Search Results

Search found 11068 results on 443 pages for 'print preview'.

Page 436/443 | < Previous Page | 432 433 434 435 436 437 438 439 440 441 442 443  | Next Page >

  • Need AngularJS grid resizing directive to resize "thumbnail" that contains no image

    - by thebravedave
    UPDATE Plunker to project: http://plnkr.co/edit/oKB96szQhqwpKQbOGUDw?p=preview I have an AngularJS project that uses AngularJS Bootstrap grids. I need all of the grid elements to have the same size so they stack properly. I created an angularJs directive that auto resizes the grid element when placed in said grid element. I have 2 directives that do this for me Directive 1: onload Directive 2: imageonload Directive 2 works. If the grid element uses an image, after the image loads then the directive triggers an event that sends the grid elements height to all other grid elements. If that height sent out via the event is greater than that of the grid element which is listening to the event then that listening grid element changes it's height to be the greater height. This way the largest height becomes the height for all the grid elements. Directive 1 does not work. This one is placed on the outer most grid elements html element, and is triggered when the element loads. The problem is that when the element loads and the onload directive is called AngularJS has not yet filled out the data in said grid element. The outcome is that the real height after AngularJS data binds is not broadcast as an event. My only solution I have thought of (but haven't tried) is to add an image url to an image that exists but doesn't have any data in it, and place that in the grid element (the one that didn't have any images before placing the blank one in). I could then call imageonload instead of onload and I pretty sure the angularjs data binding will have taken place by then. the problem is that that is pretty hacky. I would rather be able to have not an image in the grid element, and be able to call my custom onload directive and have the onload directive calculate the height AFTER angularJS data binds to all of the data binding variables in the grid element. Here is my imageonload directive .directive('imageonload', function($rootScope) { return { restrict: 'A', link: function(scope, element, attrs) { scope.heightArray = []; scope.largestHeight = 50; element.bind('load', function() { broadcastThumbnailHeight(); }); scope.$on('imageOnLoadEvent', function(caller, value){ var el = angular.element(element); var id = el.prop('id'); var pageName = el.prop('title'); if(pageName == value[0]){ if(scope.largestHeight < value[1]){ scope.largestHeight = value[1]; var nestedString = el.prop('alt'); if(nestedString == "") nestedString = "1"; var nested = parseInt(nestedString); nested = nested - 1; var inte = 0; var thumbnail = el["0"]; var finalThumbnailContainer = thumbnail.parentElement; while(inte != nested){ finalThumbnailContainer = finalThumbnailContainer.parentElement; inte++; } var innerEl = angular.element(finalThumbnailContainer); var height = value[1]; innerEl.height(height); } } }); scope.$on('findHeightAndBroadcast', function(){ broadcastThumbnailHeight(); }); scope.$on('resetThumbnailHeight', function(){ scope.largestHeight = 50; }); function broadcastThumbnailHeight(){ var el = angular.element(element); var id = el.prop('id'); var alt = el.prop('alt'); if(alt == "") alt = "1"; var nested = parseInt(alt); nested = nested - 1; var pageName = el.prop('title'); var inte = 1; var thumbnail = el["0"]; var finalThumbnail = thumbnail.parentElement; while(inte != nested){ finalThumbnail = finalThumbnail.parentElement; inte++; } var elZero = el["0"]; var clientHeight = finalThumbnail.clientHeight; var arr = []; arr[0] = pageName; arr[1] = clientHeight; $rootScope.$broadcast('imageOnLoadEvent', arr); } } }; }) And here is my onload directive .directive('onload', function($rootScope) { return { restrict: 'A', link: function(scope, element, attrs) { scope.largestHeight=100; getHeightAndBroadcast(); scope.$on('onLoadEvent', function(caller, value){ var el = angular.element(element); var id = el.prop('id'); var pageName = el.prop('title'); if(pageName == value[0]){ if(scope.largestHeight < value[1]){ scope.largestHeight = value[1]; var height = value[1]; el.height(height); } } }); function getHeightAndBroadcast(){ var el = angular.element(element); var h = el["0"].children; var thumbnailHeightElement = angular.element(h); var pageName = el.prop("title"); var clientHeight = thumbnailHeightElement["0"].clientHeight; var arr = []; arr[0] = pageName; arr[1] = clientHeight; if(clientHeight != undefined) $rootScope.$broadcast('onLoadEvent', arr); } } }; }) Here is an example of one of my grid elements that uses imageonload. Note the imageonload directive in the image html element. This works. There is also an onload directive on the outer most html of the grid element. That does not work. I have stepped through this carefully in Firebug and saw that the onload was calculating the height before AngularJS data binding was complete. <div class="thumbnail col-md-3" id="{{product.id}}" title="thumbnailAdminProductsGrid" onload> <div class="row"> <div class="containerz"> <div class="row-fluid"> <div class="col-md-2"></div> <div class="col-md-7"> <div class="textcenterinline"> <!--tag--><img class="img-responsive" id="{{product.id}}" title="imageAdminProductsGrid" alt=6 ng-src="{{product.baseImage}}" imageonload/><!--end tag--> </div> </div> </div> <div class="caption"> <div class="testing"> <div class="row-fluid"> <div class="col-md-12"> <h3 class=""> <!--tag--><a href="javascript:void(0);" ng-click="loadProductView('{{product.id}}')">{{product.name}}</a><!--end tag--> </h3> </div> </div> <div class="row-fluid"> <div class="col-md-12"> <p class="lead"><!--tag--> {{product.price}}</p><!--end tag--> </div> </div> <div class="row-fluid"> <div class="col-md-12"> <p><!--tag-->{{product.inStock}} units available<!--end tag--></p> </div> </div> <div class="row-fluid"> <div class="col-md-12"> <p class=""><!--tag-->{{product.generalDescription}}<!--end tag--></p> </div> </div> <!--tag--> <div data-ng-if="product.specialized=='true'"> <div class="row-fluid"> <div class="col-md-12" ng-repeat="varCat in product.varietyCategoriesAndOptions"> <b><h4>{{varCat.varietyCategoryName}}</h4></b> <select ng-model="varCat.varietyCategoryOption" ng-options="value.varietyCategoryOptionId as value.varietyCategoryOptionValue for (key,value) in varCat.varietyCategoryOptions"> </select> </div> </div> </div> <!--end tag--> <div class="row-fluid"> <div class="col-md-12"> <!--tag--><div ng-if="product.weight==0"><b>Free Shipping</b></div><!--end tag--> </div> </div> </div> </div> </div> </div> Here is an example of one of the html for one of my grid elements that only uses the "onload" directive and not "imageonload" <div class="thumbnail col-md-3" title="thumbnailCouponGrid" onload> <div class="innnerContainer"> <div class="text-center"> {{coupon.name}} <br /> <br /> <b>Description</b> <br /> {{coupon.description}} <br /> <br /> <button class="btn btn-large btn-primary" ng-click="goToCoupon()">View Coupon Details</button> </div> </div> The imageonload function might look a little confusing because I use the img html attribute "alt" to signal to the directive how many levels the imageonload is placed below the outermost html for the grid element. We have to have this so the directive knows which html element to set the new height on. also I use the "title" attribute to set which grid this grid resizing is for (that way you can use the directive multiple times on the same page for different grids and not have the events for the wrong grid triggered). Does anyone know how I can get the "onload" directive to get called AFTER angularJS binds to the grid element? Just for completeness here are 2 images (almost looks like just 1), the second is a grid that contains grid elements that have images and use the "imageonload" directive and the first is a grid that contains grid elements that do not use images and only uses the "onload" directive.

    Read the article

  • OpenGL basics: calling glDrawElements once per object

    - by Bethor
    Hi all, continuing on from my explorations of the basics of OpenGL (see this question), I'm trying to figure out the basic principles of drawing a scene with OpenGL. I am trying to render a simple cube repeated n times in every direction. My method appears to yield terrible performance : 1000 cubes brings performance below 50fps (on a QuadroFX 1800, roughly a GeForce 9600GT). My method for drawing these cubes is as follows: done once: set up a vertex buffer and array buffer containing my cube vertices in model space set up an array buffer indexing the cube for drawing as 12 triangles done for each frame: update uniform values used by the vertex shader to move all cubes at once done for each cube, for each frame: update uniform values used by the vertex shader to move each cube to its position call glDrawElements to draw the positioned cube Is this a sane method ? If not, how does one go about something like this ? I'm guessing I need to minimize calls to glUniform, glDrawElements, or both, but I'm not sure how to do that. Full code for my little test : (depends on gletools and pyglet) I'm aware that my init code (at least) is really ugly; I'm concerned with the rendering code for each frame right now, I'll move to something a little less insane for the creation of the vertex buffers and such later on. import pyglet from pyglet.gl import * from pyglet.window import key from numpy import deg2rad, tan from gletools import ShaderProgram, FragmentShader, VertexShader, GeometryShader vertexData = [-0.5, -0.5, -0.5, 1.0, -0.5, 0.5, -0.5, 1.0, 0.5, -0.5, -0.5, 1.0, 0.5, 0.5, -0.5, 1.0, -0.5, -0.5, 0.5, 1.0, -0.5, 0.5, 0.5, 1.0, 0.5, -0.5, 0.5, 1.0, 0.5, 0.5, 0.5, 1.0] elementArray = [2, 1, 0, 1, 2, 3,## back face 4, 7, 6, 4, 5, 7,## front face 1, 3, 5, 3, 7, 5,## top face 2, 0, 4, 2, 4, 6,## bottom face 1, 5, 4, 0, 1, 4,## left face 6, 7, 3, 6, 3, 2]## right face def toGLArray(input): return (GLfloat*len(input))(*input) def toGLushortArray(input): return (GLushort*len(input))(*input) def initPerspectiveMatrix(aspectRatio = 1.0, fov = 45): frustumScale = 1.0 / tan(deg2rad(fov) / 2.0) fzNear = 0.5 fzFar = 300.0 perspectiveMatrix = [frustumScale*aspectRatio, 0.0 , 0.0 , 0.0 , 0.0 , frustumScale, 0.0 , 0.0 , 0.0 , 0.0 , (fzFar+fzNear)/(fzNear-fzFar) , -1.0, 0.0 , 0.0 , (2*fzFar*fzNear)/(fzNear-fzFar), 0.0 ] return perspectiveMatrix class ModelObject(object): vbo = GLuint() vao = GLuint() eao = GLuint() initDone = False verticesPool = [] indexPool = [] def __init__(self, vertices, indexing): super(ModelObject, self).__init__() if not ModelObject.initDone: glGenVertexArrays(1, ModelObject.vao) glGenBuffers(1, ModelObject.vbo) glGenBuffers(1, ModelObject.eao) glBindVertexArray(ModelObject.vao) initDone = True self.numIndices = len(indexing) self.offsetIntoVerticesPool = len(ModelObject.verticesPool) ModelObject.verticesPool.extend(vertices) self.offsetIntoElementArray = len(ModelObject.indexPool) ModelObject.indexPool.extend(indexing) glBindBuffer(GL_ARRAY_BUFFER, ModelObject.vbo) glEnableVertexAttribArray(0) #position glVertexAttribPointer(0, 4, GL_FLOAT, GL_FALSE, 0, 0) glBindBuffer(GL_ELEMENT_ARRAY_BUFFER, ModelObject.eao) glBufferData(GL_ARRAY_BUFFER, len(ModelObject.verticesPool)*4, toGLArray(ModelObject.verticesPool), GL_STREAM_DRAW) glBufferData(GL_ELEMENT_ARRAY_BUFFER, len(ModelObject.indexPool)*2, toGLushortArray(ModelObject.indexPool), GL_STREAM_DRAW) def draw(self): glDrawElements(GL_TRIANGLES, self.numIndices, GL_UNSIGNED_SHORT, self.offsetIntoElementArray) class PositionedObject(object): def __init__(self, mesh, pos, objOffsetUf): super(PositionedObject, self).__init__() self.mesh = mesh self.pos = pos self.objOffsetUf = objOffsetUf def draw(self): glUniform3f(self.objOffsetUf, self.pos[0], self.pos[1], self.pos[2]) self.mesh.draw() w = 800 h = 600 AR = float(h)/float(w) window = pyglet.window.Window(width=w, height=h, vsync=False) window.set_exclusive_mouse(True) pyglet.clock.set_fps_limit(None) ## input forward = [False] left = [False] back = [False] right = [False] up = [False] down = [False] inputs = {key.Z: forward, key.Q: left, key.S: back, key.D: right, key.UP: forward, key.LEFT: left, key.DOWN: back, key.RIGHT: right, key.PAGEUP: up, key.PAGEDOWN: down} ## camera camX = 0.0 camY = 0.0 camZ = -1.0 def simulate(delta): global camZ, camX, camY scale = 10.0 move = scale*delta if forward[0]: camZ += move if back[0]: camZ += -move if left[0]: camX += move if right[0]: camX += -move if up[0]: camY += move if down[0]: camY += -move pyglet.clock.schedule(simulate) @window.event def on_key_press(symbol, modifiers): global forward, back, left, right, up, down if symbol in inputs.keys(): inputs[symbol][0] = True @window.event def on_key_release(symbol, modifiers): global forward, back, left, right, up, down if symbol in inputs.keys(): inputs[symbol][0] = False ## uniforms for shaders camOffsetUf = GLuint() objOffsetUf = GLuint() perspectiveMatrixUf = GLuint() camRotationUf = GLuint() program = ShaderProgram( VertexShader(''' #version 330 layout(location = 0) in vec4 objCoord; uniform vec3 objOffset; uniform vec3 cameraOffset; uniform mat4 perspMx; void main() { mat4 translateCamera = mat4(1.0f, 0.0f, 0.0f, 0.0f, 0.0f, 1.0f, 0.0f, 0.0f, 0.0f, 0.0f, 1.0f, 0.0f, cameraOffset.x, cameraOffset.y, cameraOffset.z, 1.0f); mat4 translateObject = mat4(1.0f, 0.0f, 0.0f, 0.0f, 0.0f, 1.0f, 0.0f, 0.0f, 0.0f, 0.0f, 1.0f, 0.0f, objOffset.x, objOffset.y, objOffset.z, 1.0f); vec4 modelCoord = objCoord; vec4 positionedModel = translateObject*modelCoord; vec4 cameraPos = translateCamera*positionedModel; gl_Position = perspMx * cameraPos; }'''), FragmentShader(''' #version 330 out vec4 outputColor; const vec4 fillColor = vec4(1.0f, 1.0f, 1.0f, 1.0f); void main() { outputColor = fillColor; }''') ) shapes = [] def init(): global camOffsetUf, objOffsetUf with program: camOffsetUf = glGetUniformLocation(program.id, "cameraOffset") objOffsetUf = glGetUniformLocation(program.id, "objOffset") perspectiveMatrixUf = glGetUniformLocation(program.id, "perspMx") glUniformMatrix4fv(perspectiveMatrixUf, 1, GL_FALSE, toGLArray(initPerspectiveMatrix(AR))) obj = ModelObject(vertexData, elementArray) nb = 20 for i in range(nb): for j in range(nb): for k in range(nb): shapes.append(PositionedObject(obj, (float(i*2), float(j*2), float(k*2)), objOffsetUf)) glEnable(GL_CULL_FACE) glCullFace(GL_BACK) glFrontFace(GL_CW) glEnable(GL_DEPTH_TEST) glDepthMask(GL_TRUE) glDepthFunc(GL_LEQUAL) glDepthRange(0.0, 1.0) glClearDepth(1.0) def update(dt): print pyglet.clock.get_fps() pyglet.clock.schedule_interval(update, 1.0) @window.event def on_draw(): with program: pyglet.clock.tick() glClear(GL_COLOR_BUFFER_BIT|GL_DEPTH_BUFFER_BIT) glUniform3f(camOffsetUf, camX, camY, camZ) for shape in shapes: shape.draw() init() pyglet.app.run()

    Read the article

  • Why isn't pyinstaller making me an .exe file?

    - by Matt Miller
    I am attempting to follow this guide to make a simple Hello World script into an .exe file. I have Windows Vista with an AMD 64-bit processor I have installed Python 2.6.5 (Windows AMD64 version) I have set the PATH (if that's the right word) so that the command line recognizes Python I have installed UPX (there only seems to be a 32-bit version for Windows) and pasted a copy of upx.exe into the Python26 folder as instructed. I have installed Pywin (Windows AMD 64 Python 2.6 version) I have run Pyinstaller's Configure.py. It gives some error messages but seems to complete. I don't know if this is what's causing the problem, so the following is what it says when I run it: C:\Python26\Pyinstaller\branches\py26winConfigure.py I: read old config from C:\Python26\Pyinstaller\branches\py26win\config.dat I: computing EXE_dependencies I: Finding TCL/TK... I: Analyzing C:\Python26\DLLs_tkinter.pyd W: Cannot get binary dependencies for file: W: C:\Python26\DLLs_tkinter.pyd W: Traceback (most recent call last): File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 608, in get Imports return _getImports_pe(pth) File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 275, in _ge tImports_pe importva, importsz = datadirs[1] IndexError: list index out of range I: Analyzing C:\Python26\DLLs_ctypes.pyd W: Cannot get binary dependencies for file: W: C:\Python26\DLLs_ctypes.pyd W: Traceback (most recent call last): File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 608, in get Imports return _getImports_pe(pth) File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 275, in _ge tImports_pe importva, importsz = datadirs[1] IndexError: list index out of range I: Analyzing C:\Python26\DLLs\select.pyd W: Cannot get binary dependencies for file: W: C:\Python26\DLLs\select.pyd W: Traceback (most recent call last): File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 608, in get Imports return _getImports_pe(pth) File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 275, in _ge tImports_pe importva, importsz = datadirs[1] IndexError: list index out of range I: Analyzing C:\Python26\DLLs\unicodedata.pyd W: Cannot get binary dependencies for file: W: C:\Python26\DLLs\unicodedata.pyd W: Traceback (most recent call last): File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 608, in get Imports return _getImports_pe(pth) File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 275, in _ge tImports_pe importva, importsz = datadirs[1] IndexError: list index out of range I: Analyzing C:\Python26\DLLs\bz2.pyd W: Cannot get binary dependencies for file: W: C:\Python26\DLLs\bz2.pyd W: Traceback (most recent call last): File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 608, in get Imports return _getImports_pe(pth) File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 275, in _ge tImports_pe importva, importsz = datadirs[1] IndexError: list index out of range I: Analyzing C:\Python26\python.exe I: Dependent assemblies of C:\Python26\python.exe: I: amd64_Microsoft.VC90.CRT_1fc8b3b9a1e18e3b_9.0.21022.8_none I: Searching for assembly amd64_Microsoft.VC90.CRT_1fc8b3b9a1e18e3b_9.0.21022.8_ none... I: Found manifest C:\Windows\WinSxS\Manifests\amd64_microsoft.vc90.crt_1fc8b3b9a 1e18e3b_9.0.21022.8_none_750b37ff97f4f68b.manifest I: Searching for file msvcr90.dll I: Found file C:\Windows\WinSxS\amd64_microsoft.vc90.crt_1fc8b3b9a1e18e3b_9.0.21 022.8_none_750b37ff97f4f68b\msvcr90.dll I: Searching for file msvcp90.dll I: Found file C:\Windows\WinSxS\amd64_microsoft.vc90.crt_1fc8b3b9a1e18e3b_9.0.21 022.8_none_750b37ff97f4f68b\msvcp90.dll I: Searching for file msvcm90.dll I: Found file C:\Windows\WinSxS\amd64_microsoft.vc90.crt_1fc8b3b9a1e18e3b_9.0.21 022.8_none_750b37ff97f4f68b\msvcm90.dll I: Adding Microsoft.VC90.CRT\Microsoft.VC90.CRT.manifest I: Adding Microsoft.VC90.CRT\msvcr90.dll I: Adding Microsoft.VC90.CRT\msvcp90.dll I: Adding Microsoft.VC90.CRT\msvcm90.dll W: Cannot get binary dependencies for file: W: C:\Python26\python.exe W: Traceback (most recent call last): File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 608, in get Imports return _getImports_pe(pth) File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 275, in _ge tImports_pe importva, importsz = datadirs[1] IndexError: list index out of range I: Analyzing C:\Windows\WinSxS\Manifests\amd64_microsoft.vc90.crt_1fc8b3b9a1e18e 3b_9.0.21022.8_none_750b37ff97f4f68b.manifest I: Analyzing C:\Windows\WinSxS\amd64_microsoft.vc90.crt_1fc8b3b9a1e18e3b_9.0.210 22.8_none_750b37ff97f4f68b\msvcr90.dll W: Cannot get binary dependencies for file: W: C:\Windows\WinSxS\amd64_microsoft.vc90.crt_1fc8b3b9a1e18e3b_9.0.21022.8_none_ 750b37ff97f4f68b\msvcr90.dll W: Traceback (most recent call last): File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 608, in get Imports return _getImports_pe(pth) File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 275, in _ge tImports_pe importva, importsz = datadirs[1] IndexError: list index out of range I: Analyzing C:\Windows\WinSxS\amd64_microsoft.vc90.crt_1fc8b3b9a1e18e3b_9.0.210 22.8_none_750b37ff97f4f68b\msvcp90.dll W: Cannot get binary dependencies for file: W: C:\Windows\WinSxS\amd64_microsoft.vc90.crt_1fc8b3b9a1e18e3b_9.0.21022.8_none_ 750b37ff97f4f68b\msvcp90.dll W: Traceback (most recent call last): File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 608, in get Imports return _getImports_pe(pth) File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 275, in _ge tImports_pe importva, importsz = datadirs[1] IndexError: list index out of range I: Analyzing C:\Windows\WinSxS\amd64_microsoft.vc90.crt_1fc8b3b9a1e18e3b_9.0.210 22.8_none_750b37ff97f4f68b\msvcm90.dll W: Cannot get binary dependencies for file: W: C:\Windows\WinSxS\amd64_microsoft.vc90.crt_1fc8b3b9a1e18e3b_9.0.21022.8_none_ 750b37ff97f4f68b\msvcm90.dll W: Traceback (most recent call last): File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 608, in get Imports return _getImports_pe(pth) File "C:\Python26\Pyinstaller\branches\py26win\bindepend.py", line 275, in _ge tImports_pe importva, importsz = datadirs[1] IndexError: list index out of range I: could not find TCL/TK I: testing for Zlib... I: ... Zlib available I: Testing for ability to set icons, version resources... I: ... resource update available I: Testing for Unicode support... I: ... Unicode available I: testing for UPX... I: ...UPX available I: computing PYZ dependencies... I: done generating C:\Python26\Pyinstaller\branches\py26win\config.dat My Python script (named Hello.py) is the same as the example: #!/usr/bin/env python for i in xrange(10000): print "Hello, World!" This is my BAT file, in the same directory: set PIP=C:\Python26\Pyinstaller\branches\py26win\ python %PIP%Makespec.py --onefile --console --upx --tk Hello.py python %PIP%Build.py Hello.spec When I run Hello.bat in the command prompt several files are made, none of which are an .exe file, and the following is displayed: C:\My Filesset PIP=C:\Python26\Pyinstaller\branches\py26win\ C:\My Filespython C:\Python26\Pyinstaller\branches\py26win\Makespec.py --onefil e --console --upx --tk Hello.py wrote C:\My Files\Hello.spec now run Build.py to build the executable C:\My Filespython C:\Python26\Pyinstaller\branches\py26win\Build.py Hello.spec I: Dependent assemblies of C:\Python26\python.exe: I: amd64_Microsoft.VC90.CRT_1fc8b3b9a1e18e3b_9.0.21022.8_none Traceback (most recent call last): File "C:\Python26\Pyinstaller\branches\py26win\Build.py", line 1359, in main(args[0], configfilename=opts.configfile) File "C:\Python26\Pyinstaller\branches\py26win\Build.py", line 1337, in main build(specfile) File "C:\Python26\Pyinstaller\branches\py26win\Build.py", line 1297, in build execfile(spec) File "Hello.spec", line 3, in pathex=['C:\My Files']) File "C:\Python26\Pyinstaller\branches\py26win\Build.py", line 292, in _init _ raise ValueError, "script '%s' not found" % script ValueError: script 'C:\Python26\Pyinstaller\branches\py26win\support\useTK.py' n ot found I have limited knowledge with the command prompt, so please take baby steps with me if I need to do something there.

    Read the article

  • Theme confusion in SpreadsheetML.

    - by dmaruca
    I've been fighting this all day. Inside my styles.xml file I have color information given like so: <fgColor theme="0" tint="-0.249977111117893" / ECMA 376 defines a theme color reference as: Index into the <clrScheme collection, referencing a particular <sysClr or <srgbClr value expressed in the Theme part. Ok, that sounds easy. Here is an excerpt from my clrScheme xml: <a:clrScheme name="Office" <a:dk1 <a:sysClr val="windowText" lastClr="000000" / </a:dk1 <a:lt1 <a:sysClr val="window" lastClr="FFFFFF" / </a:lt1 Index zero is black, and they are wanting to darken it? I can tell you that after the tint is applied, the color should be #F2F2F2. My confusion is what does theme="0" really mean? It can't possible mean to darken #000000. Checking MSDN only confuses me even more. From http://msdn.microsoft.com/en-us/library/dd560821.aspx note that the theme color integer begins counting from left to right in the palette starting with zero. Theme color 3 is the dark 2 text/background color. Actually, if you start counting at zero the third entry is Light 2. Dark 2 is the second one. Can anyone here shed some light on this subject for me? What does theme="0" really mean? Here is the VB6 code I have been working with to apply the tint. You can paste it into your vba editor and run the test sub. Public Type tRGB R As Byte G As Byte B As Byte End Type Public Type tHSL H As Double S As Double L As Double End Type Sub TestRgbTint() Dim c As tRGB RGB_Hex2Type "ffffff", c RGB_ApplyTint c, -0.249977111117893 Debug.Print Hex(c.R) & Hex(c.G) & Hex(c.B) End Sub Public Sub RGB_Hex2Type(ByVal HexString As String, RGB As tRGB) 'Remove the alpha channel if it exists If Len(HexString) = 8 Then HexString = mID(HexString, 3) End If RGB.R = CByte("&H" & Left(HexString, 2)) RGB.G = CByte("&H" & mID(HexString, 3, 2)) RGB.B = CByte("&H" & Right(HexString, 2)) End Sub Public Sub RGB_ApplyTint(RGB As tRGB, tint As Double) Const HLSMAX = 1# Dim HSL As tHSL If tint = 0 Then Exit Sub RGB2HSL RGB, HSL If tint < 0 Then HSL.L = HSL.L * (1# + tint) Else HSL.L = HSL.L * (1# - tint) + (HLSMAX - HLSMAX * (1# - tint)) End If HSL2RGB HSL, RGB End Sub Public Sub HSL2RGB(HSL As tHSL, RGB As tRGB) HSL2RGB_ByVal HSL.H, HSL.S, HSL.L, RGB End Sub Private Sub HSL2RGB_ByVal(ByVal H As Double, ByVal S As Double, ByVal L As Double, RGB As tRGB) Dim v As Double Dim R As Double, G As Double, B As Double 'Default color to gray R = L G = L B = L If L < 0.5 Then v = L * (1# + S) Else v = L + S - L * S End If If v > 0 Then Dim m As Double, sv As Double Dim sextant As Integer Dim fract As Double, vsf As Double, mid1 As Double, mid2 As Double m = L + L - v sv = (v - m) / v H = H * 6# sextant = Int(H) fract = H - sextant vsf = v * sv * fract mid1 = m + vsf mid2 = v - vsf Select Case sextant Case 0 R = v G = mid1 B = m Case 1 R = mid2 G = v B = m Case 2 R = m G = v B = mid1 Case 3 R = m G = mid2 B = v Case 4 R = mid1 G = m B = v Case 5 R = v G = m B = mid2 End Select End If RGB.R = R * 255# RGB.G = G * 255# RGB.B = B * 255# End Sub Public Sub RGB2HSL(RGB As tRGB, HSL As tHSL) Dim R As Double, G As Double, B As Double Dim v As Double, m As Double, vm As Double Dim r2 As Double, g2 As Double, b2 As Double R = RGB.R / 255# G = RGB.G / 255# B = RGB.B / 255# 'Default to black HSL.H = 0 HSL.S = 0 HSL.L = 0 v = IIf(R > G, R, G) v = IIf(v > B, v, B) m = IIf(R < G, R, G) m = IIf(m < B, m, B) HSL.L = (m + v) / 2# If HSL.L < 0 Then Exit Sub End If vm = v - m HSL.S = vm If HSL.S > 0 Then If HSL.L <= 0.5 Then HSL.S = HSL.S / (v + m) Else HSL.S = HSL.S / (2# - v - m) End If Else Exit Sub End If r2 = (v - R) / vm g2 = (v - G) / vm b2 = (v - B) / vm If R = v Then If G = m Then HSL.H = 5# + b2 Else HSL.H = 1# - g2 End If ElseIf G = v Then If B = m Then HSL.H = 1# + r2 Else HSL.H = 3# - b2 End If Else If R = m Then HSL.H = 3# + g2 Else HSL.H = 5# - r2 End If End If HSL.H = HSL.H / 6# End Sub

    Read the article

  • Couldn't get connection factory client - fighting with Google Maps

    - by iie
    another day another problem, I finally managed to set up correctly google maps on my android application, or at least I thought I've done it, the whole progam starts, it even call the class which should "print" a map, but the only thing I can see is a grid with google label on it [ in the corner ]. I've checked the dalvik monitor and the error E/MapActivity(394): Couldn't get connection factory client occurs. I've find out on stackoverflow website that I should sent a gps signal or sth like this from dalvik monitor, and I've done it. Nothing happend, also I got the api key one more time, but nothing changed. here is map.xml <?xml version="1.0" encoding="utf-8"?> <!-- This file is /res/layout/mapview.xml --> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:orientation="vertical" android:layout_width="fill_parent" android:layout_height="fill_parent"> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:orientation="horizontal" android:layout_width="fill_parent" android:layout_height="wrap_content"> <Button android:id="@+id/zoomin" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="+" android:onClick="myClickHandler" android:padding="12px" /> <Button android:id="@+id/zoomout" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="-" android:onClick="myClickHandler" android:padding="12px" /> <Button android:id="@+id/sat" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="Satellite" android:onClick="myClickHandler" android:padding="8px" /> <Button android:id="@+id/street" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="Street" android:onClick="myClickHandler" android:padding="8px" /> <Button android:id="@+id/traffic" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="Traffic" android:onClick="myClickHandler" android:padding="8px" /> <Button android:id="@+id/normal" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="Normal" android:onClick="myClickHandler" android:padding="8px" /> </LinearLayout> <com.google.android.maps.MapView android:id="@+id/mapview" android:layout_width="fill_parent" android:layout_height="wrap_content" android:clickable="true" android:apiKey="0zPcz1VYRSpLusufJ2JoL0ffl2uxDMovgpW319w" /> </LinearLayout> here is a MapMapa.java public class MapMapa extends MapActivity { private MapView mapView; @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.map); mapView = (MapView)findViewById(R.id.mapview); } public void myClickHandler(View target) { switch(target.getId()) { case R.id.zoomin: mapView.getController().zoomIn(); break; case R.id.zoomout: mapView.getController().zoomOut(); break; case R.id.sat: mapView.setSatellite(true); break; case R.id.street: mapView.setStreetView(true); break; case R.id.traffic: mapView.setTraffic(true); break; case R.id.normal: mapView.setSatellite(false); mapView.setStreetView(false); mapView.setTraffic(false); break; } } @Override protected boolean isLocationDisplayed() { return false; } @Override protected boolean isRouteDisplayed() { return false; } manifest.xml <?xml version="1.0" encoding="utf-8"?> <manifest xmlns:android="http://schemas.android.com/apk/res/android" package="menu.dot" android:versionCode="1" ndroid:versionName="1.0"> <application android:label="@string/app_name" android:icon="@drawable/icon"> <uses-library android:name="com.google.android.maps" /> <activity android:name="MainActivity" android:label="@string/app_name"> <intent-filter> <action android:name="android.intent.action.MAIN" /> <category android:name="android.intent.category.LAUNCHER" /> </intent-filter> </activity> <activity android:name=".About"> android:label="@string/about_title" android:theme="@android:style/Theme.Dialog" > </activity> <activity android:name=".Exit"> andorid:label="@string/exit_title"> </activity> <activity android:name=".Options"> </activity> <activity android:name=".Start"> </activity> <activity android:name=".Create"> </activity> <activity android:name=".Where"> </activity> <activity android:name=".Proceed"> </activity> <activity android:name=".Finish"> </activity> <activity android:name=".Login"> </activity> <activity android:name=".OK"> </activity> <activity android:name=".UserPanel"> </activity> <activity android:name=".Managero"> </activity> <activity android:name=".Edition"> </activity> <activity android:name=".Done"> </activity> <activity android:name=".Delete"> </activity> <activity android:name=".MapMapa"> </activity> </application> <uses-permission android:name="android.permission.ACCESS_FINE_LOCATION"/> <uses-permission android:name="android.permission.ACCESS_COARSE_LOCATION"/> <uses-permission android:name="android.permission.INTERNET"/> <uses-sdk android:minSdkVersion="3" /> </manifest>

    Read the article

  • Where is the virtual function call overhead?

    - by Semen Semenych
    Hello everybody, I'm trying to benchmark the difference between a function pointer call and a virtual function call. To do this, I have written two pieces of code, that do the same mathematical computation over an array. One variant uses an array of pointers to functions and calls those in a loop. The other variant uses an array of pointers to a base class and calls its virtual function, which is overloaded in the derived classes to do absolutely the same thing as the functions in the first variant. Then I print the time elapsed and use a simple shell script to run the benchmark many times and compute the average run time. Here is the code: #include <iostream> #include <cstdlib> #include <ctime> #include <cmath> using namespace std; long long timespecDiff(struct timespec *timeA_p, struct timespec *timeB_p) { return ((timeA_p->tv_sec * 1000000000) + timeA_p->tv_nsec) - ((timeB_p->tv_sec * 1000000000) + timeB_p->tv_nsec); } void function_not( double *d ) { *d = sin(*d); } void function_and( double *d ) { *d = cos(*d); } void function_or( double *d ) { *d = tan(*d); } void function_xor( double *d ) { *d = sqrt(*d); } void ( * const function_table[4] )( double* ) = { &function_not, &function_and, &function_or, &function_xor }; int main(void) { srand(time(0)); void ( * index_array[100000] )( double * ); double array[100000]; for ( long int i = 0; i < 100000; ++i ) { index_array[i] = function_table[ rand() % 4 ]; array[i] = ( double )( rand() / 1000 ); } struct timespec start, end; clock_gettime(CLOCK_PROCESS_CPUTIME_ID, &start); for ( long int i = 0; i < 100000; ++i ) { index_array[i]( &array[i] ); } clock_gettime(CLOCK_PROCESS_CPUTIME_ID, &end); unsigned long long time_elapsed = timespecDiff(&end, &start); cout << time_elapsed / 1000000000.0 << endl; } and here is the virtual function variant: #include <iostream> #include <cstdlib> #include <ctime> #include <cmath> using namespace std; long long timespecDiff(struct timespec *timeA_p, struct timespec *timeB_p) { return ((timeA_p->tv_sec * 1000000000) + timeA_p->tv_nsec) - ((timeB_p->tv_sec * 1000000000) + timeB_p->tv_nsec); } class A { public: virtual void calculate( double *i ) = 0; }; class A1 : public A { public: void calculate( double *i ) { *i = sin(*i); } }; class A2 : public A { public: void calculate( double *i ) { *i = cos(*i); } }; class A3 : public A { public: void calculate( double *i ) { *i = tan(*i); } }; class A4 : public A { public: void calculate( double *i ) { *i = sqrt(*i); } }; int main(void) { srand(time(0)); A *base[100000]; double array[100000]; for ( long int i = 0; i < 100000; ++i ) { array[i] = ( double )( rand() / 1000 ); switch ( rand() % 4 ) { case 0: base[i] = new A1(); break; case 1: base[i] = new A2(); break; case 2: base[i] = new A3(); break; case 3: base[i] = new A4(); break; } } struct timespec start, end; clock_gettime(CLOCK_PROCESS_CPUTIME_ID, &start); for ( int i = 0; i < 100000; ++i ) { base[i]->calculate( &array[i] ); } clock_gettime(CLOCK_PROCESS_CPUTIME_ID, &end); unsigned long long time_elapsed = timespecDiff(&end, &start); cout << time_elapsed / 1000000000.0 << endl; } My system is LInux, Fedora 13, gcc 4.4.2. The code is compiled it with g++ -O3. The first one is test1, the second is test2. Now I see this in console: [Ignat@localhost circuit_testing]$ ./test2 && ./test2 0.0153142 0.0153166 Well, more or less, I think. And then, this: [Ignat@localhost circuit_testing]$ ./test2 && ./test2 0.01531 0.0152476 Where are the 25% which should be visible? How can the first executable be even slower than the second one? I'm asking this because I'm doing a project which involves calling a lot of small functions in a row like this in order to compute the values of an array, and the code I've inherited does a very complex manipulation to avoid the virtual function call overhead. Now where is this famous call overhead?

    Read the article

  • Segmentation fault when running a python script/GTKBuilder app?

    - by pythonscript
    I'm trying to learn GUI programming using python2 and GTKBuilder, but I get a segmentation fault when I run the code. This is my file, created in Glade as a GTKBuilder file: <?xml version="1.0" encoding="UTF-8"?> <interface> <!-- interface-requires gtk+ 3.0 --> <object class="GtkWindow" id="mainWindow"> <property name="can_focus">False</property> <child> <object class="GtkBox" id="box1"> <property name="visible">True</property> <property name="can_focus">False</property> <property name="orientation">vertical</property> <child> <object class="GtkBox" id="box2"> <property name="visible">True</property> <property name="can_focus">False</property> <property name="halign">start</property> <property name="margin_left">146</property> <property name="margin_right">276</property> <child> <object class="GtkLabel" id="label1"> <property name="visible">True</property> <property name="can_focus">False</property> <property name="label" translatable="yes">label</property> </object> <packing> <property name="expand">True</property> <property name="fill">False</property> <property name="position">0</property> </packing> </child> <child> <object class="GtkEntry" id="entryName"> <property name="visible">True</property> <property name="can_focus">True</property> <property name="margin_bottom">4</property> <property name="hexpand">True</property> <property name="vexpand">True</property> <property name="invisible_char">?</property> <property name="placeholder_text">Please enter your name here...</property> </object> <packing> <property name="expand">True</property> <property name="fill">True</property> <property name="position">1</property> </packing> </child> </object> <packing> <property name="expand">False</property> <property name="fill">True</property> <property name="position">0</property> </packing> </child> <child> <object class="GtkButton" id="buttonWriteNameToFile"> <property name="label" translatable="yes">button</property> <property name="use_action_appearance">False</property> <property name="visible">True</property> <property name="can_focus">True</property> <property name="receives_default">True</property> <property name="use_action_appearance">False</property> <signal name="clicked" handler="buttonWriteNameToFile_clicked" swapped="no"/> </object> <packing> <property name="expand">False</property> <property name="fill">True</property> <property name="position">1</property> </packing> </child> <child> <placeholder/> </child> <child> <placeholder/> </child> </object> </child> </object> </interface> My python code, based on this question, is this: #!/usr/bin/env python import gtk class NameApp: def __init__(self): filename = "project.glade" builder = gtk.Builder() builder.add_from_file(filename) builder.connect_signals(self) builder.get_object("mainWindow").show_all() def buttonWriteNameToFile_clicked(self, widget): print("File write code...") if __name__ == "__main__": app = NameApp() gtk.main() Running the file with python2 yields this error: name.py:9: Warning: cannot create instance of abstract (non-instantiatable) type `GtkBox' builder.add_from_file(filename) ./geany_run_script.sh: line 5: 14897 Segmentation fault python2 "name.py" I thought I followed that example as closely as possible, and I don't see any differences outside of the GTKBuilder file. However, the example in the linked question runs successfully on my machine. I don't know if it's relevant, but I'm running Arch Linux x86_64.

    Read the article

  • NSXMLParser & memory leaks

    - by HBR
    Hi, I am parsing an XML file using a custom class that instanciates & uses NSXMLParser. On the first call everything is fine but on the second, third and later calls Instruments show tens of memory leaks on certain lines inside didEndElement, didEndElement and foundCharacters functions. I googled it and found some people having this issue, but I didn't find anything that could really help me. My Parser class looks like this : Parser.h @interface XMLParser : NSObject { NSMutableArray *data; NSMutableString *currentValue; NSArray *xml; NSMutableArray *videos; NSMutableArray *photos; NSXMLParser *parser; NSURLConnection *feedConnection; NSMutableData *downloadedData; Content *content; Video *video; BOOL nowPhoto; BOOL nowVideo; BOOL finished; BOOL webTV; } -(void)parseXML:(NSURL*)xmlURL; -(int)getCount; -(NSArray*)getData; //- (void)handleError:(NSError *)error; //@property(nonatomic, retain) NSMutableString *currentValue; @property(nonatomic, retain) NSURLConnection *feedConnection; @property(nonatomic, retain) NSMutableData *downloadedData; @property(nonatomic, retain) NSArray *xml; @property(nonatomic, retain) NSXMLParser *parser; @property(nonatomic, retain) NSMutableArray *data; @property(nonatomic, retain) NSMutableArray *photos; @property(nonatomic, retain) NSMutableArray *videos; @property(nonatomic, retain) Content *content; @property(nonatomic, retain) Video *video; @property(nonatomic) BOOL finished; @property(nonatomic) BOOL nowPhoto; @property(nonatomic) BOOL nowVideo; @property(nonatomic) BOOL webTV; @end Parser.m #import "Content.h" #import "Video.h" #import "Parser.h" #import <CFNetwork/CFNetwork.h> @implementation XMLParser @synthesize xml, parser, finished, nowPhoto, nowVideo, webTV; @synthesize feedConnection, downloadedData, data, content, photos, videos, video; -(void)parseXML:(NSURL*)xmlURL { /* NSURLRequest *req = [NSURLRequest requestWithURL:xmlURL]; self.feedConnection = [[[NSURLConnection alloc] initWithRequest:req delegate:self] autorelease]; [UIApplication sharedApplication].networkActivityIndicatorVisible = YES; */ [[NSURLCache sharedURLCache] setMemoryCapacity:0]; [[NSURLCache sharedURLCache] setDiskCapacity:0]; NSXMLParser *feedParser = [[NSXMLParser alloc] initWithContentsOfURL:xmlURL]; //NSXMLParser *feedParser = [[NSXMLParser alloc] initWithData:theXML]; [self setParser:feedParser]; [feedParser release]; [[self parser] setDelegate:self]; [[self parser] setShouldResolveExternalEntities:YES]; [[self parser] parse]; } - (void)parser:(NSXMLParser *)parser didStartElement:(NSString *)elementName namespaceURI:(NSString *)namespaceURI qualifiedName:(NSString *)qualifiedName attributes:(NSDictionary *)attributeDict { if ([elementName isEqualToString:@"articles"]) { self.finished = NO; self.nowPhoto = NO; self.nowVideo = NO; self.webTV = NO; if (!data) { NSMutableArray *tmp = [[NSMutableArray alloc] init]; [self setData:tmp]; [tmp release]; return ; } } if ([elementName isEqualToString:@"WebTV"]) { self.finished = NO; self.nowPhoto = NO; self.nowVideo = NO; self.webTV = YES; if (!data) { NSMutableArray *tmp = [[NSMutableArray alloc] init]; [self setData:tmp]; [tmp release]; return ; } } if ([elementName isEqualToString:@"photos"]) { if (!photos) { NSMutableArray *tmp = [[NSMutableArray alloc] init]; [self setPhotos:tmp]; [tmp release]; return; } } if ([elementName isEqualToString:@"videos"]) { if (!videos) { NSMutableArray *tmp = [[NSMutableArray alloc] init]; [self setVideos:tmp]; [tmp release]; return; } } if ([elementName isEqualToString:@"photo"]) { self.nowPhoto = YES; self.nowVideo = NO; } if ([elementName isEqualToString:@"video"]) { self.nowPhoto = NO; self.nowVideo = YES; } if ([elementName isEqualToString:@"WebTVItem"]) { if (!video) { Video *tmp = [[Video alloc] init]; [self setVideo:tmp]; [tmp release]; } NSString *videoId = [attributeDict objectForKey:@"id"]; [[self video] setVideoId:[videoId intValue]]; } if ([elementName isEqualToString:@"article"]) { if (!content) { Content *tmp = [[Content alloc] init]; [self setContent:tmp]; [tmp release]; } NSString *contentId = [attributeDict objectForKey:@"id"]; [[self content] setContentId:[contentId intValue]]; return; } if ([elementName isEqualToString:@"category"]) { NSString *categoryId = [attributeDict objectForKey:@"id"]; NSString *parentId = [attributeDict objectForKey:@"parent"]; [[self content] setCategoryId:[categoryId intValue]]; [[self content] setParentId:[parentId intValue]]; categoryId = nil; parentId = nil; return; } if ([elementName isEqualToString:@"vCategory"]) { NSString *categoryId = [attributeDict objectForKey:@"id"]; NSString *parentId = [attributeDict objectForKey:@"parent"]; [[self video] setCategoryId:[categoryId intValue]]; [[self video] setParentId:[parentId intValue]]; categoryId = nil; parentId = nil; return; } } - (void)parser:(NSXMLParser *)parser foundCharacters:(NSString *)string { if (!currentValue) { currentValue = [[NSMutableString alloc] initWithCapacity:1000]; } if (currentValue != @"\n") [currentValue appendString:string]; } - (void)parser:(NSXMLParser *)parser didEndElement:(NSString *)elementName namespaceURI:(NSString *)namespaceURI qualifiedName:(NSString *)qName { NSString *cleanValue = [currentValue stringByReplacingOccurrencesOfString:@"\n" withString:@""] ; if ([elementName isEqualToString:@"articles"]) { self.finished = YES; //[content release]; } if ([elementName isEqualToString:@"article"]) { [[self data] addObject:[self content]]; [self setContent:nil]; [self setPhotos:nil]; [self setVideos:nil]; /* [content release]; content = nil; [videos release]; videos = nil; [photos release]; photos = nil; */ } if ([elementName isEqualToString:@"WebTVItem"]) { [[self data] addObject:[self video]]; [self setVideo:nil]; //[video release]; //video = nil; } if ([elementName isEqualToString:@"title"]) { //NSLog(@"Tit: %@",cleanValue); [[self content] setTitle:cleanValue]; } if ([elementName isEqualToString:@"vTitle"]) { [[self video] setTitle:cleanValue]; } if ([elementName isEqualToString:@"link"]) { //NSURL *url = [[NSURL alloc] initWithString:cleanValue] ; [[self content] setUrl:[NSURL URLWithString:cleanValue]]; [[self content] setLink: cleanValue]; //[url release]; //url = nil; } if ([elementName isEqualToString:@"vLink"]) { [[self video] setLink:cleanValue]; [[self video] setUrl:[NSURL URLWithString:cleanValue]]; } if ([elementName isEqualToString:@"teaser"]) { NSString *tmp = [cleanValue stringByReplacingOccurrencesOfString:@"##BREAK##" withString:@"\n"]; [[self content] setTeaser:tmp]; tmp = nil; } if ([elementName isEqualToString:@"content"]) { NSString *tmp = [cleanValue stringByReplacingOccurrencesOfString:@"##BREAK##" withString:@"\n"]; [[self content] setContent:tmp]; tmp = nil; } if ([elementName isEqualToString:@"category"]) { [[self content] setCategory:cleanValue]; } if ([elementName isEqualToString:@"vCategory"]) { [[self video] setCategory:cleanValue]; } if ([elementName isEqualToString:@"date"]) { [[self content] setDate:cleanValue]; } if ([elementName isEqualToString:@"vDate"]) { [[self video] setDate:cleanValue]; } if ([elementName isEqualToString:@"thumbnail"]) { [[self content] setThumbnail:[NSURL URLWithString:cleanValue]]; [[self content] setThumbnailURL:cleanValue]; } if ([elementName isEqualToString:@"vThumbnail"]) { [[self video] setThumbnailURL:cleanValue]; [[self video] setThumbnail:[NSURL URLWithString:cleanValue]]; } if ([elementName isEqualToString:@"vDirectLink"]){ [[self video] setDirectLink: cleanValue]; } if ([elementName isEqualToString:@"preview"]){ [[self video] setPreview: cleanValue]; } if ([elementName isEqualToString:@"thumbnail_position"]){ [[self content] setThumbnailPosition: cleanValue]; } if ([elementName isEqualToString:@"url"]) { if (self.nowPhoto == YES) { [[self photos] addObject:cleanValue]; } else if (self.nowVideo == YES) { [[self videos] addObject:cleanValue]; } } if ([elementName isEqualToString:@"photos"]) { [[self content] setPhotos:[self photos]]; //[photos release]; //photos = nil; self.nowPhoto = NO; } if ([elementName isEqualToString:@"videos"]) { [[self content] setVideos:[self videos]]; //[videos release]; //videos = nil; self.nowVideo = NO; } //[cleanValue release]; //cleanValue = nil; [currentValue release]; currentValue = nil; } - (void)parser:(NSXMLParser *)parser parseErrorOccurred:(NSError *)parseError { UIAlertView *alert = [[UIAlertView alloc] initWithTitle:nil message:@"Error" delegate:self cancelButtonTitle:@"OK" otherButtonTitles:nil]; [alert show]; [alert release]; } -(NSArray*)getData { return data; } -(int)getCount { return [data count]; } - (void)dealloc { [parser release]; //[data release]; //[photos release]; //[videos release]; //[video release]; //[content release]; [currentValue release]; [super dealloc]; } @end Somewhere in my code, I create an instance of this class : XMLParser* feed = [[XMLParser alloc] init]; [self setRssParser:feed]; [feed release]; // Parse feed NSString *url = [NSString stringWithFormat:@"MyXMLURL"]; [[self rssParser] parseXML:[NSURL URLWithString:url]]; Now the problem is that after the first (which has zero leaks), instruments shows leaks in too many parts like this one (they are too much to enumerate them all, but all the calls look the same, I made the leaking line bold) : in didEndElement : if ([elementName isEqualToString:@"link"]) { // THIS LINE IS LEAKING => INSTRUMENTS SAYS IT IS A NSCFString LEAK [self content] setUrl:[NSURL URLWithString:cleanValue]]; [[self content] setLink: cleanValue]; } Any idea how to fix this pealse ? Could this be the same problem as the one mentioned (as an apple bug) by Lee Amtrong here :http://stackoverflow.com/questions/1598928/nsxmlparser-leaking

    Read the article

  • JSF : able to do mass update but unable to update a single row in a datatable

    - by nash
    I have a simple data object: Car. I am showing the properties of Car objects in a JSF datatable. If i display the properties using inputText tags, i am able to get the modified values in the managed bean. However i just want a single row editable. So have placed a edit button in a separate column and inputText and outputText for every property of Car. the edit button just toggles the rendering of inputText and outputText. Plus i placed a update button in a separate column which is used to save the updated values. However on clicking the update button, i still get the old values instead of the modified values. Here is the complete code: public class Car { int id; String brand; String color; public Car(int id, String brand, String color) { this.id = id; this.brand = brand; this.color = color; } //getters and setters of id, brand, color } Here is the managed bean: import java.util.ArrayList; import java.util.List; import javax.faces.bean.ManagedBean; import javax.faces.bean.RequestScoped; import javax.faces.component.UIData; @ManagedBean(name = "CarTree") @RequestScoped public class CarTree { int editableRowId; List<Car> carList; private UIData myTable; public CarTree() { carList = new ArrayList<Car>(); carList.add(new Car(1, "jaguar", "grey")); carList.add(new Car(2, "ferari", "red")); carList.add(new Car(3, "camri", "steel")); } public String update() { System.out.println("updating..."); //below statments print old values, was expecting modified values System.out.println("new car brand is:" + ((Car) myTable.getRowData()).brand); System.out.println("new car color is:" + ((Car) myTable.getRowData()).color); //how to get modified row values in this method?? return null; } public int getEditableRowId() { return editableRowId; } public void setEditableRowId(int editableRowId) { this.editableRowId = editableRowId; } public UIData getMyTable() { return myTable; } public void setMyTable(UIData myTable) { this.myTable = myTable; } public List<Car> getCars() { return carList; } public void setCars(List<Car> carList) { this.carList = carList; } } here is the JSF 2 page: <?xml version='1.0' encoding='UTF-8' ?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core"> <h:head> <title>Facelet Title</title> </h:head> <h:body> <h:form id="carForm" prependId="false"> <h:dataTable id="dt" binding="#{CarTree.myTable}" value="#{CarTree.cars}" var="car" > <h:column> <h:outputText value="#{car.id}" /> </h:column> <h:column> <h:outputText value="#{car.brand}" rendered="#{CarTree.editableRowId != car.id}"/> <h:inputText value="#{car.brand}" rendered="#{CarTree.editableRowId == car.id}"/> </h:column> <h:column> <h:outputText value="#{car.color}" rendered="#{CarTree.editableRowId != car.id}"/> <h:inputText value="#{car.color}" rendered="#{CarTree.editableRowId == car.id}"/> </h:column> <h:column> <h:commandButton value="edit"> <f:setPropertyActionListener target="#{CarTree.editableRowId}" value="#{car.id}" /> </h:commandButton> </h:column> <h:column> <h:commandButton value="update" action="#{CarTree.update}"/> </h:column> </h:dataTable> </h:form> </h:body> </html> However if i just keep the inputText tags and remove the rendered attributes, i get the modified values in the update method. How can i get the modified values for the single row edit?

    Read the article

  • Threading extra state through a parser in Scala

    - by Travis Brown
    I'll give you the tl;dr up front I'm trying to use the state monad transformer in Scalaz 7 to thread extra state through a parser, and I'm having trouble doing anything useful without writing a lot of t m a -> t m b versions of m a -> m b methods. An example parsing problem Suppose I have a string containing nested parentheses with digits inside them: val input = "((617)((0)(32)))" I also have a stream of fresh variable names (characters, in this case): val names = Stream('a' to 'z': _*) I want to pull a name off the top of the stream and assign it to each parenthetical expression as I parse it, and then map that name to a string representing the contents of the parentheses, with the nested parenthetical expressions (if any) replaced by their names. To make this more concrete, here's what I'd want the output to look like for the example input above: val target = Map( 'a' -> "617", 'b' -> "0", 'c' -> "32", 'd' -> "bc", 'e' -> "ad" ) There may be either a string of digits or arbitrarily many sub-expressions at a given level, but these two kinds of content won't be mixed in a single parenthetical expression. To keep things simple, we'll assume that the stream of names will never contain either duplicates or digits, and that it will always contain enough names for our input. Using parser combinators with a bit of mutable state The example above is a slightly simplified version of the parsing problem in this Stack Overflow question. I answered that question with a solution that looked roughly like this: import scala.util.parsing.combinator._ class ParenParser(names: Iterator[Char]) extends RegexParsers { def paren: Parser[List[(Char, String)]] = "(" ~> contents <~ ")" ^^ { case (s, m) => (names.next -> s) :: m } def contents: Parser[(String, List[(Char, String)])] = "\\d+".r ^^ (_ -> Nil) | rep1(paren) ^^ ( ps => ps.map(_.head._1).mkString -> ps.flatten ) def parse(s: String) = parseAll(paren, s).map(_.toMap) } It's not too bad, but I'd prefer to avoid the mutable state. What I want Haskell's Parsec library makes adding user state to a parser trivially easy: import Control.Applicative ((*>), (<$>), (<*)) import Data.Map (fromList) import Text.Parsec paren = do (s, m) <- char '(' *> contents <* char ')' h : t <- getState putState t return $ (h, s) : m where contents = flip (,) [] <$> many1 digit <|> (\ps -> (map (fst . head) ps, concat ps)) <$> many1 paren main = print $ runParser (fromList <$> paren) ['a'..'z'] "example" "((617)((0)(32)))" This is a fairly straightforward translation of my Scala parser above, but without mutable state. What I've tried I'm trying to get as close to the Parsec solution as I can using Scalaz's state monad transformer, so instead of Parser[A] I'm working with StateT[Parser, Stream[Char], A]. I have a "solution" that allows me to write the following: import scala.util.parsing.combinator._ import scalaz._, Scalaz._ object ParenParser extends ExtraStateParsers[Stream[Char]] with RegexParsers { protected implicit def monadInstance = parserMonad(this) def paren: ESP[List[(Char, String)]] = (lift("(" ) ~> contents <~ lift(")")).flatMap { case (s, m) => get.flatMap( names => put(names.tail).map(_ => (names.head -> s) :: m) ) } def contents: ESP[(String, List[(Char, String)])] = lift("\\d+".r ^^ (_ -> Nil)) | rep1(paren).map( ps => ps.map(_.head._1).mkString -> ps.flatten ) def parse(s: String, names: Stream[Char]) = parseAll(paren.eval(names), s).map(_.toMap) } This works, and it's not that much less concise than either the mutable state version or the Parsec version. But my ExtraStateParsers is ugly as sin—I don't want to try your patience more than I already have, so I won't include it here (although here's a link, if you really want it). I've had to write new versions of every Parser and Parsers method I use above for my ExtraStateParsers and ESP types (rep1, ~>, <~, and |, in case you're counting). If I had needed to use other combinators, I'd have had to write new state transformer-level versions of them as well. Is there a cleaner way to do this? I'd love to see an example of a Scalaz 7's state monad transformer being used to thread state through a parser, but Scala 6 or Haskell examples would also be useful.

    Read the article

  • Get CoreLocation Update before TableView population?

    - by Clemens
    hi, i have the corelocation stuff in an uitableview controller. i actually want to get a distance from two locations and print that distance in a tableview cell. the problem is, that the tableview is filled before all the corelocation stuff happens. how can i make corelocation makes all updates before the table is filled? heres my class: // // EntriesListViewController.m // OEAW_App // // Created by Clemens on 6/6/10. // Copyright 2010 MyCompanyName. All rights reserved. // import "EntriesListViewController.h" import "EntryDetailController.h" @implementation EntriesListViewController @synthesize locationManager; @synthesize delegate; NSMutableDictionary *entries; NSMutableDictionary *dictionary; CLLocation *coords; /- (id) init { self = [super init]; if (self != nil) { self.locationManager = [[[CLLocationManager alloc] init] autorelease]; self.locationManager.delegate = self; } return self; }/ (CLLocationManager *)locationManager { if (locationManager != nil) { return locationManager; } locationManager = [[CLLocationManager alloc] init]; locationManager.desiredAccuracy = kCLLocationAccuracyNearestTenMeters; locationManager.delegate = self; return locationManager; } (void)locationManager:(CLLocationManager *)manager didUpdateToLocation:(CLLocation *)newLocation fromLocation:(CLLocation *)oldLocation { //coords.longitude = newLocation.coordinate.longitude; //coords.latitude = newLocation.coordinate.latitude; coords = newLocation; NSLog(@"Location: %@", [newLocation description]); } (void)locationManager:(CLLocationManager *)manager didFailWithError:(NSError *)error { NSLog(@"Error: %@", [error description]); } (void)viewDidLoad { //[[MyCLController alloc] init]; //[locationManager startUpdatingLocation]; [[self locationManager] startUpdatingLocation]; //---initialize the array--- //entries = [[NSMutableArray alloc] init]; //---add items--- //NSString *Path = [[NSBundle mainBundle] bundlePath]; //NSString *DataPath = [Path stringByAppendingPathComponent:@"Memorials.plist"]; dictionary = [[NSDictionary alloc] initWithContentsOfURL:[NSURL URLWithString: @"http://akm.madison.at/memorials.xml"]]; /*NSDictionary *dssItem = [dictionary objectForKey:@"1"]; NSString *text = [dssItem objectForKey:@"text"]; */ //entries = [[NSMutableDictionary alloc] init]; NSLog(@"%@", dictionary); //Path get the path to MyTestList.plist NSString *path=[[NSBundle mainBundle] pathForResource:@"Memorials" ofType:@"plist"]; //Next create the dictionary from the contents of the file. NSDictionary *dict=[NSDictionary dictionaryWithContentsOfFile:path]; //now we can use the items in the file. // self.name.text = [dict valueForKey:@"Name"] ; NSLog(@"%@",[dict valueForKey:@"Name"]); //---set the title--- self.navigationItem.title = @"Türkendenkmäler"; [super viewDidLoad]; } (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { // Return the number of sections. return 1; } (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { // Return the number of rows in the section. return [dictionary count]; } // Customize the appearance of table view cells. - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { static NSString *CellIdentifier = @"Cell"; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithStyle:UITableViewCellStyleValue1 reuseIdentifier:CellIdentifier] autorelease]; } // Configure the cell... NSArray *keys = [dictionary allKeys]; id key = [keys objectAtIndex:indexPath.row]; NSDictionary *tmp = [dictionary objectForKey:key]; NSString *name = [tmp objectForKey:@"name"]; cell.textLabel.text = name; cell.font = [UIFont fontWithName:@"Helvetica" size:12.0]; CLLocation *location = [[CLLocation alloc] initWithLatitude:[[tmp valueForKey:@"coords_x"] floatValue] longitude:[[tmp valueForKey:@"coords_y"] floatValue]]; /*CLLocation *newLoc = [[CLLocation alloc] initWithLatitude:coords.latitude longitude:coords.longitude];*/ //locationController = [[MyCLController alloc] init]; int distance = [coords distanceFromLocation:location]; NSLog(@"%@",distance); cell.detailTextLabel.text = [NSString stringWithFormat:@"%@m",distance]; //NSLog(@"%@", [getLocation newLoc]); return cell; } (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { EntryDetailController *detailViewController = [[EntryDetailController alloc] initWithNibName:@"EntryDetailController" bundle:nil]; //detailViewController.entrySelected = [dictionary objectAtIndex:indexPath.row]; NSArray *keys = [dictionary allKeys]; id key = [keys objectAtIndex:indexPath.row]; NSDictionary *tmp = [dictionary objectForKey:key]; NSString *name = [tmp objectForKey:@"name"]; detailViewController.entrySelected_name = name; NSString *location = [tmp objectForKey:@"location"]; detailViewController.entrySelected_location = location; NSString *type = [tmp objectForKey:@"type"]; detailViewController.entrySelected_type = type; NSString *slug = [tmp objectForKey:@"slug"]; detailViewController.entrySelected_slug = slug; [self.navigationController pushViewController:detailViewController animated:YES]; [detailViewController release]; } (void)didReceiveMemoryWarning { [super didReceiveMemoryWarning]; } (void)dealloc { [entries release]; [super dealloc]; } @end

    Read the article

  • Maddening Linked List problem

    - by Mike
    This has been plaguing me for weeks. It's something really simple, I know it. Every time I print a singly linked list, it prints an address at the end of the list. #include <iostream> using namespace std; struct node { int info; node *link; }; node *before(node *head); node *after(node *head); void middle(node *head, node *ptr); void reversep(node *head, node *ptr); node *head, *ptr, *newnode; int main() { head = NULL; ptr = NULL; newnode = new node; head = newnode; for(int c1=1;c1<11;c1++) { newnode->info = c1; ptr = newnode; newnode = new node; ptr->link = newnode; ptr = ptr->link; } ptr->link=NULL; head = before(head); head = after(head); middle(head, ptr); //reversep(head, ptr); ptr = head; cout<<ptr->info<<endl; while(ptr->link!=NULL) { ptr=ptr->link; cout<<ptr->info<<endl; } system("Pause"); return 0; } node *before(node *head) { node *befnode; befnode = new node; cout<<"What should go before the list?"<<endl; cin>>befnode->info; befnode->link = head; head = befnode; return head; } node *after(node *head) { node *afnode, *ptr2; afnode = new node; ptr2 = head; cout<<"What should go after the list?"<<endl; cin>>afnode->info; ptr2 = afnode; afnode->link=NULL; ptr2 = head; return ptr2; } void middle(node *head, node *ptr) { int c1 = 0, c2 = 0; node *temp, *midnode; ptr = head; while(ptr->link->link!=NULL) { ptr=ptr->link; c1++; } c1/=2; c1-=1; ptr = head; while(c2<c1) { ptr=ptr->link; c2++; } midnode = new node; cout<<"What should go in the middle of the list?"<<endl; cin>>midnode->info; cout<<endl; temp=ptr->link; ptr->link=midnode; midnode->link=temp; } void reversep(node *head, node *ptr) { node *last, *ptr2; ptr=head; ptr2=head; while(ptr->link!=NULL) ptr = ptr->link; last = ptr; cout<<last->info; while(ptr!=head) { while(ptr2->link!=ptr) ptr2=ptr2->link; ptr = ptr2; cout<<ptr->info; } } I'll admit that this is class work, but even the professor can't figure it out, and says that its probably something insignificant that we're overlooking, but I can't put my mind to rest until I find out what it is.

    Read the article

  • Of these 3 methods for reading linked lists from shared memory, why is the 3rd fastest?

    - by Joseph Garvin
    I have a 'server' program that updates many linked lists in shared memory in response to external events. I want client programs to notice an update on any of the lists as quickly as possible (lowest latency). The server marks a linked list's node's state_ as FILLED once its data is filled in and its next pointer has been set to a valid location. Until then, its state_ is NOT_FILLED_YET. I am using memory barriers to make sure that clients don't see the state_ as FILLED before the data within is actually ready (and it seems to work, I never see corrupt data). Also, state_ is volatile to be sure the compiler doesn't lift the client's checking of it out of loops. Keeping the server code exactly the same, I've come up with 3 different methods for the client to scan the linked lists for changes. The question is: Why is the 3rd method fastest? Method 1: Round robin over all the linked lists (called 'channels') continuously, looking to see if any nodes have changed to 'FILLED': void method_one() { std::vector<Data*> channel_cursors; for(ChannelList::iterator i = channel_list.begin(); i != channel_list.end(); ++i) { Data* current_item = static_cast<Data*>(i->get(segment)->tail_.get(segment)); channel_cursors.push_back(current_item); } while(true) { for(std::size_t i = 0; i < channel_list.size(); ++i) { Data* current_item = channel_cursors[i]; ACQUIRE_MEMORY_BARRIER; if(current_item->state_ == NOT_FILLED_YET) { continue; } log_latency(current_item->tv_sec_, current_item->tv_usec_); channel_cursors[i] = static_cast<Data*>(current_item->next_.get(segment)); } } } Method 1 gave very low latency when then number of channels was small. But when the number of channels grew (250K+) it became very slow because of looping over all the channels. So I tried... Method 2: Give each linked list an ID. Keep a separate 'update list' to the side. Every time one of the linked lists is updated, push its ID on to the update list. Now we just need to monitor the single update list, and check the IDs we get from it. void method_two() { std::vector<Data*> channel_cursors; for(ChannelList::iterator i = channel_list.begin(); i != channel_list.end(); ++i) { Data* current_item = static_cast<Data*>(i->get(segment)->tail_.get(segment)); channel_cursors.push_back(current_item); } UpdateID* update_cursor = static_cast<UpdateID*>(update_channel.tail_.get(segment)); while(true) { if(update_cursor->state_ == NOT_FILLED_YET) { continue; } ::uint32_t update_id = update_cursor->list_id_; Data* current_item = channel_cursors[update_id]; if(current_item->state_ == NOT_FILLED_YET) { std::cerr << "This should never print." << std::endl; // it doesn't continue; } log_latency(current_item->tv_sec_, current_item->tv_usec_); channel_cursors[update_id] = static_cast<Data*>(current_item->next_.get(segment)); update_cursor = static_cast<UpdateID*>(update_cursor->next_.get(segment)); } } Method 2 gave TERRIBLE latency. Whereas Method 1 might give under 10us latency, Method 2 would inexplicably often given 8ms latency! Using gettimeofday it appears that the change in update_cursor-state_ was very slow to propogate from the server's view to the client's (I'm on a multicore box, so I assume the delay is due to cache). So I tried a hybrid approach... Method 3: Keep the update list. But loop over all the channels continuously, and within each iteration check if the update list has updated. If it has, go with the number pushed onto it. If it hasn't, check the channel we've currently iterated to. void method_three() { std::vector<Data*> channel_cursors; for(ChannelList::iterator i = channel_list.begin(); i != channel_list.end(); ++i) { Data* current_item = static_cast<Data*>(i->get(segment)->tail_.get(segment)); channel_cursors.push_back(current_item); } UpdateID* update_cursor = static_cast<UpdateID*>(update_channel.tail_.get(segment)); while(true) { for(std::size_t i = 0; i < channel_list.size(); ++i) { std::size_t idx = i; ACQUIRE_MEMORY_BARRIER; if(update_cursor->state_ != NOT_FILLED_YET) { //std::cerr << "Found via update" << std::endl; i--; idx = update_cursor->list_id_; update_cursor = static_cast<UpdateID*>(update_cursor->next_.get(segment)); } Data* current_item = channel_cursors[idx]; ACQUIRE_MEMORY_BARRIER; if(current_item->state_ == NOT_FILLED_YET) { continue; } found_an_update = true; log_latency(current_item->tv_sec_, current_item->tv_usec_); channel_cursors[idx] = static_cast<Data*>(current_item->next_.get(segment)); } } } The latency of this method was as good as Method 1, but scaled to large numbers of channels. The problem is, I have no clue why. Just to throw a wrench in things: if I uncomment the 'found via update' part, it prints between EVERY LATENCY LOG MESSAGE. Which means things are only ever found on the update list! So I don't understand how this method can be faster than method 2. The full, compilable code (requires GCC and boost-1.41) that generates random strings as test data is at: http://pastebin.com/e3HuL0nr

    Read the article

  • How to get predecessor and successors from an adjacency matrix

    - by NickTFried
    Hi I am am trying to complete an assignment, where it is ok to consult the online community. I have to create a graph class that ultimately can do Breadth First Search and Depth First Search. I have been able to implement those algorithms successfully however another requirement is to be able to get the successors and predecessors and detect if two vertices are either predecessors or successors for each other. I'm having trouble thinking of a way to do this. I will post my code below, if anyone has any suggestions it would be greatly appreciated. import java.util.ArrayList; import java.util.Iterator; import java.util.LinkedList; import java.util.Queue; import java.util.Stack; public class Graph<T> { public Vertex<T> root; public ArrayList<Vertex<T>> vertices=new ArrayList<Vertex<T>>(); public int[][] adjMatrix; int size; private ArrayList<Vertex<T>> dfsArrList; private ArrayList<Vertex<T>> bfsArrList; public void setRootVertex(Vertex<T> n) { this.root=n; } public Vertex<T> getRootVertex() { return this.root; } public void addVertex(Vertex<T> n) { vertices.add(n); } public void removeVertex(int loc){ vertices.remove(loc); } public void addEdge(Vertex<T> start,Vertex<T> end) { if(adjMatrix==null) { size=vertices.size(); adjMatrix=new int[size][size]; } int startIndex=vertices.indexOf(start); int endIndex=vertices.indexOf(end); adjMatrix[startIndex][endIndex]=1; adjMatrix[endIndex][startIndex]=1; } public void removeEdge(Vertex<T> v1, Vertex<T> v2){ int startIndex=vertices.indexOf(v1); int endIndex=vertices.indexOf(v2); adjMatrix[startIndex][endIndex]=1; adjMatrix[endIndex][startIndex]=1; } public int countVertices(){ int ver = vertices.size(); return ver; } /* public boolean isPredecessor( Vertex<T> a, Vertex<T> b){ for() return true; }*/ /* public boolean isSuccessor( Vertex<T> a, Vertex<T> b){ for() return true; }*/ public void getSuccessors(Vertex<T> v1){ } public void getPredessors(Vertex<T> v1){ } private Vertex<T> getUnvisitedChildNode(Vertex<T> n) { int index=vertices.indexOf(n); int j=0; while(j<size) { if(adjMatrix[index][j]==1 && vertices.get(j).visited==false) { return vertices.get(j); } j++; } return null; } public Iterator<Vertex<T>> bfs() { Queue<Vertex<T>> q=new LinkedList<Vertex<T>>(); q.add(this.root); printVertex(this.root); root.visited=true; while(!q.isEmpty()) { Vertex<T> n=q.remove(); Vertex<T> child=null; while((child=getUnvisitedChildNode(n))!=null) { child.visited=true; bfsArrList.add(child); q.add(child); } } clearVertices(); return bfsArrList.iterator(); } public Iterator<Vertex<T>> dfs() { Stack<Vertex<T>> s=new Stack<Vertex<T>>(); s.push(this.root); root.visited=true; printVertex(root); while(!s.isEmpty()) { Vertex<T> n=s.peek(); Vertex<T> child=getUnvisitedChildNode(n); if(child!=null) { child.visited=true; dfsArrList.add(child); s.push(child); } else { s.pop(); } } clearVertices(); return dfsArrList.iterator(); } private void clearVertices() { int i=0; while(i<size) { Vertex<T> n=vertices.get(i); n.visited=false; i++; } } private void printVertex(Vertex<T> n) { System.out.print(n.label+" "); } }

    Read the article

  • capturing video from ip camera

    - by Ruby
    I am trying to capture video from ip camera into my application , its giving exception com.sun.image.codec.jpeg.ImageFormatException: Not a JPEG file: starts with 0x0d 0x0a at sun.awt.image.codec.JPEGImageDecoderImpl.readJPEGStream(Native Method) at sun.awt.image.codec.JPEGImageDecoderImpl.decodeAsBufferedImage(Unknown Source) at test.AxisCamera1.readJPG(AxisCamera1.java:130) at test.AxisCamera1.readMJPGStream(AxisCamera1.java:121) at test.AxisCamera1.readStream(AxisCamera1.java:100) at test.AxisCamera1.run(AxisCamera1.java:171) at java.lang.Thread.run(Unknown Source) its giving exception at image = decoder.decodeAsBufferedImage(); Here is the code i am trying private static final long serialVersionUID = 1L; public boolean useMJPGStream = true; public String jpgURL = "http://ip here/video.cgi/jpg/image.cgi?resolution=640×480"; public String mjpgURL = "http://ip here /video.cgi/mjpg/video.cgi?resolution=640×480"; DataInputStream dis; private BufferedImage image = null; public Dimension imageSize = null; public boolean connected = false; private boolean initCompleted = false; HttpURLConnection huc = null; Component parent; /** Creates a new instance of AxisCamera */ public AxisCamera1(Component parent_) { parent = parent_; } public void connect() { try { URL u = new URL(useMJPGStream ? mjpgURL : jpgURL); huc = (HttpURLConnection) u.openConnection(); // System.out.println(huc.getContentType()); InputStream is = huc.getInputStream(); connected = true; BufferedInputStream bis = new BufferedInputStream(is); dis = new DataInputStream(bis); if (!initCompleted) initDisplay(); } catch (IOException e) { // incase no connection exists wait and try // again, instead of printing the error try { huc.disconnect(); Thread.sleep(60); } catch (InterruptedException ie) { huc.disconnect(); connect(); } connect(); } catch (Exception e) { ; } } public void initDisplay() { // setup the display if (useMJPGStream) readMJPGStream(); else { readJPG(); disconnect(); } imageSize = new Dimension(image.getWidth(this), image.getHeight(this)); setPreferredSize(imageSize); parent.setSize(imageSize); parent.validate(); initCompleted = true; } public void disconnect() { try { if (connected) { dis.close(); connected = false; } } catch (Exception e) { ; } } public void paint(Graphics g) { // used to set the image on the panel if (image != null) g.drawImage(image, 0, 0, this); } public void readStream() { // the basic method to continuously read the // stream try { if (useMJPGStream) { while (true) { readMJPGStream(); parent.repaint(); } } else { while (true) { connect(); readJPG(); parent.repaint(); disconnect(); } } } catch (Exception e) { ; } } public void readMJPGStream() { // preprocess the mjpg stream to remove the // mjpg encapsulation readLine(3, dis); // discard the first 3 lines readJPG(); readLine(2, dis); // discard the last two lines } public void readJPG() { // read the embedded jpeg image try { JPEGImageDecoder decoder = JPEGCodec.createJPEGDecoder(dis); image = decoder.decodeAsBufferedImage(); } catch (Exception e) { e.printStackTrace(); disconnect(); } } public void readLine(int n, DataInputStream dis) { // used to strip out the // header lines for (int i = 0; i < n; i++) { readLine(dis); } } public void readLine(DataInputStream dis) { try { boolean end = false; String lineEnd = "\n"; // assumes that the end of the line is marked // with this byte[] lineEndBytes = lineEnd.getBytes(); byte[] byteBuf = new byte[lineEndBytes.length]; while (!end) { dis.read(byteBuf, 0, lineEndBytes.length); String t = new String(byteBuf); System.out.print(t); // uncomment if you want to see what the // lines actually look like if (t.equals(lineEnd)) end = true; } } catch (Exception e) { e.printStackTrace(); } } public void run() { System.out.println("in Run..................."); connect(); readStream(); } @SuppressWarnings("deprecation") public static void main(String[] args) { JFrame jframe = new JFrame(); jframe.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); AxisCamera1 axPanel = new AxisCamera1(jframe); new Thread(axPanel).start(); jframe.getContentPane().add(axPanel); jframe.pack(); jframe.show(); } } Any suggestions what I am doing wrong here??

    Read the article

  • Qt drag & drop button; drop not detecting

    - by Thomas Verbeke
    I'm creating a 2D game in QT and i'm trying to implement a drag & drop into my program. For some reason the drop is not registered: qDebug should print a message on dropping but this doesn't happen. #include "dialog.h" #include "ui_dialog.h" #include "world.h" #include <vector> Dialog::Dialog(QWidget *parent) : QDialog(parent), ui(new Ui::Dialog) { ui->setupUi(this); scene = new QGraphicsScene(this); ui->graphicsView->setScene(scene); MySquare *item; QGraphicsRectItem *enemyItem; World *myWorld = new World(); std::vector<Tile*> tiles = myWorld->createWorld(":/texture.jpg"); int count = 0; foreach (Tile *tile, tiles){ count++; item = new MySquare(tile->getXPos()*4,tile->getYPos()*4,4,4); item->setBrush(QColor(tile->getValue()*255,tile->getValue()*255,tile->getValue()*255)); item->setAcceptDrops(true); scene->addItem(item); } player = new MySquare(10,20,10,10); player->setAcceptDrops(true); scene->addItem(player); //drag & drop part QPushButton *pushButton = new QPushButton("Click Me",this); connect(pushButton,SIGNAL(pressed()),this,SLOT(makeDrag())); setAcceptDrops(true); } void Dialog::makeDrag() { QDrag *dr = new QDrag(this); // The data to be transferred by the drag and drop operation is contained in a QMimeData object QMimeData *data = new QMimeData; data->setText("This is a test"); // Assign ownership of the QMimeData object to the QDrag object. dr->setMimeData(data); // Start the drag and drop operation dr->start(); } mysquare.cpp #include "mysquare.h" MySquare::MySquare(int _x,int _y, int _w, int _h) { isPlayer=false; Pressed=false; setFlag(ItemIsMovable); setFlag(ItemIsFocusable); setAcceptDrops(true); color=Qt::red; color_pressed = Qt::green; x = _x; y = _y; w = _w; h = _h; } QRectF MySquare::boundingRect() const { return QRectF(x,y,w,h); } void MySquare::paint(QPainter *painter, const QStyleOptionGraphicsItem *option, QWidget *widget) { QRectF rec = boundingRect(); QBrush brush(color); if (Pressed){ brush.setColor(color); } else { brush.setColor(color_pressed); } painter->fillRect(rec,brush); painter->drawRect(rec); } void MySquare::mousePressEvent(QGraphicsSceneMouseEvent *event) { Pressed=true; update(); QGraphicsItem::mousePressEvent(event); qDebug() << "mouse Pressed"; } void MySquare::mouseReleaseEvent(QGraphicsSceneMouseEvent *event) { Pressed=false; update(); QGraphicsItem::mousePressEvent(event); qDebug() << "mouse Released"; } void MySquare::keyPressEvent(QKeyEvent *event){ int x = pos().x(); int y = pos().y(); //key handling QGraphicsItem::keyPressEvent(event); } void MySquare::dropEvent(QDropEvent *event) { qDebug("dropEvent - square"); // Unpack dropped data and handle it the way you want qDebug("Contents: %s", event->mimeData()->text().toLatin1().data()); } void MySquare::dragMoveEvent(QDragMoveEvent *event){ qDebug("dragMoveEvent - square "); event->accept(); } void MySquare::dragEnterEvent(QDragEnterEvent *event){ event->setAccepted(true); qDebug("dragEnterEvent - square"); event->acceptProposedAction(); } void MySquare::setBrush(QColor _color){ color = _color; color_pressed = _color; update(); //repaint } edit; there is no problem with qDebug() i'm just using it to test them i'm inside the drag events..which i'm not

    Read the article

  • Why can't my main class see the array in my calender class

    - by Rocky Celltick Eadie
    This is a homework problem. I'm already 5 days late and can't figure out what I'm doing wrong.. this is my 1st semester in Java and my first post on this site Here is the assignment.. Create a class called Calendar. The class should contain a variable called events that is a String array. The array should be created to hold 5 elements. Use a constant value to specify the array size. Do not hard code the array size. Initialize the array in the class constructor so that each element contains the string “ – No event planned – “. The class should contain a method called CreateEvent. This method should accept a String argument that contains a one-word user event and an integer argument that represents the day of the week. Monday should be represented by the number 1 and Friday should be represented by the number 5. Populate the events array with the event info passed into the method. Although the user will input one-word events, each event string should prepend the following string to each event: event_dayAppoinment: (where event_day is the day of the week) For example, if the user enters 1 and “doctor” , the first array element should read: Monday Appointment: doctor If the user enters 2 and “PTA” , the second array element should read: Tuesday Appointment: PTA Write a driver program (in a separate class) that creates and calls your Calendar class. Then use a loop to gather user input. Ask for the day (as an integer) and then ask for the event (as a one word string). Pass the integer and string to the Calendar object’s CreateEvent method. The user should be able enter 0 – 5 events. If the user enters -1, the loop should exit and your application should print out all the events in a tabular format. Your program should not allow the user to enter invalid values for the day of the week. Any input other than 1 – 5 or -1 for the day of the week would be considered invalid. Notes: When obtaining an integer from the user, you will need to use the nextInt() method on your Scanner object. When obtaining a string from a user, you will need to use the next() method on your Scanner object. Here is my code so far.. //DRIVER CLASS /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin class driver public class driver { /** * @paramargs the command line arguments */ //begin main method public static void main(String[] args) { //initiates scanner Scanner userInput = new Scanner (System.in); //declare variables int dayOfWeek; String userEvent; //creates object for calender class calendercalenderObject = new calender(); //user prompt System.out.println("Enter day of week for your event in the following format:"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //user prompt System.out.println("Please type in the name of your event"); //collect user input userEvent = userInput.next(); //begin while loop while (dayOfWeek != -1) { //test for valid day of week if ((dayOfWeek>=1) && (dayOfWeek<=5)){ //calls createEvent method in calender class and passes 2 variables calenderObject.createEvent(userEvent,dayOfWeek); } else { //error message System.out.println("You have entered an invalid number"); //user prompts System.out.println("Press -1 to quit or enter another day"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //end data validity test } //end while loop } //prints array to screen int i=0; for (i=0;i<events.length;i++){ System.out.println(events[i]); } //end main method } } /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin calender class public class calender { //creates events array String[] events = new String[5]; //begin calender class constructor public calender() { //Initializes array String[] events = {"-No event planned-","-No event planned-","-No event planned-","-No event planned-","-No event planned-"}; //end calender class constructor } //begin createEvent method public String[] createEvent (String userEvent, int dayOfWeek){ //Start switch test switch (dayOfWeek){ case 1: events[0] = ("Monday Appoinment:") + userEvent; break; case 2: events[1] = ("Tuesday Appoinment:") + userEvent; break; case 3: events[2] = ("WednsdayAppoinment:") + userEvent; break; case 4: events[3] = ("Thursday Appoinment:") + userEvent; break; case 5: events[4] = ("Friday Appoinment:") + userEvent; break; default: break; //End switch test } //returns events array return events; //end create event method } //end calender class }

    Read the article

  • Very simple, terse and easy GUI programming “frameworks”

    - by jetxee
    Please list GUI programming libraries, toolkits, frameworks which allow to write GUI apps quickly. I mean in such a way, that GUI is described entirely in a human-readable (and human-writable) plain text file (code) code is terse (1 or 2 lines of code per widget/event pair), suitable for scripting structure and operation of the GUI is evident from the code (nesting of widgets and flow of events) details about how to build the GUI are hidden (things like mainloop, attaching event listeners, etc.) auto-layouts are supported (vboxes, hboxes, etc.) As answers suggest, this may be defined as declarative GUI programming, but it is not necessarily such. Any approach is OK if it works, is easy to use and terse. There are some GUI libraries/toolkits like this. They are listed below. Please extend the list if you see a qualifying toolkit missing. Indicate if the project is crossplatform, mature, active, and give an example if possible. Please use this wiki to discuss only Open Source projects. This is the list so far (in alphabetical order): Fudgets Fudgets is a Haskell library. Platform: Unix. Status: Experimental, but still maintained. An example: import Fudgets main = fudlogue (shellF "Hello" (labelF "Hello, world!" >+< quitButtonF)) GNUstep Renaissance Renaissance allows to describe GUI in simple XML. Platforms: OSX/GNUstep. Status: part of GNUstep. An example below: <window title="Example"> <vbox> <label font="big"> Click the button below to quit the application </label> <button title="Quit" action="terminate:"/> </vbox> </window> HTML HTML-based GUI (HTML + JS). Crossplatform, mature. Can be used entirely on the client side. Looking for a nice “helloworld” example. JavaFX JavaFX is usable for standalone (desktop) apps as well as for web applications. Not completely crossplatform, not yet completely open source. Status: 1.0 release. An example: Frame { content: Button { text: "Press Me" action: operation() { System.out.println("You pressed me"); } } visible: true } Screenshot is needed. Phooey Phooey is another Haskell library. Crossplatform (wxWidgets), HTML+JS backend planned. Mature and active. An example (a little more than a helloworld): ui1 :: UI () ui1 = title "Shopping List" $ do a <- title "apples" $ islider (0,10) 3 b <- title "bananas" $ islider (0,10) 7 title "total" $ showDisplay (liftA2 (+) a b) PythonCard PythonCard describes GUI in a Python dictionary. Crossplatform (wxWidgets). Some apps use it, but the project seems stalled. There is an active fork. I skip PythonCard example because it is too verbose for the contest. Shoes Shoes for Ruby. Platforms: Win/OSX/GTK+. Status: Young but active. A minimal app looks like this: Shoes.app { @push = button "Push me" @note = para "Nothing pushed so far" @push.click { @note.replace "Aha! Click!" } } Tcl/Tk Tcl/Tk. Crossplatform (its own widget set). Mature (probably even dated) and active. An example: #!/usr/bin/env wish button .hello -text "Hello, World!" -command { exit } pack .hello tkwait window . tekUI tekUI for Lua (and C). Platforms: X11, DirectFB. Status: Alpha (usable, but API still evolves). An example: #/usr/bin/env lua ui = require "tek.ui" ui.Application:new { Children = { ui.Window:new { Title = "Hello", Children = { ui.Text:new { Text = "_Hello, World!", Style = "button", Mode = "button", }, }, }, }, }:run() Treethon Treethon for Python. It describes GUI in a YAML file (Python in a YAML tree). Platform: GTK+. Status: work in proress. A simple app looks like this: _import: gtk view: gtk.Window() add: - view: gtk.Button('Hello World') on clicked: print view.get_label() Yet unnamed Python library by Richard Jones: This one is not released yet. The idea is to use Python context managers (with keyword) to structure GUI code. See Richard Jones' blog for details. with gui.vertical: text = gui.label('hello!') items = gui.selection(['one', 'two', 'three']) with gui.button('click me!'): def on_click(): text.value = items.value text.foreground = red XUL XUL + Javascript may be used to create stand-alone desktop apps with XULRunner as well as Mozilla extensions. Mature, open source, crossplatform. <?xml version="1.0"?> <?xml-stylesheet href="chrome://global/skin/" type="text/css"?> <window id="main" title="My App" width="300" height="300" xmlns="http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul"> <caption label="Hello World"/> </window> Thank your for contributions!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • PHP: Strange behaviour while calling custom php functions

    - by baltusaj
    I am facing a strange behavior while coding in PHP with Flex. Let me explain the situation: I have two funcions lets say: populateTable() //puts some data in a table made with flex createXML() //creates an xml file which is used by Fusion Charts to create a chart Now, if i call populateTable() alone, the table gets populated with data but if i call it with createXML(), the table doesn't get populated but createXML() does it's work i.e. creates an xml file. Even if i run following code, only xml file gets generated but table remains empty whereas i called populateTable() before createXML(). Any idea what may be going wrong? MXML Part <mx:HTTPService id="userRequest" url="request.php" method="POST" resultFormat="e4x"> <mx:request xmlns=""> <getResult>send</getResult> </mx:request> and <mx:DataGrid id="dgUserRequest" dataProvider="{userRequest.lastResult.user}" x="28.5" y="36" width="525" height="250" > <mx:columns> <mx:DataGridColumn headerText="No." dataField="no" /> <mx:DataGridColumn headerText="Name" dataField="name"/> <mx:DataGridColumn headerText="Age" dataField="age"/> </mx:columns> PHP Part <?php //-------------------------------------------------------------------------- function initialize($username,$password,$database) //-------------------------------------------------------------------------- { # Connect to the database $link = mysql_connect("localhost", $username,$password); if (!$link) { die('Could not connected to the database : ' . mysql_error()); } # Select the database $db_selected = mysql_select_db($database, $link); if (!$db_selected) { die ('Could not select the DB : ' . mysql_error()); } // populateTable(); createXML(); # Close database connection } //-------------------------------------------------------------------------- populateTable() //-------------------------------------------------------------------------- { if($_POST['getResult'] == 'send') { $Result = mysql_query("SELECT * FROM session" ); $Return = "<Users>"; $no = 1; while ( $row = mysql_fetch_object( $Result ) ) { $Return .= "<user><no>".$no."</no><name>".$row->name."</name><age>".$row->age."</age><salary>". $row->salary."</salary></session>"; $no=$no+1; $Return .= "</Users>"; mysql_free_result( $Result ); print ($Return); } //-------------------------------------------------------------------------- createXML() //-------------------------------------------------------------------------- { $users=array ( "0"=>array("",0), "1"=>array("Obama",0), "2"=>array("Zardari",0), "3"=>array("Imran Khan",0), "4"=>array("Ahmadenijad",0) ); $selectedUsers=array(1,4); //this means only obama and ahmadenijad are selected and the xml file will contain info related to them only //Extracting salaries of selected users $size=count($users); for($i = 0; $i<$size; $i++) { //initialize temp which will calculate total throughput for each protocol separately $salary = 0; $result = mysql_query("SELECT salary FROM userInfo where name='$users[$selectedUsers[$i]][0]'"); $row = mysql_fetch_array($result)) $salary = $row['salary']; } $users[$selectedUsers[$i]][1]=$salary; } //creating XML string $chartContent = "<chart caption=\"Users Vs Salaries\" formatNumberScale=\"0\" pieSliceDepth=\"30\" startingAngle=\"125\">"; for($i=0;$i<$size;$i++) { $chartContent .= "<set label=\"".$users[$selectedUsers[$i]][0]."\" value=\"".$users[$selectedUsers[$i]][1]."\"/>"; } $chartContent .= "<styles>" . "<definition>" . "<style type=\"font\" name=\"CaptionFont\" size=\"16\" color=\"666666\"/>" . "<style type=\"font\" name=\"SubCaptionFont\" bold=\"0\"/>" . "</definition>" . "<application>" . "<apply toObject=\"caption\" styles=\"CaptionFont\"/>" . "<apply toObject=\"SubCaption\" styles=\"SubCaptionFont\"/>" . "</application>" . "</styles>" . "</chart>"; $file_handle = fopen('ChartData.xml','w'); fwrite($file_handle,$chartContent); fclose($file_handle); } initialize("root","","hiddenpeak"); ?>

    Read the article

  • Saving in mongoDb with Mongoose, unexpected elements saved

    - by guiomie
    When I write in my mongoDB with mongoose the operation is treated with success, my document is saved, but there is also all kind of weird other sutff written down. It seems to be mongoose code. What could cause this? I add stuff in a specific array with: resultReference.ref[arrayLocation].allEvents.push(theEvent); {id: 11, allEvents: [] } is the structure of a ref element, and I push theEvent in the allEvents array. I then resultReference.save() I use express, mongoose and mongoHQ for database. I tried on a local mongo server, and this annoyance is still there. I've print in my console the document to write before save() and non of this weird code is there. { id 11 allEvents [ 0 { _events { maxListeners 0 } _doc { _id {"$oid": "4eb87834f54944e263000003"} title "Test" allDay false start 2011-11-10 13:00:00 UTC end 2011-11-10 15:00:00 UTC url "/test/4eb87834f54944e263000002" color "#99CCFF" ref "4eb87834f54944e263000002" } _activePaths { paths { title "modify" allDay "modify" start "modify" end "modify" url "modify" color "modify" ref "modify" } states { init { } modify { title true allDay true start true end true url true color true ref true } require { } } stateNames [ 0 "require" 1 "modify" 2 "init" ] } _saveError null _validationError null isNew true _pres { save [ 0 function (next) { // we keep the error semaphore to make sure we don't // call `save` unnecessarily (we only need 1 error) var subdocs = 0 , error = false , self = this; var arrays = this._activePaths .map('init', 'modify', function (i) { return self.getValue(i); }) .filter(function (val) { return (val && val instanceof DocumentArray && val.length); }); if (!arrays.length) return next(); arrays.forEach(function (array) { subdocs += array.length; array.forEach(function (value) { if (!error) value.save(function (err) { if (!error) { if (err) { error = true; next(err); } else --subdocs || next(); } }); }); }); } 1 "function checkForExistingErrors(next) { if (self._saveError){ next(self._saveError); self._saveError = null; } else { next(); } }" 2 "function validation(next) { return self.validate.call(self, next); }" ] } _posts { save [ ] } save function () { var self = this , hookArgs // arguments eventually passed to the hook - are mutable , lastArg = arguments[arguments.length-1] , pres = this._pres[name] , posts = this._posts[name] , _total = pres.length , _current = -1 , _asyncsLeft = proto[name].numAsyncPres , _next = function () { if (arguments[0] instanceof Error) { return handleError(arguments[0]); } var _args = Array.prototype.slice.call(arguments) , currPre , preArgs; if (_args.length && !(arguments[0] === null && typeof lastArg === 'function')) hookArgs = _args; if (++_current < _total) { currPre = pres[_current] if (currPre.isAsync && currPre.length < 2) throw new Error("Your pre must have next and done arguments -- e.g., function (next, done, ...)"); if (currPre.length < 1) throw new Error("Your pre must have a next argument -- e.g., function (next, ...)"); preArgs = (currPre.isAsync ? [once(_next), once(_asyncsDone)] : [once(_next)]).concat(hookArgs); return currPre.apply(self, preArgs); } else if (!proto[name].numAsyncPres) { return _done.apply(self, hookArgs); } } , _done = function () { var args_ = Array.prototype.slice.call(arguments) , ret, total_, current_, next_, done_, postArgs; if (_current === _total) { ret = fn.apply(self, args_); total_ = posts.length; current_ = -1; next_ = function () { if (arguments[0] instanceof Error) { return handleError(arguments[0]); } var args_ = Array.prototype.slice.call(arguments, 1) , currPost , postArgs; if (args_.length) hookArgs = args_; if (++current_ < total_) { currPost = posts[current_] if (currPost.length < 1) throw new Error("Your post must have a next argument -- e.g., function (next, ...)"); postArgs = [once(next_)].concat(hookArgs); return currPost.apply(self, postArgs); } }; if (total_) return next_(); return ret; } }; if (_asyncsLeft) { function _asyncsDone (err) { if (err && err instanceof Error) { return handleError(err); } --_asyncsLeft || _done.apply(self, hookArgs); } } function handleError (err) { if ('function' == typeof lastArg) return lastArg(err); if (errorCb) return errorCb.call(self, err); throw err; } return _next.apply(this, arguments); } errors null } ] } ]

    Read the article

  • .NET interview, code structure and the design

    - by j_lewis
    I have been given the below .NET question in an interview. I don’t know why I got low marks. Unfortunately I did not get a feedback. Question: The file hockey.csv contains the results from the Hockey Premier League. The columns ‘For’ and ‘Against’ contain the total number of goals scored for and against each team in that season (so Alabama scored 79 goals against opponents, and had 36 goals scored against them). Write a program to print the name of the team with the smallest difference in ‘for’ and ‘against’ goals. the structure of the hockey.csv looks like this (it is a valid csv file, but I just copied the values here to get an idea) Team - For - Against Alabama 79 36 Washinton 67 30 Indiana 87 45 Newcastle 74 52 Florida 53 37 New York 46 47 Sunderland 29 51 Lova 41 64 Nevada 33 63 Boston 30 64 Nevada 33 63 Boston 30 64 Solution: class Program { static void Main(string[] args) { string path = @"C:\Users\<valid csv path>"; var resultEvaluator = new ResultEvaluator(string.Format(@"{0}\{1}",path, "hockey.csv")); var team = resultEvaluator.GetTeamSmallestDifferenceForAgainst(); Console.WriteLine( string.Format("Smallest difference in ‘For’ and ‘Against’ goals > TEAM: {0}, GOALS DIF: {1}", team.Name, team.Difference )); Console.ReadLine(); } } public interface IResultEvaluator { Team GetTeamSmallestDifferenceForAgainst(); } public class ResultEvaluator : IResultEvaluator { private static DataTable leagueDataTable; private readonly string filePath; private readonly ICsvExtractor csvExtractor; public ResultEvaluator(string filePath){ this.filePath = filePath; csvExtractor = new CsvExtractor(); } private DataTable LeagueDataTable{ get { if (leagueDataTable == null) { leagueDataTable = csvExtractor.GetDataTable(filePath); } return leagueDataTable; } } public Team GetTeamSmallestDifferenceForAgainst() { var teams = GetTeams(); var lowestTeam = teams.OrderBy(p => p.Difference).First(); return lowestTeam; } private IEnumerable<Team> GetTeams() { IList<Team> list = new List<Team>(); foreach (DataRow row in LeagueDataTable.Rows) { var name = row["Team"].ToString(); var @for = int.Parse(row["For"].ToString()); var against = int.Parse(row["Against"].ToString()); var team = new Team(name, against, @for); list.Add(team); } return list; } } public interface ICsvExtractor { DataTable GetDataTable(string csvFilePath); } public class CsvExtractor : ICsvExtractor { public DataTable GetDataTable(string csvFilePath) { var lines = File.ReadAllLines(csvFilePath); string[] fields; fields = lines[0].Split(new[] { ',' }); int columns = fields.GetLength(0); var dt = new DataTable(); //always assume 1st row is the column name. for (int i = 0; i < columns; i++) { dt.Columns.Add(fields[i].ToLower(), typeof(string)); } DataRow row; for (int i = 1; i < lines.GetLength(0); i++) { fields = lines[i].Split(new char[] { ',' }); row = dt.NewRow(); for (int f = 0; f < columns; f++) row[f] = fields[f]; dt.Rows.Add(row); } return dt; } } public class Team { public Team(string name, int against, int @for) { Name = name; Against = against; For = @for; } public string Name { get; private set; } public int Against { get; private set; } public int For { get; private set; } public int Difference { get { return (For - Against); } } } Output: Smallest difference in for' andagainst' goals TEAM: Boston, GOALS DIF: -34 Can someone please review my code and see anything obviously wrong here? They were only interested in the structure/design of the code and whether the program produces the correct result (i.e lowest difference). Much appreciated. "P.S - Please correct me if the ".net-interview" tag is not the right tag to use"

    Read the article

  • while I scroll between the layout it takes too long to be able to scroll between the gallerie's pictures. Is there any way to reduce this time?

    - by Mateo
    Hello, this is my first question here, though I've being reading this forum for quite a while. Most of the answers to my doubts are from here :) Getting back on topic. I'm developing an Android application. I'm drawing a dynamic layout that are basically Galleries, inside a LinearLayout, inside a ScrollView, inside a RelativeLayout. The ScrollView is a must, because I'm drawing a dynamic amount of galleries that most probably will not fit on the screen. When I scroll inside the layout, I have to wait 3/4 seconds until the ScrollView "deactivates" to be able to scroll inside the galleries. What I want to do is to reduce this time to a minimum. Preferably I would like to be able to scroll inside the galleries as soon as I lift my finger from the screen, though anything lower than 2 seconds would be great as well. I've being googling around for a solution but all I could find until now where layout tutorials that didn't tackle this particular issue. I was hoping someone here knows if this is possible and if so to give me some hints on how to do so. I would prefer not to do my own ScrollView to solve this. But if that is the only way I would appreciate some help because I'm not really sure how would I solve this issue by doing that. this is my layout: public class PicturesL extends Activity implements OnClickListener, OnItemClickListener, OnItemLongClickListener { private ArrayList<ImageView> imageView = new ArrayList<ImageView>(); private StringBuilder PicsDate = new StringBuilder(); private CaWaApplication application; private long ListID; private ArrayList<Gallery> gallery = new ArrayList<Gallery>(); private ArrayList<Bitmap> Thumbails = new ArrayList<Bitmap>(); private String idioma; private ArrayList<Long> Days = new ArrayList<Long>(); private long oldDay; private long oldThumbsLoaded; private ArrayList<Long> ThumbailsDays = new ArrayList<Long>(); private ArrayList<ArrayList<Long>> IDs = new ArrayList<ArrayList<Long>>(); @Override public void onCreate(Bundle savedInstancedState) { super.onCreate(savedInstancedState); RelativeLayout layout = new RelativeLayout(this); ScrollView scroll = new ScrollView(this); LinearLayout realLayout = new LinearLayout(this); ArrayList<TextView> texts = new ArrayList<TextView>(); Button TakePic = new Button(this); idioma = com.mateloft.cawa.prefs.getLang(this); if (idioma.equals("en")) { TakePic.setText("Take Picture"); } else if (idioma.equals("es")) { TakePic.setText("Sacar Foto"); } RelativeLayout.LayoutParams scrollLP = new RelativeLayout.LayoutParams(RelativeLayout.LayoutParams.FILL_PARENT, RelativeLayout.LayoutParams.FILL_PARENT); layout.addView(scroll, scrollLP); realLayout.setOrientation(LinearLayout.VERTICAL); realLayout.setLayoutParams(new LayoutParams(LayoutParams.FILL_PARENT, LayoutParams.FILL_PARENT)); scroll.addView(realLayout); TakePic.setId(67); TakePic.setOnClickListener(this); application = (CaWaApplication) getApplication(); ListID = getIntent().getExtras().getLong("listid"); getAllThumbailsOfID(); LinearLayout.LayoutParams TakeLP = new LinearLayout.LayoutParams(LinearLayout.LayoutParams.WRAP_CONTENT, LinearLayout.LayoutParams.WRAP_CONTENT); realLayout.addView(TakePic); oldThumbsLoaded = 0; int galler = 100; for (int z = 0; z < Days.size(); z++) { ThumbailsManager croppedThumbs = new ThumbailsManager(Thumbails, oldThumbsLoaded, ThumbailsDays.get(z)); oldThumbsLoaded = ThumbailsDays.get(z); texts.add(new TextView(this)); texts.get(z).setText("Day " + Days.get(z).toString()); gallery.add(new Gallery(this)); gallery.get(z).setAdapter(new ImageAdapter(this, croppedThumbs.getGallery(), 250, 175, true, ListID)); gallery.get(z).setOnItemClickListener(this); gallery.get(z).setOnItemLongClickListener(this); gallery.get(z).setId(galler); galler++; realLayout.addView(texts.get(z)); realLayout.addView(gallery.get(z)); } Log.d("PicturesL", "ListID: " + ListID); setContentView(layout); } private void getAllThumbailsOfID() { ArrayList<ModelPics> Pictures = new ArrayList<ModelPics>(); ArrayList<String> ThumbailsPath = new ArrayList<String>(); Pictures = application.dataManager.selectAllPics(); long thumbpathloaded = 0; int currentID = 0; for (int x = 0; x < Pictures.size(); x++) { if (Pictures.get(x).walkname == ListID) { if (Days.size() == 0) { Days.add(Pictures.get(x).day); oldDay = Pictures.get(x).day; IDs.add(new ArrayList<Long>()); currentID = 0; } if (oldDay != Pictures.get(x).day) { oldDay = Pictures.get(x).day; ThumbailsDays.add(thumbpathloaded); Days.add(Pictures.get(x).day); IDs.add(new ArrayList<Long>()); currentID++; } StringBuilder tpath = new StringBuilder(); tpath.append(Pictures.get(x).path.substring(0, Pictures.get(x).path.length() - 4)); tpath.append("-t.jpg"); IDs.get(currentID).add(Pictures.get(x).id); ThumbailsPath.add(tpath.toString()); thumbpathloaded++; if (x == Pictures.size() - 1) { Log.d("PicturesL", "El ultimo de los arrays, tamaño: " + Days.size()); ThumbailsDays.add(thumbpathloaded); } } } for (int y = 0; y < ThumbailsPath.size(); y++) { Thumbails.add(BitmapFactory.decodeFile(ThumbailsPath.get(y))); } } I had a memory leak on another activity when screen orientation changed that was making it slower, now it is working better. The scroller is not locking up. But sometimes, when it stops scrolling, it takes a few seconds (2/3) to disable itself. I just want it to be a little more dynamic, is there any way to override the listener and make it stop scrolling ON_ACTION_UP or something like that? I don't want to use the listview because I want to have each gallery separated by other views, now I just have text, but I will probably separate them with images with a different size than the galleries. I'm not really sure if this is possible with a listadapter and a listview, I assumed that a view can only handle only one type of object, so I'm using a scrollview of a layout, if I'm wrong please correct me :) Also this activity works as a preview or selecting the pictures you want to view in full size and manage their values. So its working only with thumbnails. Each one weights 40 kb. Guessing that is very unlikely that a user gets more than 1000~1500 pictures in this view, i thought that the activity wouldn't use more than 40~50 mb of ram in this case, adding 10 more if I open the fullsized view. So I guessed as well most devices are able to display this view in full size. If it doesn't work on low-end devices my plan was to add an option in the app preferences to let user chop this view according to some database values. And a last reason is that during most of this activity "life-cycle" (the app has pics that are relevant to the view, when it ends the value that selects which pictures are displayed has to change and no more pictures are added inside this instance of this activity); the view will be unpopulated, so most of the time showing everything wont cost much, just at the end of its cycle That was more or less what I thought at the time i created this layout. I'm open to any sort of suggestion or opinion, I just created this layout a few days ago and I'm trying to see if it can work right, because it suits my app needs. Though if there is a better way i would love to hear it Thanks Mateo

    Read the article

  • a program similar to ls with some modifications

    - by Bond
    Hi, here is a simple puzzle I wanted to discuss. A C program to take directory name as command line argument and print last 3 directories and 3 files in all subdirectories without using api 'system' inside it. suppose directory bond0 contains bond1, di2, bond3, bond4, bond5 and my_file1, my_file2, my_file3, my_file4, my_file5, my_file6 and bond1 contains bond6 my_file7 my_file8 my_file9 my_file10 program should output - bond3, bond4, bond5, my_file4, my_file5, my_file6, bond6, my_file8, my_file9, my_file10 My code for the above problem is here #include<dirent.h> #include<unistd.h> #include<string.h> #include<sys/stat.h> #include<stdlib.h> #include<stdio.h> char *directs[20], *files[20]; int i = 0; int j = 0; int count = 0; void printdir(char *); int count_dirs(char *); int count_files(char *); int main() { char startdir[20]; printf("Scanning user directories\n"); scanf("%s", startdir); printdir(startdir); } void printdir(char *dir) { printf("printdir called %d directory is %s\n", ++count, dir); DIR *dp = opendir(dir); int nDirs, nFiles, nD, nF; nDirs = 0; nFiles = 0; nD = 0; nF = 0; if (dp) { struct dirent *entry = 0; struct stat statBuf; nDirs = count_dirs(dir); nFiles = count_files(dir); printf("The no of subdirectories in %s is %d \n", dir, nDirs); printf("The no of files in %s is %d \n", dir, nFiles); while ((entry = readdir(dp)) != 0) { if (strcmp(entry->d_name, ".") == 0 || strcmp(entry->d_name, "..") == 0) { continue; } char *filepath = malloc(strlen(dir) + strlen(entry->d_name) + 2); if (filepath) { sprintf(filepath, "%s/%s", dir, entry->d_name); if (lstat(filepath, &statBuf) != 0) { } if (S_ISDIR(statBuf.st_mode)) { nD++; if ((nDirs - nD) < 3) { printf("The directory is %s\n",entry->d_name); } } else { nF++; if ((nFiles - nF) < 3) { printf("The files are %s\n", entry->d_name); } //if } //else free(filepath); } //if(filepath) } //while while ((entry = readdir(dp)) != 0) { if (strcmp(entry->d_name, ".") == 0 || strcmp(entry->d_name, "..") == 0) { continue; } printf("In second while loop *entry=%s\n",entry->d_name); char *filepath = malloc(strlen(dir) + strlen(entry->d_name) + 2); if (filepath) { sprintf(filepath, "%s/%s", dir, entry->d_name); if (lstat(filepath, &statBuf) != 0) { } if (S_ISDIR(statBuf.st_mode)) { printdir(entry->d_name); } } //else free(filepath); } //2nd while closedir(dp); } else { fprintf(stderr, "Error, cannot open directory %s\n", dir); } } //printdir int count_dirs(char *dir) { DIR *dp = opendir(dir); int nD; nD = 0; if (dp) { struct dirent *entry = 0; struct stat statBuf; while ((entry = readdir(dp)) != 0) { if (strcmp(entry->d_name, ".") == 0 || strcmp(entry->d_name, "..") == 0) { continue; } char *filepath = malloc(strlen(dir) + strlen(entry->d_name) + 2); if (filepath) { sprintf(filepath, "%s/%s", dir, entry->d_name); if (lstat(filepath, &statBuf) != 0) { fprintf(stderr, "File Not found? %s\n", filepath); } if (S_ISDIR(statBuf.st_mode)) { nD++; } else { continue; } free(filepath); } } closedir(dp); } else { fprintf(stderr, "Error, cannot open directory %s\n", dir); } return nD; } int count_files(char *dir) { DIR *dp = opendir(dir); int nF; nF = 0; if (dp) { struct dirent *entry = 0; struct stat statBuf; while ((entry = readdir(dp)) != 0) { if (strcmp(entry->d_name, ".") == 0 || strcmp(entry->d_name, "..") == 0) { continue; } char *filepath = malloc(strlen(dir) + strlen(entry->d_name) + 2); if (filepath) { sprintf(filepath, "%s/%s", dir, entry->d_name); if (lstat(filepath, &statBuf) != 0) { fprintf(stderr, "File Not found? %s\n", filepath); } if (S_ISDIR(statBuf.st_mode)) { continue; } else { nF++; } free(filepath); } } closedir(dp); } else { fprintf(stderr, "Error, cannot open file %s\n", dir); } return nF; } The above code I wrote is a bit not functioning correctly can some one help me to understand the error which is coming.So that I improve it further.There seems to be some small glitch which is not clear to me right now.

    Read the article

  • $_GET loading content before head tag instead of in specified div.

    - by s32ialx
    NOT EDITING BELOW BUT THANKS TO SOME REALLY NICE PEOPLE I CAN'T POST AN IMAGE ANYMORE BECAUSE I HAD a 15 Rep but NOW ONLY A 5 becuase my question wasn't what they wanted help with they gave me a neg rep. The problem is that the content loads it displays UNDER the div i placed #CONTENT# inside so the styles are being ignored and it's posting #CONTENT# outside the divs at positions 0,0 any suggestions? Found out whats happening by using "View Source" seems that it's putting all of the #CONTENT#, content that's being loaded in front of the <head> tag. Like this <doctype...> <div class="home"> \ blah blah #CONTENT# bot being loaded in correct specified area </div> / <head> <script src=""></script> </head> <body> <div class="header"></div> <div class="contents"> #CONTENT# < where content SHOULD load </div> <div class="footer"></div> </body> so anyone got a fix? OK so a better description I'll add relevant screen-shots Whats happening is /* file.class.php */ <?php $file = new file(); class file{ var $path = "templates/clean"; var $ext = "tpl"; function loadfile($filename){ return file_get_contents($this->path . "/" . $filename . "." . $this->ext); } function setcontent($content,$newcontent,$vartoreplace='#CONTENT#'){ $val = str_replace($vartoreplace,$newcontent,$content); return $val; } function p($content) { $v = $content; $v = str_replace('#CONTENT#','',$v); print $v; } } if(!isset($_GET['page'])){ // if not, lets load our index page(you can change home.php to whatever you want: include("main.txt"); // else $_GET['page'] was set so lets do stuff: } else { // lets first check if the file exists: if(file_exists($_GET['page'].'.txt')){ // and lets include that then: include($_GET['page'].'.txt'); // sorry mate, could not find it: } else { echo 'Sorry, could not find <strong>' . $_GET['page'] .'.txt</strong>'; } } ?> is calling for a file_get_contents at the bottom which I use in /* index.php */ <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en"> <?php include('classes/file.class.php'); // load the templates $header = $file->loadfile('header'); $body = $file->loadfile('body'); $footer = $file->loadfile('footer'); // fill body.tpl #CONTENT# slot with $content $body = $file->setcontent($body, $content); // cleanup and output the full page $file->p($header . $body . $footer); ?> and loads into /* body.tpl */ <div id="bodys"> <div id="bodt"></div> <div id="bodm"> <div id="contents"> #CONTENT# </div> </div> <div id="bodb"></div> </div> but the issue is as follows the $content loads properly img tags etc <h2> tags etc but CSS styling is TOTALY ignored for position width z-index etc. and as follows here's the screen-shot My Firefox Showing The Problem In Action REPOSTED DUE TO PEOPLE NOT HELPING AND JUST BEING ARROGANT AND GIVING NEGATIVE VOTES and not even saying a word. DO NOT COMMENT UNLESS YOU PLAN TO HELP god I'm a beginner and with you people giving me bad reviews this won't make me help you out when the chance comes.

    Read the article

< Previous Page | 432 433 434 435 436 437 438 439 440 441 442 443  | Next Page >