenues. The next step is to budget expenses.  Board members fill out a sample spreadsheet with their budget for the year.  They can add line items and notes describing what the amounts are for.  Each Board portfolio typically has from 10 to 30 line items.  Any new initiatives they want to pursue needs to be budgeted.  The Summit operations budget is managed by HQ.  It includes the cost for food, electrical, internet, etc.  Most of these come from our estimate of attendees and our contract with the convention center.  During this process the Board can ask for more or less to be spent on various line items.  For example, if we weren’t happy with the Internet at the last Summit we can ask them to look into different options and/or increasing the budget.  HQ will also make adjustments to these numbers based on what they see at the events and the feedback we receive on the surveys. After we have all the initial estimates we start reviewing the entire budget.  It is sent out to the Board and we can see what each portfolio requested and what the overall profit and loss number is.  We usually start with too much in expenses and need to cut.  In years past the Board started haggling over these numbers as a group.  This past year they decided I should take a first cut and present them with a reasonable budget and a list of what I changed.  That worked well and I think we’ll continue to do that in the future. We go through a number of iterations on the budget.  If I remember correctly, we went through 32 iterations before we passed the budget.  At each iteration various revenue and expense numbers can change.  Keep in mind that the PASS budget has 200+ line items spread over 20 portfolios.  Many of these depend on other numbers.  For example, if we decide increase the projected attendees that cascades through our budget.  At each iteration we list what changed and the impact.  Ideally these discussions will take place at a face-to-face Board meeting.  Many of them also take place over the phone.  Board members explain any increase they are asking for while performing due diligence on other budget requests.  Eventually a budget emerges and is passed. Publishing After the budget is passed we create a version without the formulas and salaries for posting on the web site.  Sandy also creates some charts to help our members understand the budget.  The EVP writes a nice little letter describing some of the changes from last year’s budget.  You can see my letter and our budget on the PASS Governance page. And then, eight months later, we start all over again.

    Read the article

  • Why Is Vertical Resolution Monitor Resolution so Often a Multiple of 360?

    - by Jason Fitzpatrick
    Stare at a list of monitor resolutions long enough and you might notice a pattern: many of the vertical resolutions, especially those of gaming or multimedia displays, are multiples of 360 (720, 1080, 1440, etc.) But why exactly is this the case? Is it arbitrary or is there something more at work? Today’s Question & Answer session comes to us courtesy of SuperUser—a subdivision of Stack Exchange, a community-driven grouping of Q&A web sites. The Question SuperUser reader Trojandestroy recently noticed something about his display interface and needs answers: YouTube recently added 1440p functionality, and for the first time I realized that all (most?) vertical resolutions are multiples of 360. Is this just because the smallest common resolution is 480×360, and it’s convenient to use multiples? (Not doubting that multiples are convenient.) And/or was that the first viewable/conveniently sized resolution, so hardware (TVs, monitors, etc) grew with 360 in mind? Taking it further, why not have a square resolution? Or something else unusual? (Assuming it’s usual enough that it’s viewable). Is it merely a pleasing-the-eye situation? So why have the display be a multiple of 360? The Answer SuperUser contributor User26129 offers us not just an answer as to why the numerical pattern exists but a history of screen design in the process: Alright, there are a couple of questions and a lot of factors here. Resolutions are a really interesting field of psychooptics meeting marketing. First of all, why are the vertical resolutions on youtube multiples of 360. This is of course just arbitrary, there is no real reason this is the case. The reason is that resolution here is not the limiting factor for Youtube videos – bandwidth is. Youtube has to re-encode every video that is uploaded a couple of times, and tries to use as little re-encoding formats/bitrates/resolutions as possible to cover all the different use cases. For low-res mobile devices they have 360×240, for higher res mobile there’s 480p, and for the computer crowd there is 360p for 2xISDN/multiuser landlines, 720p for DSL and 1080p for higher speed internet. For a while there were some other codecs than h.264, but these are slowly being phased out with h.264 having essentially ‘won’ the format war and all computers being outfitted with hardware codecs for this. Now, there is some interesting psychooptics going on as well. As I said: resolution isn’t everything. 720p with really strong compression can and will look worse than 240p at a very high bitrate. But on the other side of the spectrum: throwing more bits at a certain resolution doesn’t magically make it better beyond some point. There is an optimum here, which of course depends on both resolution and codec. In general: the optimal bitrate is actually proportional to the resolution. So the next question is: what kind of resolution steps make sense? Apparently, people need about a 2x increase in resolution to really see (and prefer) a marked difference. Anything less than that and many people will simply not bother with the higher bitrates, they’d rather use their bandwidth for other stuff. This has been researched quite a long time ago and is the big reason why we went from 720×576 (415kpix) to 1280×720 (922kpix), and then again from 1280×720 to 1920×1080 (2MP). Stuff in between is not a viable optimization target. And again, 1440P is about 3.7MP, another ~2x increase over HD. You will see a difference there. 4K is the next step after that. Next up is that magical number of 360 vertical pixels. Actually, the magic number is 120 or 128. All resolutions are some kind of multiple of 120 pixels nowadays, back in the day they used to be multiples of 128. This is something that just grew out of LCD panel industry. LCD panels use what are called line drivers, little chips that sit on the sides of your LCD screen that control how bright each subpixel is. Because historically, for reasons I don’t really know for sure, probably memory constraints, these multiple-of-128 or multiple-of-120 resolutions already existed, the industry standard line drivers became drivers with 360 line outputs (1 per subpixel). If you would tear down your 1920×1080 screen, I would be putting money on there being 16 line drivers on the top/bottom and 9 on one of the sides. Oh hey, that’s 16:9. Guess how obvious that resolution choice was back when 16:9 was ‘invented’. Then there’s the issue of aspect ratio. This is really a completely different field of psychology, but it boils down to: historically, people have believed and measured that we have a sort of wide-screen view of the world. Naturally, people believed that the most natural representation of data on a screen would be in a wide-screen view, and this is where the great anamorphic revolution of the ’60s came from when films were shot in ever wider aspect ratios. Since then, this kind of knowledge has been refined and mostly debunked. Yes, we do have a wide-angle view, but the area where we can actually see sharply – the center of our vision – is fairly round. Slightly elliptical and squashed, but not really more than about 4:3 or 3:2. So for detailed viewing, for instance for reading text on a screen, you can utilize most of your detail vision by employing an almost-square screen, a bit like the screens up to the mid-2000s. However, again this is not how marketing took it. Computers in ye olden days were used mostly for productivity and detailed work, but as they commoditized and as the computer as media consumption device evolved, people didn’t necessarily use their computer for work most of the time. They used it to watch media content: movies, television series and photos. And for that kind of viewing, you get the most ‘immersion factor’ if the screen fills as much of your vision (including your peripheral vision) as possible. Which means widescreen. But there’s more marketing still. When detail work was still an important factor, people cared about resolution. As many pixels as possible on the screen. SGI was selling almost-4K CRTs! The most optimal way to get the maximum amount of pixels out of a glass substrate is to cut it as square as possible. 1:1 or 4:3 screens have the most pixels per diagonal inch. But with displays becoming more consumery, inch-size became more important, not amount of pixels. And this is a completely different optimization target. To get the most diagonal inches out of a substrate, you want to make the screen as wide as possible. First we got 16:10, then 16:9 and there have been moderately successful panel manufacturers making 22:9 and 2:1 screens (like Philips). Even though pixel density and absolute resolution went down for a couple of years, inch-sizes went up and that’s what sold. Why buy a 19″ 1280×1024 when you can buy a 21″ 1366×768? Eh… I think that about covers all the major aspects here. There’s more of course; bandwidth limits of HDMI, DVI, DP and of course VGA played a role, and if you go back to the pre-2000s, graphics memory, in-computer bandwdith and simply the limits of commercially available RAMDACs played an important role. But for today’s considerations, this is about all you need to know. Have something to add to the explanation? Sound off in the the comments. Want to read more answers from other tech-savvy Stack Exchange users? Check out the full discussion thread here.     

    Read the article

  • ODEE Green Field (Windows) Part 4 - Documaker

    - by AndyL-Oracle
    Welcome back! We're about nearing completion of our installation of Oracle Documaker Enterprise Edition ("ODEE") in a green field. In my previous post, I covered the installation of SOA Suite for WebLogic. Before that, I covered the installation of WebLogic, and Oracle 11g database - all of which constitute the prerequisites for installing ODEE. Naturally, if your environment already has a WebLogic server and Oracle database, then you can skip all those components and go straight for the heart of the installation of ODEE. The ODEE installation is comprised of two procedures, the first covers the installation, which is running the installer and answering some questions. This will lay down the files necessary to install into the tiers (e.g. database schemas, WebLogic domains, etcetera). The second procedure is to deploy the configuration files into the various components (e.g. deploy the database schemas, WebLogic domains, SOA composites, etcetera). I will segment my posts accordingly! Let's get started, shall we? Unpack the installation files into a temporary directory location. This should extract a zip file. Extract that zip file into the temporary directory location. Navigate to and execute the installer in Disk1/setup.exe. You may have to allow the program to run if User Account Control is enabled. Once the dialog below is displayed, click Next. Select your ODEE Home - inside this directory is where all the files will be deployed. For ease of support, I recommend using the default, however you can put this wherever you want. Click Next. Select the database type, database connection type – note that the database name should match the value used for the connection type (e.g. if using SID, then the name should be IDMAKER; if using ServiceName, the name should be “idmaker.us.oracle.com”). Verify whether or not you want to enable advanced compression. Note: if you are not licensed for Oracle 11g Advanced Compression option do not use this option! Terrible, terrible calamities will befall you if you do! Click Next. Enter the Documaker Admin user name (default "dmkr_admin" is recommended for support purposes) and set the password. Update the System name and ID (must be unique) if you want/need to - since this is a green field install you should be able to use the default System ID. The only time you'd change this is if you were, for some reason, installing a new ODEE system into an existing schema that already had a system. Click Next. Enter the Assembly Line user name (default "dmkr_asline" is recommended) and set the password. Update the Assembly Line name and ID (must be unique) if you want/need to - it's quite possible that at some point you will create another assembly line, in which case you have several methods of doing so. One is to re-run the installer, and in this case you would pick a different assembly line ID and name. Click Next. Note: you can set the DB folder if needed (typically you don’t – see ODEE Installation Guide for specifics. Select the appropriate Application Server type - in this case, our green field install is going to use WebLogic - set the username to weblogic (this is required) and specify your chosen password. This credential will be used to access the application server console/control panel. Keep in mind that there are specific criteria on password choices that are required by WebLogic, but are not enforced by the installer (e.g. must contain a number, must be of a certain length, etcetera). Choose a strong password. Set the connection information for the JMS server. Note that for the 12.3.x version, the installer creates a separate JVM (WebLogic managed server) that hosts the JMS server, whereas prior editions place the JMS server on the AdminServer.  You may also specify a separate URL to the JMS server in case you intend to move the JMS resources to a separate/different server (e.g. back to AdminServer). You'll need to provide a login principal and credentials - for simplicity I usually make this the same as the WebLogic domain user, however this is not a secure practice! Make your JMS principal different from the WebLogic principal and choose a strong password, then click Next. Specify the Hot Folder(s) (comma-delimited if more than one) - this is the directory/directories that is/are monitored by ODEE for jobs to process. Click Next. If you will be setting up an SMTP server for ODEE to send emails, you may configure the connection details here. The details required are simple: hostname, port, user/password, and the sender's address (e.g. emails will appear to be sent by the address shown here so if the recipient clicks "reply", this is where it will go). Click Next. If you will be using Oracle WebCenter:Content (formerly known as Oracle UCM) you can enable this option and set the endpoints/credentials here. If you aren't sure, select False - you can always go back and enable this later. I'm almost 76% certain there will be a post sometime in the future that details how to configure ODEE + WCC:C! Click Next. If you will be using Oracle UMS for sending MMS/text messages, you can enable and set the endpoints/credentials here. As with UCM, if you're not sure, don't enable it - you can always set it later. Click Next. On this screen you can change the endpoints for the Documaker Web Service (DWS), and the endpoints for approval processing in Documaker Interactive. The deployment process for ODEE will create 3 managed WebLogic servers for hosting various Documaker components (JMS, Interactive, DWS, Dashboard, Documaker Administrator, etcetera) and it will set the ports used for each of these services. In this screen you can change these values if you know how you want to deploy these managed servers - but for now we'll just accept the defaults. Click Next. Verify the installation details and click Install. You can save the installation into a response file if you need to (which might be useful if you want to rerun this installation in an unattended fashion). Allow the installation to progress... Click Next. You can save the response file if needed (e.g. in case you forgot to save it earlier!) Click Finish. That's it, you're done with the initial installation. Have a look around the ODEE_HOME that you just installed (remember we selected c:\oracle\odee_1?) and look at the files that are laid down. Don't change anything just yet! Stay tuned for the next segment where we complete and verify the installation. 

    Read the article

  • Projected Results

    - by Sylvie MacKenzie, PMP
    Excerpt from PROFIT - ORACLE - by Monica Mehta Yasser Mahmud has seen a revolution in project management over the past decade. During that time, the former Primavera product strategist (who joined Oracle when his company was acquired in 2008) has not only observed a transformation in the way IT systems support corporate projects but the role project portfolio management (PPM) plays in the enterprise. “15 years ago project management was the domain of project management office (PMO),” Mahmud recalls of earlier days. “But over the course of the past decade, we've seen it transform into a mission critical enterprise discipline, that has made Primavera indispensable in the board room. Now, as a senior manager, a board member, or a C-level executive you have direct and complete visibility into what’s kind of going on in the organization—at a level of detail that you're going to consume that information.” Now serving as Oracle’s vice president of product strategy and industry marketing, Mahmud shares his thoughts on how Oracle’s Primavera solutions have evolved and how best-in-class project portfolio management systems can help businesses stay competitive. Profit: What do you feel are the market dynamics that are changing project management today? Mahmud: First, the data explosion. We're generating data at twice the rate at which we can actually store it. The same concept applies for project-intensive organizations. A lot of data is gathered, but what are we really doing with it? Are we turning data into insight? Are we using that insight and turning it into foresight with analytics tools? This is a key driver that will separate the very good companies—the very competitive companies—from those that are not as competitive. Another trend is centered on the explosion of mobile computing. By the year 2013, an estimated 35 percent of the world’s workforce is going to be mobile. That’s one billion people. So the question is not if you're going to go mobile, it’s how fast you are going to go mobile. What kind of impact does that have on how the workforce participates in projects? What worked ten to fifteen years ago is not going to work today. It requires a real rethink around the interfaces and how data is actually presented. Profit: What is the role of project management in this new landscape? Mahmud: We recently conducted a PPM study with the Economist Intelligence Unit centered to determine how important project management is considered within organizations. Our target was primarily CFOs, CIOs, and senior managers and we discovered that while 95 percent of participants believed it critical to their business, only six percent were confident that projects were delivered on time and on budget. That’s a huge gap. Most organizations are looking for efficiency, especially in these volatile financial times. But senior management can’t keep track of every project in a large organization. As a result, executives are attempting to inventory the work being conducted under their watch. What is often needed is a very high-level assessment conducted at the board level to say, “Here are the 50 initiatives that we have underway. How do they line up with our strategic drivers?” This line of questioning can provide early warning that work and strategy are out of alignment; finding the gap between what the business needs to do and the actual performance scorecard. That’s low-hanging fruit for any executive looking to increase efficiency and save money. But it can only be obtained through proper assessment of existing projects—and you need a project system of record to get that done. Over the next decade or so, project management is going to transform into holistic work management. Business leaders will want make sure key projects align with corporate strategy, but also the ability to drill down into daily activity and smaller projects to make sure they line up as well. Keeping employees from working on tasks—even for a few hours—that don’t line up with corporate goals will, in many ways, become a competitive differentiator. Profit: How do all of these market challenges and shifting trends impact Oracle’s Primavera solutions and meeting customers’ needs? Mahmud: For Primavera, it’s a transformation from being a project management application to a PPM system in the enterprise. Also making that system a mission-critical application by connecting to other key applications within the ecosystem, such as the enterprise resource planning (ERP), supply chain, and CRM systems. Analytics have also become a huge component. Business analytics have made Oracle’s Primavera applications pertinent in the boardroom. Now, as a senior manager, a board member, a CXO, CIO, or CEO, you have direct visibility into what’s going on in the organization at a level that you're able to consume that information. In addition, all of this information pairs up really well with your financials and other data. Certainly, when you're an Oracle shop, you have that visibility that you didn’t have before from a project execution perspective. Profit: What new strategies and tools are being implemented to create a more efficient workplace for users? Mahmud: We believe very strongly that just because you call something an enterprise project portfolio management system doesn’t make it so—you have to get people to want to participate in the system. This can’t be mandated down from the top. It simply doesn’t work that way. A truly adoptable solution is one that makes it super easy for all types users to participate, by providing them interfaces where they live. Keeping that in mind, a major area of development has been alternative user interfaces. This is increasingly resulting in the creation of lighter weight, targeted interfaces such as iOS applications, and smartphones interfaces such as for iPhone and Android platform. Profit: How does this translate into the development of Oracle’s Primavera solutions? Mahmud: Let me give you a few examples. We recently announced the launch of our Primavera P6 Team Member application, which is a native iOS application for the iPhone. This interface makes it easier for team members to do their jobs quickly and effectively. Similarly, we introduced the Primavera analytics application, which can be consumed via mobile devices, and when married with Oracle Spatial capabilities, users can get a geographical view of what’s going on and which projects are occurring in various locations around the world. Lastly, we introduced advanced email integration that allows project team members to status work via E-mail. This functionality leverages the fact that users are in E-mail system throughout the day and allows them to status their work without the need to launch the Primavera application. It comes back to a mantra: provide as many alternative user interfaces as possible, so you can give people the ability to work, to participate, to raise issues, to create projects, in the places where they live. Do it in such a way that it’s non-intrusive, do it in such a way that it’s easy and intuitive and they can get it done in a short amount of time. If you do that, workers can get back to doing what they're actually getting paid for.

    Read the article

  • Completing install of ruby 1.9.3 with Ruby for for Mac OS X 10.7.5 Leopard, Xcode 4.5.2 -- problems with rvm pkg install openssl

    - by user1848361
    First, many thanks in advance for any help. I'm a complete novice with programming and I'm trying to get started with this Ruby on Rails tutorial (http://ruby.railstutorial.org/ruby-on-rails-tutorial-book?version=3.2) I have been trying figure this out for about 7 hours now and since I don't have any hair left to pull out I'm turning to these hallowed pages. I have searched for solutions here again and again. System: Mac OS X 10.7.5 Leopard, Xcode 4.5.2 I installed homebrew and have updated it multiple times I used homebrew to install rvm and have updated it multiple times I installed git The standard ruby on the system (checking with $ ruby -v) is 1.8.7 My problem is that every time I try to use rvm to install a new version of Ruby ($ rvm install 1.9.3) I get the following error: Ruby (and needed base gems) for your selection will be installed shortly. Before it happens, please read and execute the instructions below. Please use a separate terminal to execute any additional commands. Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: : I have performed $ brew install libksba and when I try to do it again it tells me that libksba is installed already. When I type "$ rvm requirements" I get: Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: Right now Ruby requires gcc to compile, but Xcode 4.2 and later no longer ship with gcc. Instead they ship with llvm-gcc (to which gcc is a symlink) and clang, neither of which are supported for building Ruby. Xcode 4.1 was the last version to ship gcc, which was /usr/bin/gcc-4.2. Xcode 4.1 and earlier: - Ruby will build fine. Xcode 4.2 and later (including Command Line Tools for Xcode): - If you have gcc-4.2 (and friends) from an earlier Xcode version, Ruby will build fine. - If you don't have gcc-4.2, you have two options to get it: * Install apple-gcc42 from Homebrew * Install osx-gcc-installer Homebrew: If you are using Homebrew, you can install the apple-gcc42 and required libraries from homebrew/dupes: brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Xcode 4.2+ install or/and Command Line Tools for Xcode is required to provide make and other tools. osx-gcc-installer: If you don't use Homebrew, you can download and install osx-gcc-installer: https://github.com/kennethreitz/osx-gcc-installer. Warning: Installing osx-gcc-installer on top of a recent Xcode is known to cause problems, so you must uninstall Xcode before installing osx-gcc-installer. Afterwards you may install Xcode 4.2+ or Command Line Tools for Xcode if you desire. ** NOTE: Currently, Node.js is having issues building with osx-gcc-installer. The only fix is to install Xcode over osx-gcc-installer. So I assume I have to do something with brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Everything seemed to work fine until "$ rvm pkg install openssl", which returns: Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log Johns-MacBook-Pro:~ thierinvestmentservices$ rvm pkg install openssl Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log make.log reads "[2012-11-23 13:15:28] make /Users/thierinvestmentservices/.rvm/scripts/functions/utility: line 116: make: command not found" and openssl.certs.log reads "[2012-11-23 14:04:04] update_openssl_certs update_openssl_certs () { ( chpwd_functions="" builtin cd $rvm_usr_path/ssl && command curl -O http://curl.haxx.se/ca/cacert.pem && mv cacert.pem cert.pem ) } current path: /Users/thierinvestmentservices command(1): update_openssl_certs /Users/thierinvestmentservices/.rvm/scripts/functions/pkg: line 205: cd: /Users/thierinvestmentservices/.rvm/usr/ssl: No such file or directory" At this point the letters might as well be wingdings I have no idea what is going on. I have tried to install rvm make with something I saw on one forum post but I got a bunch of warnings. If anyone has any suggestions I would be deeply grateful, I am completely in over my head,

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • MVC 3 Remote Validation jQuery error on submit

    - by Richard Reddy
    I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

    Read the article

  • ASP.Net MVC Interview Questions and Answers

    - by Samir R. Bhogayta
    About ASP.Net MVC The ASP.Net MVC is the framework provided by Microsoft that lets you develop the applications that follows the principles of Model-View-Controller (MVC) design pattern. The .Net programmers new to MVC thinks that it is similar to WebForms Model (Normal ASP.Net), but it is far different from the WebForms programming.  This article will tell you how to quick learn the basics of MVC along with some frequently asked interview questions and answers on ASP.Net MVC 1. What is ASP.Net MVC The ASP.Net MVC is the framework provided by Microsoft to achieve     separation of concerns that leads to easy maintainability of the     application. Model is supposed to handle data related activity View deals with user interface related work Controller is meant for managing the application flow by communicating between Model and View. Normal 0 false false false EN-US X-NONE X-NONE 2. Why to use ASP.Net MVC The strength of MVC (i.e. ASP.Net MVC) listed below will answer this question MVC reduces the dependency between the components; this makes your code more testable. MVC does not recommend use of server controls, hence the processing time required to generate HTML response is drastically reduced. The integration of java script libraries like jQuery, Microsoft MVC becomes easy as compared to Webforms approach. 3. What do you mean by Razor The Razor is the new View engine introduced in MVC 3.0. The View engine is responsible for processing the view files [e.g. .aspx, .cshtml] in order to generate HTML response. The previous versions of MVC were dependent on ASPX view engine.  4. Can we use ASPX view engine in latest versions of MVC Yes. The Recommended way is to prefer Razor View 5. What are the benefits of Razor View?      The syntax for server side code is simplified      The length of code is drastically reduced      Razor syntax is easy to learn and reduces the complexity Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;} 6. What is the extension of Razor View file? .cshtml (for c#) and .vbhtml (for vb) 7. How to create a Controller in MVC Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;} Create a simple class and extend it from Controller class. The bare minimum requirement for a class to become a controller is to inherit it from ControllerBase is the class that is required to inherit to create the controller but Controller class inherits from ControllerBase. 8. How to create an Action method in MVC Add a simple method inside a controller class with ActionResult return type. 9. How to access a view on the server    The browser generates the request in which the information like Controller name, Action Name and Parameters are provided, when server receives this URL it resolves the Name of Controller and Action, after that it calls the specified action with provided parameters. Action normally does some processing and returns the ViewResult by specifying the view name (blank name searches according to naming conventions).   10. What is the default Form method (i.e. GET, POST) for an action method GET. To change this you can add an action level attribute e.g [HttpPost] Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;} 11. What is a Filter in MVC? When user (browser) sends a request to server an action method of a controller gets invoked; sometimes you may require executing a custom code before or after action method gets invoked, this custom code is called as Filter. 12. What are the different types of Filters in MVC? a. Authorization filter b. Action filter c. Result filter d. Exception filter [Do not forget the order mentioned above as filters gets executed as per above mentioned sequence] 13. Explain the use of Filter with an example? Suppose you are working on a MVC application where URL is sent in an encrypted format instead of a plain text, once encrypted URL is received by server it will ignore action parameters because of URL encryption. To solve this issue you can create global action filter by overriding OnActionExecuting method of controller class, in this you can extract the action parameters from the encrypted URL and these parameters can be set on filterContext to send plain text parameters to the actions.     14. What is a HTML helper? A HTML helper is a method that returns string; return string usually is the HTML tag. The standard HTML helpers (e.g. Html.BeginForm(),Html.TextBox()) available in MVC are lightweight as it does not rely on event model or view state as that of in ASP.Net server controls.

    Read the article

  • Java Box Class: Unsolvable: aligning components to the left or right

    - by user323186
    I have been trying to left align buttons contained in a Box to the left, with no success. They align left alright, but for some reason dont shift all the way left as one would imagine. I attach the code below. Please try compiling it and see for yourself. Seems bizarre to me. Thanks, Eric import java.awt.Dimension; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.io.BufferedReader; import java.io.File; import java.io.FileNotFoundException; import java.io.FileReader; import java.io.IOException; import javax.swing.Box; import javax.swing.BoxLayout; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.JMenu; import javax.swing.JMenuBar; import javax.swing.JMenuItem; import javax.swing.JScrollPane; import javax.swing.JTextArea; public class MainGUI extends Box implements ActionListener{ //Create GUI Components Box centerGUI=new Box(BoxLayout.X_AXIS); Box bottomGUI=new Box(BoxLayout.X_AXIS); //centerGUI subcomponents JTextArea left=new JTextArea(), right=new JTextArea(); JScrollPane leftScrollPane = new JScrollPane(left), rightScrollPane = new JScrollPane(right); //bottomGUI subcomponents JButton encrypt=new JButton("Encrypt"), decrypt=new JButton("Decrypt"), close=new JButton("Close"), info=new JButton("Info"); //Create Menubar components JMenuBar menubar=new JMenuBar(); JMenu fileMenu=new JMenu("File"); JMenuItem open=new JMenuItem("Open"), save=new JMenuItem("Save"), exit=new JMenuItem("Exit"); int returnVal =0; public MainGUI(){ super(BoxLayout.Y_AXIS); initCenterGUI(); initBottomGUI(); initFileMenu(); add(centerGUI); add(bottomGUI); addActionListeners(); } private void addActionListeners() { open.addActionListener(this); save.addActionListener(this); exit.addActionListener(this); encrypt.addActionListener(this); decrypt.addActionListener(this); close.addActionListener(this); info.addActionListener(this); } private void initFileMenu() { fileMenu.add(open); fileMenu.add(save); fileMenu.add(exit); menubar.add(fileMenu); } public void initCenterGUI(){ centerGUI.add(leftScrollPane); centerGUI.add(rightScrollPane); } public void initBottomGUI(){ bottomGUI.setAlignmentX(LEFT_ALIGNMENT); //setBorder(BorderFactory.createLineBorder(Color.BLACK)); bottomGUI.add(encrypt); bottomGUI.add(decrypt); bottomGUI.add(close); bottomGUI.add(info); } @Override public void actionPerformed(ActionEvent arg0) { // find source of the action Object source=arg0.getSource(); //if action is of such a type do the corresponding action if(source==close){ kill(); } else if(source==open){ //CHOOSE FILE File file1 =chooseFile(); String input1=readToString(file1); System.out.println(input1); left.setText(input1); } else if(source==decrypt){ //decrypt everything in Right Panel and output in left panel decrypt(); } else if(source==encrypt){ //encrypt everything in left panel and output in right panel encrypt(); } else if(source==info){ //show contents of info file in right panel doInfo(); } else { System.out.println("Error"); //throw new UnimplementedActionException(); } } private void doInfo() { // TODO Auto-generated method stub } private void encrypt() { // TODO Auto-generated method stub } private void decrypt() { // TODO Auto-generated method stub } private String readToString(File file) { FileReader fr = null; try { fr = new FileReader(file); } catch (FileNotFoundException e1) { e1.printStackTrace(); } BufferedReader br=new BufferedReader(fr); String line = null; try { line = br.readLine(); } catch (IOException e) { e.printStackTrace(); } String input=""; while(line!=null){ input=input+"\n"+line; try { line=br.readLine(); } catch (IOException e) { e.printStackTrace(); } } return input; } private File chooseFile() { //Create a file chooser final JFileChooser fc = new JFileChooser(); returnVal = fc.showOpenDialog(fc); return fc.getSelectedFile(); } private void kill() { System.exit(0); } public static void main(String[] args) { // TODO Auto-generated method stub MainGUI test=new MainGUI(); JFrame f=new JFrame("Tester"); f.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); f.setJMenuBar(test.menubar); f.setPreferredSize(new Dimension(600,400)); //f.setUndecorated(true); f.add(test); f.pack(); f.setVisible(true); } }

    Read the article

  • Processing Kinect v2 Color Streams in Parallel

    - by Chris Gardner
    Originally posted on: http://geekswithblogs.net/freestylecoding/archive/2014/08/20/processing-kinect-v2-color-streams-in-parallel.aspxProcessing Kinect v2 Color Streams in Parallel I've really been enjoying being a part of the Kinect for Windows Developer's Preview. The new hardware has some really impressive capabilities. However, with great power comes great system specs. Unfortunately, my little laptop that could is not 100% up to the task; I've had to get a little creative. The most disappointing thing I've run into is that I can't always cleanly display the color camera stream in managed code. I managed to strip the code down to what I believe is the bear minimum: using( ColorFrame _ColorFrame = e.FrameReference.AcquireFrame() ) { if( null == _ColorFrame ) return;   BitmapToDisplay.Lock(); _ColorFrame.CopyConvertedFrameDataToIntPtr( BitmapToDisplay.BackBuffer, Convert.ToUInt32( BitmapToDisplay.BackBufferStride * BitmapToDisplay.PixelHeight ), ColorImageFormat.Bgra ); BitmapToDisplay.AddDirtyRect( new Int32Rect( 0, 0, _ColorFrame.FrameDescription.Width, _ColorFrame.FrameDescription.Height ) ); BitmapToDisplay.Unlock(); } With this snippet, I'm placing the converted Bgra32 color stream directly on the BackBuffer of the WriteableBitmap. This gives me pretty smooth playback, but I still get the occasional freeze for half a second. After a bit of profiling, I discovered there were a few problems. The first problem is the size of the buffer along with the conversion on the buffer. At this time, the raw image format of the data from the Kinect is Yuy2. This is great for direct video processing. It would be ideal if I had a WriteableVideo object in WPF. However, this is not the case. Further digging led me to the real problem. It appears that the SDK is converting the input serially. Let's think about this for a second. The color camera is a 1080p camera. As we should all know, this give us a native resolution of 1920 x 1080. This produces 2,073,600 pixels. Yuy2 uses 4 bytes per 2 pixel, for a buffer size of 4,147,200 bytes. Bgra32 uses 4 bytes per pixel, for a buffer size of 8,294,400 bytes. The SDK appears to be doing this on one thread. I started wondering if I chould do this better myself. I mean, I have 8 cores in my system. Why can't I use them all? The first problem is converting a Yuy2 frame into a Bgra32 frame. It is NOT trivial. I spent a day of research of just how to do this. In the end, I didn't even produce the best algorithm possible, but it did work. After I managed to get that to work, I knew my next step was the get the conversion operation off the UI Thread. This was a simple process of throwing the work into a Task. Of course, this meant I had to marshal the final write to the WriteableBitmap back to the UI thread. Finally, I needed to vectorize the operation so I could run it safely in parallel. This was, mercifully, not quite as hard as I thought it would be. I had my loop return an index to a pair of pixels. From there, I had to tell the loop to do everything for this pair of pixels. If you're wondering why I did it for pairs of pixels, look back above at the specification for the Yuy2 format. I won't go into full detail on why each 4 bytes contains 2 pixels of information, but rest assured that there is a reason why the format is described in that way. The first working attempt at this algorithm successfully turned my poor laptop into a space heater. I very quickly brought and maintained all 8 cores up to about 97% usage. That's when I remembered that obscure option in the Task Parallel Library where you could limit the amount of parallelism used. After a little trial and error, I discovered 4 parallel tasks was enough for most cases. This yielded the follow code: private byte ClipToByte( int p_ValueToClip ) { return Convert.ToByte( ( p_ValueToClip < byte.MinValue ) ? byte.MinValue : ( ( p_ValueToClip > byte.MaxValue ) ? byte.MaxValue : p_ValueToClip ) ); }   private void ColorFrameArrived( object sender, ColorFrameArrivedEventArgs e ) { if( null == e.FrameReference ) return;   // If you do not dispose of the frame, you never get another one... using( ColorFrame _ColorFrame = e.FrameReference.AcquireFrame() ) { if( null == _ColorFrame ) return;   byte[] _InputImage = new byte[_ColorFrame.FrameDescription.LengthInPixels * _ColorFrame.FrameDescription.BytesPerPixel]; byte[] _OutputImage = new byte[BitmapToDisplay.BackBufferStride * BitmapToDisplay.PixelHeight]; _ColorFrame.CopyRawFrameDataToArray( _InputImage );   Task.Factory.StartNew( () => { ParallelOptions _ParallelOptions = new ParallelOptions(); _ParallelOptions.MaxDegreeOfParallelism = 4;   Parallel.For( 0, Sensor.ColorFrameSource.FrameDescription.LengthInPixels / 2, _ParallelOptions, ( _Index ) => { // See http://msdn.microsoft.com/en-us/library/windows/desktop/dd206750(v=vs.85).aspx int _Y0 = _InputImage[( _Index << 2 ) + 0] - 16; int _U = _InputImage[( _Index << 2 ) + 1] - 128; int _Y1 = _InputImage[( _Index << 2 ) + 2] - 16; int _V = _InputImage[( _Index << 2 ) + 3] - 128;   byte _R = ClipToByte( ( 298 * _Y0 + 409 * _V + 128 ) >> 8 ); byte _G = ClipToByte( ( 298 * _Y0 - 100 * _U - 208 * _V + 128 ) >> 8 ); byte _B = ClipToByte( ( 298 * _Y0 + 516 * _U + 128 ) >> 8 );   _OutputImage[( _Index << 3 ) + 0] = _B; _OutputImage[( _Index << 3 ) + 1] = _G; _OutputImage[( _Index << 3 ) + 2] = _R; _OutputImage[( _Index << 3 ) + 3] = 0xFF; // A   _R = ClipToByte( ( 298 * _Y1 + 409 * _V + 128 ) >> 8 ); _G = ClipToByte( ( 298 * _Y1 - 100 * _U - 208 * _V + 128 ) >> 8 ); _B = ClipToByte( ( 298 * _Y1 + 516 * _U + 128 ) >> 8 );   _OutputImage[( _Index << 3 ) + 4] = _B; _OutputImage[( _Index << 3 ) + 5] = _G; _OutputImage[( _Index << 3 ) + 6] = _R; _OutputImage[( _Index << 3 ) + 7] = 0xFF; } );   Application.Current.Dispatcher.Invoke( () => { BitmapToDisplay.WritePixels( new Int32Rect( 0, 0, Sensor.ColorFrameSource.FrameDescription.Width, Sensor.ColorFrameSource.FrameDescription.Height ), _OutputImage, BitmapToDisplay.BackBufferStride, 0 ); } ); } ); } } This seemed to yield a results I wanted, but there was still the occasional stutter. This lead to what I realized was the second problem. There is a race condition between the UI Thread and me locking the WriteableBitmap so I can write the next frame. Again, I'm writing approximately 8MB to the back buffer. Then, I started thinking I could cheat. The Kinect is running at 30 frames per second. The WPF UI Thread runs at 60 frames per second. This made me not feel bad about exploiting the Composition Thread. I moved the bulk of the code from the FrameArrived handler into CompositionTarget.Rendering. Once I was in there, I polled from a frame, and rendered it if it existed. Since, in theory, I'm only killing the Composition Thread every other hit, I decided I was ok with this for cases where silky smooth video performance REALLY mattered. This ode looked like this: private byte ClipToByte( int p_ValueToClip ) { return Convert.ToByte( ( p_ValueToClip < byte.MinValue ) ? byte.MinValue : ( ( p_ValueToClip > byte.MaxValue ) ? byte.MaxValue : p_ValueToClip ) ); }   void CompositionTarget_Rendering( object sender, EventArgs e ) { using( ColorFrame _ColorFrame = FrameReader.AcquireLatestFrame() ) { if( null == _ColorFrame ) return;   byte[] _InputImage = new byte[_ColorFrame.FrameDescription.LengthInPixels * _ColorFrame.FrameDescription.BytesPerPixel]; byte[] _OutputImage = new byte[BitmapToDisplay.BackBufferStride * BitmapToDisplay.PixelHeight]; _ColorFrame.CopyRawFrameDataToArray( _InputImage );   ParallelOptions _ParallelOptions = new ParallelOptions(); _ParallelOptions.MaxDegreeOfParallelism = 4;   Parallel.For( 0, Sensor.ColorFrameSource.FrameDescription.LengthInPixels / 2, _ParallelOptions, ( _Index ) => { // See http://msdn.microsoft.com/en-us/library/windows/desktop/dd206750(v=vs.85).aspx int _Y0 = _InputImage[( _Index << 2 ) + 0] - 16; int _U = _InputImage[( _Index << 2 ) + 1] - 128; int _Y1 = _InputImage[( _Index << 2 ) + 2] - 16; int _V = _InputImage[( _Index << 2 ) + 3] - 128;   byte _R = ClipToByte( ( 298 * _Y0 + 409 * _V + 128 ) >> 8 ); byte _G = ClipToByte( ( 298 * _Y0 - 100 * _U - 208 * _V + 128 ) >> 8 ); byte _B = ClipToByte( ( 298 * _Y0 + 516 * _U + 128 ) >> 8 );   _OutputImage[( _Index << 3 ) + 0] = _B; _OutputImage[( _Index << 3 ) + 1] = _G; _OutputImage[( _Index << 3 ) + 2] = _R; _OutputImage[( _Index << 3 ) + 3] = 0xFF; // A   _R = ClipToByte( ( 298 * _Y1 + 409 * _V + 128 ) >> 8 ); _G = ClipToByte( ( 298 * _Y1 - 100 * _U - 208 * _V + 128 ) >> 8 ); _B = ClipToByte( ( 298 * _Y1 + 516 * _U + 128 ) >> 8 );   _OutputImage[( _Index << 3 ) + 4] = _B; _OutputImage[( _Index << 3 ) + 5] = _G; _OutputImage[( _Index << 3 ) + 6] = _R; _OutputImage[( _Index << 3 ) + 7] = 0xFF; } );   BitmapToDisplay.WritePixels( new Int32Rect( 0, 0, Sensor.ColorFrameSource.FrameDescription.Width, Sensor.ColorFrameSource.FrameDescription.Height ), _OutputImage, BitmapToDisplay.BackBufferStride, 0 ); } }

    Read the article

  • In a SQL XDL File, how do I read the waitresource attribute on process nodes which are deadlocking?

    - by skimania
    On SQL Server 2005, I'm getting a deadlock when updating two different keys in the same table. note from below that these two waitresources have the same beginning part, but different ending parts. waitresource="KEY: 6:72057594090487808 (d900ed5a6cc6)" and waitresource="KEY: 6:72057594090487808 (d900fb5261bb)" These two keys are locking, and I need to figure out why. The question: If the values in parenthesis are different, why are the first half of the key's the same? <deadlock-list> <deadlock victim="processffffffff8f5863e8"> <process-list> <process id="processaf02f8" taskpriority="0" logused="0" waitresource="KEY: 6:72057594090487808 (d900fb5261bb)" waittime="2281" ownerId="1370264705" transactionname="user_transaction" lasttranstarted="2010-06-17T00:35:25.483" XDES="0x69453a70" lockMode="U" schedulerid="3" kpid="7624" status="suspended" spid="339" sbid="0" ecid="0" priority="0" transcount="2" lastbatchstarted="2010-06-17T00:35:25.483" lastbatchcompleted="2010-06-17T00:35:25.483" clientapp=".Net SqlClient Data Provider" hostname="RISKBBG_VM" hostpid="5848" loginname="RiskOpt" isolationlevel="read committed (2)" xactid="1370264705" currentdb="6" lockTimeout="4294967295" clientoption1="671088672" clientoption2="128056"> <executionStack> <frame procname="MKP_RISKDB.dbo.MarketDataCurrentRtUpload" line="14" stmtstart="840" stmtend="1220" sqlhandle="0x03000600005f9d24c8878f00849d00000100000000000000"> UPDATE c WITH (ROWLOCK) SET LastUpdate = t.LastUpdate, Value = t.Value, Source = t.Source FROM MarketDataCurrent c INNER JOIN #TEMPTABLE2 t ON c.MDID = t.mdid; -- Insert new MDID </frame> <frame procname="adhoc" line="1" sqlhandle="0x010006004a58132228bf8d73000000000000000000000000"> MarketDataCurrentBlbgRtUpload </frame> </executionStack> <inputbuf> MarketDataCurrentBlbgRtUpload </inputbuf> </process> <process id="processffffffff8f5863e8" taskpriority="0" logused="0" waitresource="KEY: 6:72057594090487808 (d900ed5a6cc6)" waittime="2281" ownerId="1370264646" transactionname="user_transaction" lasttranstarted="2010-06-17T00:35:25.450" XDES="0x1cb72be8" lockMode="U" schedulerid="5" kpid="1880" status="suspended" spid="287" sbid="0" ecid="0" priority="0" transcount="2" lastbatchstarted="2010-06-17T00:35:25.450" lastbatchcompleted="2010-06-17T00:35:25.450" clientapp=".Net SqlClient Data Provider" hostname="RISKAPPS_VM" hostpid="1424" loginname="RiskOpt" isolationlevel="read committed (2)" xactid="1370264646" currentdb="6" lockTimeout="4294967295" clientoption1="671088672" clientoption2="128056"> <executionStack> <frame procname="MKP_RISKDB.dbo.MarketDataCurrent_BulkUpload" line="28" stmtstart="1062" stmtend="1720" sqlhandle="0x03000600a28e5e4ef4fd8e00849d00000100000000000000"> UPDATE c WITH (ROWLOCK) SET LastUpdate = getdate(), Value = t.Value, Source = @source FROM MarketDataCurrent c INNER JOIN #MDTUP t ON c.MDID = t.mdid WHERE c.lastUpdate &lt; @updateTime and c.mdid not in (select mdid from MarketData where BloombergTicker is not null and PriceSource like &apos;Live.%&apos;) and c.value &lt;&gt; t.value </frame> <frame procname="adhoc" line="1" stmtstart="88" sqlhandle="0x01000600c1653d0598706ca7000000000000000000000000"> exec MarketDataCurrent_BulkUpload @clearBefore, @source </frame> <frame procname="unknown" line="1" sqlhandle="0x000000000000000000000000000000000000000000000000"> unknown </frame> </executionStack> <inputbuf> (@clearBefore datetime,@source nvarchar(10))exec MarketDataCurrent_BulkUpload @clearBefore, @source </inputbuf> </process> </process-list> <resource-list> <keylock hobtid="72057594090487808" dbid="6" objectname="MKP_RISKDB.dbo.MarketDataCurrent" indexname="PK_MarketDataCurrent" id="lock64ac7940" mode="U" associatedObjectId="72057594090487808"> <owner-list> <owner id="processffffffff8f5863e8" mode="U"/> </owner-list> <waiter-list> <waiter id="processaf02f8" mode="U" requestType="wait"/> </waiter-list> </keylock> <keylock hobtid="72057594090487808" dbid="6" objectname="MKP_RISKDB.dbo.MarketDataCurrent" indexname="PK_MarketDataCurrent" id="lockffffffffb8d2dd40" mode="U" associatedObjectId="72057594090487808"> <owner-list> <owner id="processaf02f8" mode="U"/> </owner-list> <waiter-list> <waiter id="processffffffff8f5863e8" mode="U" requestType="wait"/> </waiter-list> </keylock> </resource-list> </deadlock> </deadlock-list>

    Read the article

  • Setting up Mono/ASP.NET 4.0 on Apache2/Ubuntu: Virtual hosts?

    - by Dave
    I'm attempting to setup Mono/ASP.NET 4.0 on my Apache server (which is running on Ubuntu). Thus far, I've been following a few tutorials/scripts supplied here, and here. As of now: Apache 2.2 is installed (accessible via 'localhost') Mono 2.10.5 is installed However, I'm struggling to configure Apache correctly... apparently the Virtual Host setting isn't doing its job and invoking the mod_mono plugin, nor is it even pulling source from the proper directory. While the Virtual Host setting points to '\srv\www\localhost', it clearly is pulling content instead from 'var/www/', which I've found is the default DocumentRoot for virtual hosts. I can confirm: "/opt/mono-2.10/bin/mod-mono-server4" exists. Virtual hosts file is being read, since undoing the comment in the main httpd.conf changed the root directory from 'htdocs' to 'var/www/' The Mono installation is at least semi-capable of running ASP 4.0, as evidenced by running XSP, navigating to 0.0.0.0:8080/ and getting an ASP.NET style error page with "Mono ASP 4.0.x" at the bottom. Can anyone point out how to fix these configurations and get Mono linked up with Apache? Here are my configs and relevant information: /usr/local/apache2/conf/httpd.conf: # # This is the main Apache HTTP server configuration file. It contains the # configuration directives that give the server its instructions. # See <URL:http://httpd.apache.org/docs/2.2> for detailed information. # In particular, see # <URL:http://httpd.apache.org/docs/2.2/mod/directives.html> # for a discussion of each configuration directive. # # Do NOT simply read the instructions in here without understanding # what they do. They're here only as hints or reminders. If you are unsure # consult the online docs. You have been warned. # # Configuration and logfile names: If the filenames you specify for many # of the server's control files begin with "/" (or "drive:/" for Win32), the # server will use that explicit path. If the filenames do *not* begin # with "/", the value of ServerRoot is prepended -- so "logs/foo_log" # with ServerRoot set to "/usr/local/apache2" will be interpreted by the # server as "/usr/local/apache2/logs/foo_log". # # ServerRoot: The top of the directory tree under which the server's # configuration, error, and log files are kept. # # Do not add a slash at the end of the directory path. If you point # ServerRoot at a non-local disk, be sure to point the LockFile directive # at a local disk. If you wish to share the same ServerRoot for multiple # httpd daemons, you will need to change at least LockFile and PidFile. # ServerRoot "/usr/local/apache2" # # Listen: Allows you to bind Apache to specific IP addresses and/or # ports, instead of the default. See also the <VirtualHost> # directive. # # Change this to Listen on specific IP addresses as shown below to # prevent Apache from glomming onto all bound IP addresses. # #Listen 12.34.56.78:80 Listen 80 # # Dynamic Shared Object (DSO) Support # # To be able to use the functionality of a module which was built as a DSO you # have to place corresponding `LoadModule' lines at this location so the # directives contained in it are actually available _before_ they are used. # Statically compiled modules (those listed by `httpd -l') do not need # to be loaded here. # # Example: # LoadModule foo_module modules/mod_foo.so # <IfModule !mpm_netware_module> <IfModule !mpm_winnt_module> # # If you wish httpd to run as a different user or group, you must run # httpd as root initially and it will switch. # # User/Group: The name (or #number) of the user/group to run httpd as. # It is usually good practice to create a dedicated user and group for # running httpd, as with most system services. # User daemon Group daemon </IfModule> </IfModule> # 'Main' server configuration # # The directives in this section set up the values used by the 'main' # server, which responds to any requests that aren't handled by a # <VirtualHost> definition. These values also provide defaults for # any <VirtualHost> containers you may define later in the file. # # All of these directives may appear inside <VirtualHost> containers, # in which case these default settings will be overridden for the # virtual host being defined. # # # ServerAdmin: Your address, where problems with the server should be # e-mailed. This address appears on some server-generated pages, such # as error documents. e.g. [email protected] # ServerAdmin david@localhost # # ServerName gives the name and port that the server uses to identify itself. # This can often be determined automatically, but we recommend you specify # it explicitly to prevent problems during startup. # # If your host doesn't have a registered DNS name, enter its IP address here. # ServerName localhost:80 # # DocumentRoot: The directory out of which you will serve your # documents. By default, all requests are taken from this directory, but # symbolic links and aliases may be used to point to other locations. # DocumentRoot "/usr/local/apache2/htdocs" # # Each directory to which Apache has access can be configured with respect # to which services and features are allowed and/or disabled in that # directory (and its subdirectories). # # First, we configure the "default" to be a very restrictive set of # features. # <Directory /> Options FollowSymLinks AllowOverride None Order deny,allow Deny from all </Directory> # # Note that from this point forward you must specifically allow # particular features to be enabled - so if something's not working as # you might expect, make sure that you have specifically enabled it # below. # # # This should be changed to whatever you set DocumentRoot to. # <Directory "/usr/local/apache2/htdocs"> # # Possible values for the Options directive are "None", "All", # or any combination of: # Indexes Includes FollowSymLinks SymLinksifOwnerMatch ExecCGI MultiViews # # Note that "MultiViews" must be named *explicitly* --- "Options All" # doesn't give it to you. # # The Options directive is both complicated and important. Please see # http://httpd.apache.org/docs/2.2/mod/core.html#options # for more information. # Options Indexes FollowSymLinks # # AllowOverride controls what directives may be placed in .htaccess files. # It can be "All", "None", or any combination of the keywords: # Options FileInfo AuthConfig Limit # AllowOverride None # # Controls who can get stuff from this server. # Order allow,deny Allow from all </Directory> # # DirectoryIndex: sets the file that Apache will serve if a directory # is requested. # <IfModule dir_module> DirectoryIndex index.html </IfModule> # # The following lines prevent .htaccess and .htpasswd files from being # viewed by Web clients. # <FilesMatch "^\.ht"> Order allow,deny Deny from all Satisfy All </FilesMatch> # # ErrorLog: The location of the error log file. # If you do not specify an ErrorLog directive within a <VirtualHost> # container, error messages relating to that virtual host will be # logged here. If you *do* define an error logfile for a <VirtualHost> # container, that host's errors will be logged there and not here. # ErrorLog "logs/error_log" # # LogLevel: Control the number of messages logged to the error_log. # Possible values include: debug, info, notice, warn, error, crit, # alert, emerg. # LogLevel warn <IfModule log_config_module> # # The following directives define some format nicknames for use with # a CustomLog directive (see below). # LogFormat "%h %l %u %t \"%r\" %>s %b \"%{Referer}i\" \"%{User-Agent}i\"" combined LogFormat "%h %l %u %t \"%r\" %>s %b" common <IfModule logio_module> # You need to enable mod_logio.c to use %I and %O LogFormat "%h %l %u %t \"%r\" %>s %b \"%{Referer}i\" \"%{User-Agent}i\" %I %O" combinedio </IfModule> # # The location and format of the access logfile (Common Logfile Format). # If you do not define any access logfiles within a <VirtualHost> # container, they will be logged here. Contrariwise, if you *do* # define per-<VirtualHost> access logfiles, transactions will be # logged therein and *not* in this file. # CustomLog "logs/access_log" common # # If you prefer a logfile with access, agent, and referer information # (Combined Logfile Format) you can use the following directive. # #CustomLog "logs/access_log" combined </IfModule> <IfModule alias_module> # # Redirect: Allows you to tell clients about documents that used to # exist in your server's namespace, but do not anymore. The client # will make a new request for the document at its new location. # Example: # Redirect permanent /foo http://www.example.com/bar # # Alias: Maps web paths into filesystem paths and is used to # access content that does not live under the DocumentRoot. # Example: # Alias /webpath /full/filesystem/path # # If you include a trailing / on /webpath then the server will # require it to be present in the URL. You will also likely # need to provide a <Directory> section to allow access to # the filesystem path. # # ScriptAlias: This controls which directories contain server scripts. # ScriptAliases are essentially the same as Aliases, except that # documents in the target directory are treated as applications and # run by the server when requested rather than as documents sent to the # client. The same rules about trailing "/" apply to ScriptAlias # directives as to Alias. # ScriptAlias /cgi-bin/ "/usr/local/apache2/cgi-bin/" </IfModule> <IfModule cgid_module> # # ScriptSock: On threaded servers, designate the path to the UNIX # socket used to communicate with the CGI daemon of mod_cgid. # #Scriptsock logs/cgisock </IfModule> # # "/usr/local/apache2/cgi-bin" should be changed to whatever your ScriptAliased # CGI directory exists, if you have that configured. # <Directory "/usr/local/apache2/cgi-bin"> AllowOverride None Options None Order allow,deny Allow from all </Directory> # # DefaultType: the default MIME type the server will use for a document # if it cannot otherwise determine one, such as from filename extensions. # If your server contains mostly text or HTML documents, "text/plain" is # a good value. If most of your content is binary, such as applications # or images, you may want to use "application/octet-stream" instead to # keep browsers from trying to display binary files as though they are # text. # DefaultType text/plain <IfModule mime_module> # # TypesConfig points to the file containing the list of mappings from # filename extension to MIME-type. # TypesConfig conf/mime.types # # AddType allows you to add to or override the MIME configuration # file specified in TypesConfig for specific file types. # #AddType application/x-gzip .tgz # # AddEncoding allows you to have certain browsers uncompress # information on the fly. Note: Not all browsers support this. # #AddEncoding x-compress .Z #AddEncoding x-gzip .gz .tgz # # If the AddEncoding directives above are commented-out, then you # probably should define those extensions to indicate media types: # AddType application/x-compress .Z AddType application/x-gzip .gz .tgz # # AddHandler allows you to map certain file extensions to "handlers": # actions unrelated to filetype. These can be either built into the server # or added with the Action directive (see below) # # To use CGI scripts outside of ScriptAliased directories: # (You will also need to add "ExecCGI" to the "Options" directive.) # #AddHandler cgi-script .cgi # For type maps (negotiated resources): #AddHandler type-map var # # Filters allow you to process content before it is sent to the client. # # To parse .shtml files for server-side includes (SSI): # (You will also need to add "Includes" to the "Options" directive.) # #AddType text/html .shtml #AddOutputFilter INCLUDES .shtml </IfModule> # # The mod_mime_magic module allows the server to use various hints from the # contents of the file itself to determine its type. The MIMEMagicFile # directive tells the module where the hint definitions are located. # #MIMEMagicFile conf/magic # # Customizable error responses come in three flavors: # 1) plain text 2) local redirects 3) external redirects # # Some examples: #ErrorDocument 500 "The server made a boo boo." #ErrorDocument 404 /missing.html #ErrorDocument 404 "/cgi-bin/missing_handler.pl" #ErrorDocument 402 http://www.example.com/subscription_info.html # # # MaxRanges: Maximum number of Ranges in a request before # returning the entire resource, or 0 for unlimited # Default setting is to accept 200 Ranges #MaxRanges 0 # # EnableMMAP and EnableSendfile: On systems that support it, # memory-mapping or the sendfile syscall is used to deliver # files. This usually improves server performance, but must # be turned off when serving from networked-mounted # filesystems or if support for these functions is otherwise # broken on your system. # #EnableMMAP off #EnableSendfile off # Supplemental configuration # # The configuration files in the conf/extra/ directory can be # included to add extra features or to modify the default configuration of # the server, or you may simply copy their contents here and change as # necessary. # Server-pool management (MPM specific) #Include conf/extra/httpd-mpm.conf # Multi-language error messages #Include conf/extra/httpd-multilang-errordoc.conf # Fancy directory listings #Include conf/extra/httpd-autoindex.conf # Language settings #Include conf/extra/httpd-languages.conf # User home directories #Include conf/extra/httpd-userdir.conf # Real-time info on requests and configuration #Include conf/extra/httpd-info.conf # Virtual hosts Include conf/extra/httpd-vhosts.conf # Local access to the Apache HTTP Server Manual #Include conf/extra/httpd-manual.conf # Distributed authoring and versioning (WebDAV) #Include conf/extra/httpd-dav.conf # Various default settings #Include conf/extra/httpd-default.conf # Secure (SSL/TLS) connections #Include conf/extra/httpd-ssl.conf # # Note: The following must must be present to support # starting without SSL on platforms with no /dev/random equivalent # but a statically compiled-in mod_ssl. # <IfModule ssl_module> SSLRandomSeed startup builtin SSLRandomSeed connect builtin </IfModule> * /usr/local/apache2/conf/extra/httpd-vhosts.conf * # # Virtual Hosts # # If you want to maintain multiple domains/hostnames on your # machine you can setup VirtualHost containers for them. Most configurations # use only name-based virtual hosts so the server doesn't need to worry about # IP addresses. This is indicated by the asterisks in the directives below. # # Please see the documentation at # <URL:http://httpd.apache.org/docs/2.2/vhosts/> # for further details before you try to setup virtual hosts. # # You may use the command line option '-S' to verify your virtual host # configuration. # # Use name-based virtual hosting. # NameVirtualHost *:80 # # VirtualHost example: # Almost any Apache directive may go into a VirtualHost container. # The first VirtualHost section is used for all requests that do not # match a ServerName or ServerAlias in any <VirtualHost> block. # <VirtualHost *:80> ServerName localhost ServerAdmin david@localhost DocumentRoot "/srv/www/localhost" # MonoServerPath can be changed to specify which version of ASP.NET is hosted # mod-mono-server1 = ASP.NET 1.1 / mod-mono-server2 = ASP.NET 2.0 # For SUSE Linux Enterprise Mono Extension, uncomment the line below: # MonoServerPath localhost "/opt/novell/mono/bin/mod-mono-server2" # For Mono on openSUSE, uncomment the line below instead: MonoServerPath localhost "/opt/mono-2.10/bin/mod-mono-server4" # To obtain line numbers in stack traces you need to do two things: # 1) Enable Debug code generation in your page by using the Debug="true" # page directive, or by setting <compilation debug="true" /> in the # application's Web.config # 2) Uncomment the MonoDebug true directive below to enable mod_mono debugging MonoDebug localhost true # The MONO_IOMAP environment variable can be configured to provide platform abstraction # for file access in Linux. Valid values for MONO_IOMAP are: # case # drive # all # Uncomment the line below to alter file access behavior for the configured application MonoSetEnv localhost PATH=/opt/mono-2.10/bin:$PATH;LD_LIBRARY_PATH=/opt/mono-2.10/lib:$LD_LIBRARY_PATH; # # Additional environtment variables can be set for this server instance using # the MonoSetEnv directive. MonoSetEnv takes a string of 'name=value' pairs # separated by semicolons. For instance, to enable platform abstraction *and* # use Mono's old regular expression interpreter (which is slower, but has a # shorter setup time), uncomment the line below instead: # MonoSetEnv localhost MONO_IOMAP=all;MONO_OLD_RX=1 MonoApplications localhost "/:/srv/www/localhost" <Location "/"> Allow from all Order allow,deny MonoSetServerAlias localhost SetHandler mono SetOutputFilter DEFLATE SetEnvIfNoCase Request_URI "\.(?:gif|jpe?g|png)$" no-gzip dont-vary </Location> <IfModule mod_deflate.c> AddOutputFilterByType DEFLATE text/html text/plain text/xml text/javascript </IfModule> </VirtualHost> <VirtualHost *:80> ServerAdmin [email protected] DocumentRoot "/usr/local/apache2/docs/dummy-host.example.com" ServerName dummy-host.example.com ServerAlias www.dummy-host.example.com ErrorLog "logs/dummy-host.example.com-error_log" CustomLog "logs/dummy-host.example.com-access_log" common </VirtualHost> <VirtualHost *:80> ServerAdmin [email protected] DocumentRoot "/usr/local/apache2/docs/dummy-host2.example.com" ServerName dummy-host2.example.com ErrorLog "logs/dummy-host2.example.com-error_log" CustomLog "logs/dummy-host2.example.com-access_log" common </VirtualHost> mono -V output: root@david-ubuntu:~# mono -V Mono JIT compiler version 2.6.7 (Debian 2.6.7-5ubuntu3) Copyright (C) 2002-2010 Novell, Inc and Contributors. www.mono-project.com TLS: __thread GC: Included Boehm (with typed GC and Parallel Mark) SIGSEGV: altstack Notifications: epoll Architecture: amd64 Disabled: none

    Read the article

  • SQL SERVER – Fix : Error : 3117 : The log or differential backup cannot be restored because no files

    - by pinaldave
    I received the following email from one of my readers. Dear Pinal, I am new to SQL Server and our regular DBA is on vacation. Our production database had some problem and I have just restored full database backup to production server. When I try to apply log back I am getting following error. I am sure, this is valid log backup file. Screenshot is attached. [Few other details regarding server/ip address removed] Msg 3117, Level 16, State 1, Line 1 The log or differential backup cannot be restored because no files are ready to roll forward. Msg 3013, Level 16, State 1, Line 1 RESTORE LOG is terminating abnormally. Screenshot attached. [Removed as it contained live IP address] Please help immediately. Well I have answered this question in my earlier post, 2 years ago, over here SQL SERVER – Fix : Error : Msg 3117, Level 16, State 4 The log or differential backup cannot be restored because no files are ready to rollforward. However, I will try to explain it a little more this time. For SQL Server database to be used it should in online state. There are multiple states of SQL Server Database. ONLINE (Available – online for data) OFFLINE RESTORING RECOVERING RECOVERY PENDING SUSPECT EMERGENCY (Limited Availability) If the database is online, it means it is active and in operational mode. It will not make sense to apply further log from backup if the operations have continued on this database. The common practice during the backup restore process is to specify the keyword RECOVERY when the database is restored. When RECOVERY keyword is specified, the SQL Server brings back the database online and will not accept any further log backups. However, if you want to restore more than one backup files, i.e. after restoring the full back up if you want to apply further differential or log backup you cannot do that when database is online and already active. You need to have your database in the state where it can further accept the backup data and not the online data request. If the SQL Server is online and also accepts database backup file, then there can be data inconsistency. This is the reason that when there are more than one database backup files to be restored, one has to restore the database with NO RECOVERY keyword in the RESTORE operation. I suggest you all to read one more post written by me earlier. In this post, I explained the time line with image and graphic SQL SERVER – Backup Timeline and Understanding of Database Restore Process in Full Recovery Model. Sample Code for reference: RESTORE DATABASE AdventureWorks FROM DISK = 'C:\AdventureWorksFull.bak' WITH NORECOVERY; RESTORE DATABASE AdventureWorks FROM DISK = 'C:\AdventureWorksDiff.bak' WITH RECOVERY; In this post, I am not trying to cover complete backup and recovery. I am just attempting to address one type of error and its resolution. Please test these scenarios on the development server. Playing with live database backup and recovery is always very crucial and needs to be properly planned. Leave a comment here if you need help with this subject. Similar Post: SQL SERVER – Restore Sequence and Understanding NORECOVERY and RECOVERY Note: We will cover Standby Server maintenance and Recovery in another blog post and it is intentionally, not covered this post. Reference : Pinal Dave (http://blog.SQLAuthority.com) Filed under: Pinal Dave, Readers Question, SQL, SQL Authority, SQL Backup and Restore, SQL Error Messages, SQL Query, SQL Scripts, SQL Server, SQL Tips and Tricks, T SQL, Technology

    Read the article

  • Raspberry Pi entrance signed backed by Umbraco - Part 1

    - by Chris Houston
    Being experts on all things Umbraco, we jumped at the chance to help our client, QV Offices, with their pressing signage predicament. They needed to display a sign in the entrance to their building and approached us for our advice. Of course it had to be electronic: displaying multiple names of their serviced office clients, meeting room bookings and on-the-pulse promotions. But with a winding Victorian staircase and minimal storage space how could the monitor be run, updated and managed? That’s where we came in…Raspberry PiUmbraco CMSAutomatic updatesAutomated monitor of the signPower saving when the screen is not in useMounting the screenThe screen that has been used is a standard LED low energy Full HD screen and has been mounted on the wall using it's VESA mounting points, as the wall is a stud wall we were able to add an access panel behind the screen to feed through the mains, HDMI and sensor cables.The Raspberry Pi is then tucked away out of sight in the main electrical cupboard which just happens to be next to the sign, we had an electrician add a power point inside this cupboard to allow us to power the screen and the Raspberry Pi.Designing the interface and editing the contentAlthough a room sign was the initial requirement from QV Offices, their medium term goal has always been to add online meeting booking to their website and hence we suggested adding information about the current and next day's meetings to the sign that would be pulled directly from their online booking system.We produced the design and built the web page to fit exactly on a 1920 x 1080 screen (Full HD in Portrait)As you would expect all the information can be edited via an Umbraco CMS, they are able to add floors, rooms, clients and virtual clients as well as add meeting bookings to their meeting diary.How we configured the Raspberry PiAfter receiving a new Raspberry Pi we downloaded the latest release of Raspbian operating system and followed the official guide which shows how to copy the OS onto an SD card from a Mac, we then followed the majority of steps on this useful guide: 10 Things to Do After Buying a Raspberry Pi.Installing ChromiumWe chose to use the Chromium web browser which for those who do not know is the open sourced version of Google Chrome. You can install this from the terminal with the following command:sudo apt-get install chromium-browserInstalling UnclutterWe found this little application which automatically hides the mouse pointer, it is used in the script below and is installed using the following command:sudo apt-get install unclutterAuto start Chromium and disabling the screen saver, power saving and mouseWhen the Raspberry Pi has been installed it will not have a keyboard or mouse and hence if their was a power cut we needed it to always boot and re-loaded Chromium with the correct URL.Our preferred command line text editor is Nano and I have assumed you know how to use this editor or will be able to work it out pretty quickly.So using the following command:sudo nano /etc/xdg/lxsession/LXDE/autostartWe then changed the autostart file content to:@lxpanel --profile LXDE@pcmanfm --desktop --profile LXDE@xscreensaver -no-splash@xset s off@xset -dpms@xset s noblank@chromium --kiosk --incognito http://www.qvoffices.com/someURL@unclutter -idle 0The first few commands turn off the screen saver and power saving, we then open Cromium in Kiosk Mode (full screen with no menu etc) and pass in the URL to use (I have changed the URL in this example) We found a useful blog post with the Cromium command line switches.Finally we also open an application called Unclutter which auto hides the mouse after 0 seconds, so you will never see a mouse on the sign.We also had to edit the following file:sudo nano /etc/lightdm/lightdm.confAnd added the following line under the [SeatDefault] section:xserver-command=X -s 0 dpmsRefreshing the screenWe decided to try and add a scheduled task that would trigger Chromium to reload the page, at some point in the future we might well change this to using Javascript to update the content, but for now this works fine.First we installed the XDOTool which enables you to script Keyboard commands:sudo apt-get install xdotoolWe used the Refreshing Chromium Browser by Shell Script post as a reference and created the following shell script (which we called refreshing.sh):export DISPLAY=":0"WID=$(xdotool search --onlyvisible --class chromium|head -1)xdotool windowactivate ${WID}xdotool key ctrl+F5This selects the correct display and then sends a CTRL + F5 to refresh Chromium.You will need to give this file execute permissions:chmod a=rwx refreshing.shNow we have the script file setup we just need to schedule it to call this script periodically which is done by using Crontab, to edit this you use the following command:crontab -eAnd we added the following:*/5 * * * * DISPLAY=":.0" /home/pi/scripts/refreshing.sh >/home/pi/cronlog.log 2>&1This calls our script every 5 minutes to refresh the display and it logs any errors to the cronlog.log file.SummaryQV Offices now have a richer and more manageable booking system than they did before we started, and a great new sign to boot.How could we make sure that the sign was running smoothly downstairs in a busy office centre? A second post will follow outlining exactly how Vizioz enabled QV Offices to monitor their sign simply and remotely, from the comfort of their desks.

    Read the article

  • T-SQL Improvements And Data Types in ms sql 2008

    - by Aamir Hasan
     Microsoft SQL Server 2008 is a new version released in the first half of 2008 introducing new properties and capabilities to SQL Server product family. All these new and enhanced capabilities can be defined as the classic words like secure, reliable, scalable and manageable. SQL Server 2008 is secure. It is reliable. SQL2008 is scalable and is more manageable when compared to previous releases. Now we will have a look at the features that are making MS SQL Server 2008 more secure, more reliable, more scalable, etc. in details.Microsoft SQL Server 2008 provides T-SQL enhancements that improve performance and reliability. Itzik discusses composable DML, the ability to declare and initialize variables in the same statement, compound assignment operators, and more reliable object dependency information. Table-Valued ParametersInserts into structures with 1-N cardinality problematicOne order -> N order line items"N" is variable and can be largeDon't want to force a new order for every 20 line itemsOne database round-trip / line item slows things downNo ARRAY data type in SQL ServerXML composition/decomposition used as an alternativeTable-valued parameters solve this problemTable-Valued ParametersSQL Server has table variablesDECLARE @t TABLE (id int);SQL Server 2008 adds strongly typed table variablesCREATE TYPE mytab AS TABLE (id int);DECLARE @t mytab;Parameters must use strongly typed table variables Table Variables are Input OnlyDeclare and initialize TABLE variable  DECLARE @t mytab;  INSERT @t VALUES (1), (2), (3);  EXEC myproc @t;Procedure must declare variable READONLY  CREATE PROCEDURE usetable (    @t mytab READONLY ...)  AS    INSERT INTO lineitems SELECT * FROM @t;    UPDATE @t SET... -- no!T-SQL Syntax EnhancementsSingle statement declare and initialize  DECLARE @iint = 4;Compound Assignment Operators  SET @i += 1;Row constructors  DECLARE @t TABLE (id int, name varchar(20));  INSERT INTO @t VALUES    (1, 'Fred'), (2, 'Jim'), (3, 'Sue');Grouping SetsGrouping Sets allow multiple GROUP BY clauses in a single SQL statementMultiple, arbitrary, sets of subtotalsSingle read pass for performanceNested subtotals provide ever better performanceGrouping Sets are an ANSI-standardCOMPUTE BY is deprecatedGROUPING SETS, ROLLUP, CUBESQL Server 2008 - ANSI-syntax ROLLUP and CUBEPre-2008 non-ANSI syntax is deprecatedWITH ROLLUP produces n+1 different groupings of datawhere n is the number of columns in GROUP BYWITH CUBE produces 2^n different groupingswhere n is the number of columns in GROUP BYGROUPING SETS provide a "halfway measure"Just the number of different groupings you needGrouping Sets are visible in query planGROUPING_ID and GROUPINGGrouping Sets can produce non-homogeneous setsGrouping set includes NULL values for group membersNeed to distinguish by grouping and NULL valuesGROUPING (column expression) returns 0 or 1Is this a group based on column expr. or NULL value?GROUPING_ID (a,b,c) is a bitmaskGROUPING_ID bits are set based on column expressions a, b, and cMERGE StatementMultiple set operations in a single SQL statementUses multiple sets as inputMERGE target USING source ON ...Operations can be INSERT, UPDATE, DELETEOperations based onWHEN MATCHEDWHEN NOT MATCHED [BY TARGET] WHEN NOT MATCHED [BY SOURCE]More on MERGEMERGE statement can reference a $action columnUsed when MERGE used with OUTPUT clauseMultiple WHEN clauses possible For MATCHED and NOT MATCHED BY SOURCEOnly one WHEN clause for NOT MATCHED BY TARGETMERGE can be used with any table sourceA MERGE statement causes triggers to be fired onceRows affected includes total rows affected by all clausesMERGE PerformanceMERGE statement is transactionalNo explicit transaction requiredOne Pass Through TablesAt most a full outer joinMatching rows = when matchedLeft-outer join rows = when not matched by targetRight-outer join rows = when not matched by sourceMERGE and DeterminismUPDATE using a JOIN is non-deterministicIf more than one row in source matches ON clause, either/any row can be used for the UPDATEMERGE is deterministicIf more than one row in source matches ON clause, its an errorKeeping Track of DependenciesNew dependency views replace sp_dependsViews are kept in sync as changes occursys.dm_sql_referenced_entitiesLists all named entities that an object referencesExample: which objects does this stored procedure use?sys.dm_sql_referencing_entities 

    Read the article

  • jQuery Templates on Microsoft Ajax CDN

    - by Stephen Walther
    The beta version of the jQuery Templates plugin is now hosted on the Microsoft Ajax CDN. You can start using the jQuery Templates plugin in your application by referencing both jQuery 1.4.2 and jQuery Templates from the CDN. Here are the two script tags that you will want to use when developing an application: <script type="text/javascript" src=”http://ajax.microsoft.com/ajax/jquery/jquery-1.4.2.js”></script> <script type="text/javascript" src=”http://ajax.microsoft.com/ajax/jquery.templates/beta1/jquery.tmpl.js”></script> In addition, minified versions of both files are available from the CDN: <script type="text/javascript" src="http://ajax.microsoft.com/ajax/jquery/jquery-1.4.2.min.js"></script> <script type="text/javascript" src="http://ajax.microsoft.com/ajax/jquery.templates/beta1/jquery.tmpl.min.js"></script> Here’s a full code sample of using jQuery Templates from the CDN to display pictures of cats from Flickr: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Cats</title> <style type="text/css"> html { background-color:Orange; } #catBox div { width:250px; height:250px; border:solid 1px black; background-color:White; margin:5px; padding:5px; float:left; } #catBox img { width:200px; height: 200px; } </style> </head> <body> <h1>Cat Photos!</h1> <div id="catBox"></div> <script type="text/javascript" src="http://ajax.microsoft.com/ajax/jquery/jquery-1.4.2.min.js"></script> <script type="text/javascript" src="http://ajax.microsoft.com/ajax/jquery.templates/beta1/jquery.tmpl.min.js"></script> <script id="catTemplate" type="text/x-jquery-tmpl"> <div> <b>${title}</b> <br /> <img src="${media.m}" /> </div> </script> <script type="text/javascript"> var url = "http://api.flickr.com/services/feeds/groups_pool.gne?id=44124373027@N01&lang=en-us&format=json&jsoncallback=?"; // Grab some flickr images of cats $.getJSON(url, function (data) { // Format the data using the catTemplate template $("#catTemplate").tmpl(data.items).appendTo("#catBox"); }); </script> </body> </html> This page displays a list of cats retrieved from Flickr: Notice that the cat pictures are retrieved and rendered with just a few lines of code: var url = "http://api.flickr.com/services/feeds/groups_pool.gne?id=44124373027@N01&lang=en-us&format=json&jsoncallback=?"; // Grab some flickr images of cats $.getJSON(url, function (data) { // Format the data using the catTemplate template $("#catTemplate").tmpl(data.items).appendTo("#catBox"); }); The final line of code, the one that calls the tmpl() method, uses the Templates plugin to render the cat photos in a template named catTemplate. The catTemplate template is contained within a SCRIPT element with type="text/x-jquery-tmpl". The jQuery Templates plugin is an “official” jQuery plugin which will be included in jQuery 1.5 (the next major release of jQuery). You can read the full documentation for the plugin at the jQuery website: http://api.jquery.com/category/plugins/templates/ The jQuery Templates plugin is still beta so we would really appreciate your feedback on the plugin. Let us know if you use the Templates plugin in your website.

    Read the article

  • IntelliTrace As a Learning Tool for MVC2 in a VS2010 Project

    - by Sam Abraham
    IntelliTrace is a new feature in Visual Studio 2010 Ultimate Edition. I see this valuable tool as a “Program Execution Recorder” that captures information about events and calls taking place as soon as we hit the VS2010 play (Start Debugging) button or the F5 key. Many online resources already discuss IntelliTrace and the benefit it brings to both developers and testers alike so I see no value of just repeating this information.  In this brief blog entry, I would like to share with you how I will be using IntelliTrace in my upcoming talk at the Ft Lauderdale ArcSig .Net User Group Meeting on April 20th 2010 (check http://www.fladotnet.com for more information), as a learning tool to demonstrate the internals of the lifecycle of an MVC2 application.  I will also be providing some helpful links that cover IntelliTrace in more detail at the end of my article for reference. IntelliTrace is setup by default to only capture execution events. Microsoft did such a great job on optimizing its recording process that I haven’t even felt the slightest performance hit with IntelliTrace running as I was debugging my solutions and projects.  For my purposes here however, I needed to capture more information beyond execution events, so I turned on the option for capturing calls in addition to events as shown in Figures 1 and 2. Changing capture options will require us to stop our debugging session and start over for the new settings to take place. Figure 1 – Access IntelliTrace options via the Tools->Options menu items Figure 2 – Change IntelliTrace Options to capture call information as well as events Notice the warning with regards to potentially degrading performance when selecting to capture call information in addition to the default events-only setting. I have found this warning to be sure true. My subsequent tests showed slowness in page load times compared to rendering those same exact pages with the “event-only” option selected. Execution recording is auto-started along with the new debugging session of our project. At this point, we can simply interact with the application and continue executing normally until we decide to “playback” the code we have executed so far.  For code replay, first step is to “break” the current execution as show in Figure 3.   Figure 3 – Break to replay recording A few tries later, I found a good process to quickly find and demonstrate the MVC2 page lifecycle. First-off, we start with the event view as shown in Figure 4 until we find an interesting event that needs further studying.  Figure 4 – Going through IntelliTrace’s events and picking as specific entry of interest We now can, for instance, study how the highlighted HTTP GET request is being handled, by clicking on the “Calls View” for that particular event. Notice that IntelliTrace shows us all calls that took place in servicing that GET request. Double clicking on any call takes us to a more granular view of the call stack within that clicked call, up until getting to a specific line of code where we can do a line-by-line replay of the execution from that point onwards using F10 or F11 just like our typical good old VS2008 debugging helped us accomplish. Figure 5 – switching to call view on an event of interest Figure 6 – Double clicking on call shows a more granular view of the call stack. In conclusion, the introduction of IntelliTrace as a new addition to the VS developers’ tool arsenal enhances development and debugging experience and effectively tackles the “no-repro” problem. It will also hopefully enhance my audience’s experience listening to me speaking about  an MVC2 page lifecycle which I can now easily visually demonstrate, thereby improving the probability of keeping everybody awake a little longer. IntelliTrace References: http://msdn.microsoft.com/en-us/magazine/ee336126.aspx http://msdn.microsoft.com/en-us/library/dd264944(VS.100).aspx

    Read the article

  • Oracle WebCenter Portlet Debugging

    - by Alexander Rudat
    IntroductionThis article describes how to debug a portlets that is already deployed to WebLogic server using Oracle JDeveloper 11g.OverviewThese a Normal 0 21 false false false DE X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Calibri","sans-serif";} re the basic steps involved in remote debugging an WebCenter portlets deployed in WebLogic:Configuration of the WebLogic to support remote debuggingConfiguration of the portlet project in JDeveloperActual debugging of the portletConfiguration of the WebLogicTo start the WebLogic server in debugging mode, there are a couple of configuration changes that need to be done to the WebLogic domain where the portlet is deployed.First we need to edit JVM options of the WebLogic server startup script where the portlet is deployed. Normally the startManagedWebLogic.cmd is used to start this managed server.This startup script is located in the %MIDDLEWARE_HOME%\user_projects\domains\<domain_name>\bin  directory, where %MIDDLEWARE_HOME% is the installation directory of WebLogic.Add the following line before the set JAVA_OPTIONS= line:set REMOTE_DEBUG_JAVA_OPTIONS=-Xdebug -Xnoagent -Xrunjdwp:transport=dt_socket,address=4000,server=y,suspend=nChange the set JAVA_OPTIONS= line to read like the one below:set JAVA_OPTIONS=%SAVE_JAVA_OPTIONS% %ADF_JAVA_OPTIONS% %REMOTE_DEBUG_JAVA_OPTIONS%After this changes save the startup script and start the managed server and be sure that you have access to the admin console (for example http://localhost:7001/console).Finally we need to check, that HTTP tunneling is enabled on the managed server. To do this, login to the admin console, select the managed server and select the Protocols tab.Be sure that Enable Tunneling is selected.Configuration of the portletFirst let's create a new run configuration specifically for remote debugging. Double-click the project where you portlets are developed.In the Project Properties select the Run/Debug/Profile page. Click New... to create a new run configuration. In the Create Run Configuration  dialog enter Remote Debugging for the name of the run configuration. Leave the Copy Settings From selection to Default and click OK to create the new run configuration.Once the Remote Debug run configuration is created, select it in the Run Configurations and click Edit... to bring up the Edit Run Configuration dialog. In the Launch Settings page click on the Remote Debugging checkbox to enable remote debugging for this run configuration.Finally select the Remote page and verify that the Protocol is set to Attach to JPDA and the port matches the port specified earlier when configuring WebLogic for remote debugging (defaults to 4000).Actual debugging of the portletTo start the remote debugging profile, right-click on your portlet project and select Start Remote Debugger.Now JDeveloper is asking the host and port specification. If you WebLogic server is installed locally, you can apply the default settings: Set a breakpoint at you java code and run the portal (WebCenter) application, where the portlet is used.That's all, now you are able to debug the portlet java code. Hope you will find all errors in your portlet :-)Referenceshttp://www.oracle.com/technology/products/jdev/howtos/weblogic/remotedebugwls.html

    Read the article

  • SQLAuthority News – The Best Quotes of “Who Wrote This?” Contest

    - by pinaldave
    I am a frequent reader of Brent Ozar PLF, it is one of my favorite blogs. A recent post announced a “Who Wrote This?” contest to see if readers could tell their three contributors apart based on some writing samples. Here are my favorite lines from the sample paragraphs, from each of the three “mystery authors.” Topic 1: Working with Bad Managers Mystery Author A – “Working with bad managers means working against my own happiness, and I’ve come to learn that there’s no changing bad managers.” I love this line because, as anyone who has had a bad manager knows, often a lot of self-doubt rises up. We all have to remember that sometimes the problem is out of our control. Mystery Author B – “Mentor your manager just like you would mentor a junior DBA.” Having a bad manager can be extremely depressing, and we often feel out of control. But we all need to remember that our work is a two-way street, and that sometimes we can subtly influence those above us. Mystery Author C – “The trick to working for all bad managers is to remember that they aren’t your parent. Take charge of your career.” We all also need to learn not to play the blame game. Would you rather stay in a place where you are unhappy, or would you rather take charge of your life? I hope most people would pick the latter. Topic 2: Working with Remote Teams Mystery Author A – “Like almost anything else the key is to make sure that everyone on the team has an understanding of how and when communication will occur.” Communication is so important. I cannot over emphasize how much. And this one line captures how I feel and even communicates the idea clearly! Mystery Author B – “The key to remote team success is verifiable trust: feeling confident that invisible team members are doing the right amount of the right thing at the right time.” I think this line not only captures the key aspects of remote work – verifiable work and trust – but there were so many lines that followed that I loved and could not fit here. The whole paragraph is a list for successful remote work. Everyone could benefit from reading it. Mystery Author C – “What seems clear, precise, and specific in one time zone comes across as vague, soupy, and just plain weird in another.” You know what? I just love this description. The author is right – sometimes vague e-mails really do seem soupy and weird! Topic 3: Working with Your Nemesis Mystery Author A – “Every job is temporary, but your reputation stays with you.” Everyone needs to remember this. The workplace is meant to be a professional arena, and many people have the opinion that work is temporary and disposable. No one wants to work with co-worker like that. Mystery Author B – “Unhealthy conflict is going to lead to leaving three week old tuna fish sandwiches in someone’s desk drawer.” Sometimes humor really is the best policy! Mystery Author C – “Oh no, it’s that guy.” This might seem like a weird phrase to choose as my favorite from an entire paragraph. But the whole piece was written in the form of a story of co-workers getting drunk and plotting against a nemesis. It was too funny to overlook, but too long to post here. A must read! Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: PostADay, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, SQLAuthority News, T SQL, Technology

    Read the article

  • Restyling RadDataPager for WPF and Silverlight

      A small but powerful control has joined the great family of Telerik XAML controls with the recent release. RadDataPager is a result of an increasing demand from our customers who needed to work with large amounts of server data presented in small portions at the client side.  The primary goal was to make a powerful data paging control to be used in any scenarios requiring getting and presenting portions of data. How good is RadDataPager in working with paged data you can see in Rossen's announcement. Yet being a XAML control it challenged us with making one more visually appealing and highly customizable control. It offers a slick look in all available WPF/Silverlight Telerik themes:     As you can see the default design is targeting mainly business scenarios. At the same time being an example for a truly lookless XAML control RadDataPager allows restyling with minimal efforts this way widening the possible range of applications.  Lets see what we can doo with a few lines of XAML : <Style x:Key="buttonStyle" TargetType="ButtonBase" > <Setter Property="Template"> <Setter.Value> <ControlTemplate TargetType="ButtonBase"> <Grid Width="40" Background="Black"> <Ellipse StrokeThickness="2" VerticalAlignment="Center" Width="15" Height="15" HorizontalAlignment="Center" Fill="Gray" /> <Ellipse Visibility="{Binding IsCurrent, Converter={StaticResource VisibilityConverter}}" VerticalAlignment="Center" Height="16" Fill="White" HorizontalAlignment="Center" Width="16"/> </Grid> </ControlTemplate> </Setter.Value> </Setter> </Style> ... <telerik:RadDataPager NumericButtonStyle="{StaticResource buttonStyle}" ... And the result: The IPhone-style-thing bellow the RadCoverFlow is actually our RadDataPager.       With a few more lines of XAML we may get  almost any imaginable look of the pager control including the fascinating result demonstrated in the short video on the top.Did you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

    Read the article

  • Chalk Talk with John: Business Value of Identity and Access Management

    - by John Brunswick
    Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-family:"Calibri","sans-serif"; mso-ascii- mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi- mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Conveying the business value of Identity and Access Management to non technologists can potentially be challenging, especially considering the breadth capability supplied by these technologies. In this episode of Chalk Talk with John, Bob at Codeaway Valley asks Jim from Middleware Fields how they are able to manage access to buildings and facilities throughout their community. Bob and his team struggle to keep up with the needs of their community members, while ensuring the community’s safety. Jim shares his creative solution to simplifying the management of access throughout their community in Middleware Fields. Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-family:"Calibri","sans-serif"; mso-ascii- mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi- mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} About me: Hi, I am John Brunswick, an Oracle Enterprise Architect. As an Oracle Enterprise Architect, I focus on the alignment of technical capabilities in support of business vision and objectives, as well as the overall business value of technology.  Before coming to Oracle, I was a Practice Manager within BEA System's Business Interaction Division consulting organization, orchestrating enterprise systems in support of line of business goals. Follow me on Twitter and visit my site for Oracle Fusion Middleware related tips.

    Read the article

< Previous Page | 417 418 419 420 421 422 423 424 425 426 427 428  | Next Page >