Search Results

Search found 32913 results on 1317 pages for 'open office'.

Page 443/1317 | < Previous Page | 439 440 441 442 443 444 445 446 447 448 449 450  | Next Page >

  • SSL confirmation dialog popup auto closes in IE8 when re-accessing a JNLP file

    - by haylem
    I'm having this very annoying problem to troubleshoot and have been going at it for way too many days now, so have a go at it. The Environment We have 2 app-servers, which can be located on either the same machine or 2 different machines, and use the same signing certificate, and host 2 different web-apps. Though let's say, for the sake of our study case here, that they are on the same physical machine. So, we have: https://company.com/webapp1/ https://company.com/webapp2/ webapp1 is GWT-based rich-client which contains on one of its screens a menu with an item that is used to invoke a Java WebStart Client located on webapp2. It does so by performing a simple window.open call via this GWT call: Window.open("https://company.com/webapp2/app.jnlp", "_blank", null); Expected Behavior User merrilly goes to webapp1 User navigates to menu entry to start the WebStart app and clicks on it browser fires off a separate window/dialog which, depending on the browser and its security settings, will: request confirmation to navigate to this secure site, directly download the file, and possibly auto-execute a javaws process if there's a file association, otherwise the user can simply click on the file and start the app (or go about doing whatever it takes here). If you close the app, close the dialog, and re-click the menu entry, the same thing should happen again. Actual Behavior On Anything but God-forsaken IE 8 (Though I admit there's also all the god-forsaken pre-IE8 stuff, but the Requirements Lords being merciful we have already recently managed to make them drop these suckers. That was close. Let's hold hands and say a prayer of gratitude.) Stuff just works. JNLP gets downloaded, app executes just fine, you can close the app and re-do all the steps and it will restart happily. People rejoice. Puppies are safe and play on green hills in the sunshine. Developers can go grab a coffee and move on to more meaningful and rewarding tasks, like checking out on SO questions. Chrome doesn't want to execute the JNLP, but who cares? Customers won't get RSI from clicking a file every other week. On God-forsaken IE8 On the first visit, the dialog opens and requests confirmation for the user to continue to webapp2, though it could be unsafe (here be dragons, I tell you). The JNLP downloads and auto-opens, the app start. Your breathing is steady and slow. You close the app, close that SSL confirmation dialog, and re-click the menu entry. The dialog opens and auto-closes. Nothing starts, the file wasn't downloaded to any known location and Fiddler just reports the connection was closed. If you close IE and reach that menu item to click it again, it is now back to working correctly. Until you try again during the same session, of course. Your heart-rate goes up, you get some more coffee to make matters worse, and start looking for plain tickets online and a cheap but heavy golf-club on an online auction site to go clubbing baby polar seals to avenge your bloodthirst, as the gates to the IE team in Redmond are probably more secured than an ice block, as one would assume they get death threats often. Plus, the IE9 and IE10 teams are already hard at work fxing the crap left by their predecessors, so maybe you don't want to be too hard on them, and you don't have money to waste on a PI to track down the former devs responsible for this mess. Added Details I have come across many problems with IE8 not downloading files over SSL when it uses a no-cache header. This was indeed one of our problems, which seems to be worked out now. It downloads files fine, webapp2 uses the following headers to serve the JNLP file: response.setHeader("Cache-Control", "private, must-revalidate"); // IE8 happy response.setHeader("Pragma", "private"); // IE8 happy response.setHeader("Expires", "0"); // IE8 happy response.setHeader("Access-Control-Allow-Origin", "*"); // allow to request via cross-origin AJAX response.setContentType("application/x-java-jnlp-file"); // please exec me As you might have inferred, we get some confirmation dialog because there's something odd with the SSL certificate. Unfortunately I have no control over that. Assuming that's only temporary and for development purposes as we usually don't get our hands on the production certs. So the SSL cert is expired and doesn't specify the server. And the confirmation dialog. Wouldn't be that bad if it weren't for IE, as other browsers don't care, just ask for confirmation, and execute as expected and consistantly. Please, pretty please, help me, or I might consider sacrificial killings as an option. And I think I just found a decently prized stainless steel golf-club, so I'm right on the edge of gore. Side Notes Might actually be related to IE8 window.open SSL Certificate issue. Though it doesn't explain why the dialog would auto-close (that really is beyong me...), it could help to not have the confirmation dialog and not need the dialog at all. For instance, I was thinking that just having a simple URL in that menu instead of have it entirely managed by GWT code to invoke a Window.open would solve the problem. But I don't have control on that menu, and also I'm very curious how this could be fixed otherwise and why the hell it happens in the first place...

    Read the article

  • MQ Connection - 2009 error

    - by user171523
    am connectting the MQ with below code. I am able connected to MQ successfully. My case is i place the messages to MQ every 1 min once. After disconnecting the cable i get a ResonCode error but IsConnected property still show true. Is this is the right way to check if the connection is still connected ? Or there any best pratcices around that. I would like to open the connection when applicaiton is started keep it open for ever. public static MQQueueManager ConnectMQ() { if ((queueManager == null) || (!queueManager.IsConnected)||(queueManager.ReasonCode == 2009)) { queueManager = new MQQueueManager(); } return queueManager; }

    Read the article

  • Apache availability with the two front-ends on diferent locations. Is it possible?

    - by marc.riera
    Hello, I have to locations (office and service providers). One DNS(bind) serving our domain as authoritative, and a service provider webserver with our corporate web on a private server. So.. Now we are planing to upgrade our server on the ISP to a new one, and I would like to use this situation to improve our service. Is it possible to mount a high availability apache/mysql/php within to different locations? I will install a bind slave on the same new server, so I hope it will make things easier, but I need some hints and tips on how to ride it. THanks.

    Read the article

  • Thunderbird: Synchronize tags

    - by fuenfundachtzig
    When I check my mail (via IMAP) on my laptop I'd like to see the same tags that I set when I checked my mail on my office computer. So the question is: Is it possible to synchronize user-specified mail tags between Thunderbird running on different computers? I've read that tags could be stored via IMAP on the server, so maybe it's just that the server of my mail provider does not support this IMAP feature? (Whichever it is...) Has anybody any experience with this? Related, but not my primary concern: Will there ever be a more flexible tagging system in Thunderbird which allows for an easier definition of new tags? (I.e. that a don't have to define new tags in the preferences menu, but can just type them in when reading a mail?)

    Read the article

  • Link to another file in chrome extension

    - by Hintswen
    I want to have a link in the popup.html file for my extension that loads another file (which will be included with the extension) how can I do this? or will I need to keep it in the same page? I tried using this code: <a href="/mail.html"> <img id="newmail_icon" src="" width="16" height="16" /> <span id="newmail">loading</span><br /> </a> But when I click the link nothing happens. I just found out that adding target="_blank" to the link will make it work and open in a new tab, but I can't get it to open in the popup. I have tried target="_self" but it didn't do anything.

    Read the article

  • Tunneling HTTP traffic from a particular host/port

    - by knoopx
    Hello, I'm trying to figure out how to access from my development machine (Devel) to a third party web service (www.domain.com) which I am not allowed to directly contact using my office IP address. Here's a basic diagram (i'm not allowed to post images...): http://yuml.me/diagram/scruffy/class/%5BDevel%5D-%5BA%5D,%20%5BA%5D-%5BB%5D,%20%5BB%5D-%5Bwww.domain.com%5D The only machine allowed to access that service is B (production server) but I do neither can directly access it from my development machine (Devel). So in order to access the web service I have to ssh into A, and then from A to B to access www.domain.com Is there any way of tunneling traffic from B to A and then back to my development machine so I can directly access www.domain.com without having to ssh into every box? Devel: My development machine. A, B: Linux servers. I own root access on both. B: Production server www.domain.com: Third party HTTP API production server uses.

    Read the article

  • Excel macro send rich mail using LotusNotes

    - by CC
    Hi everybody. I'm working on a small macro to send mail from excel 2007 using my Lotus Notes session. The sending mail part is working fine. Now I need to send in the body part, a part of a stylesheet (for instance the area from A1:B20). This area has colors, bold font. To send my email here is the code: Set oSess = CreateObject("Notes.NotesSession") Set oDB = oSess.GETDATABASE("", "") Call oDB.OPENMAIL flag = True If Not (oDB.IsOpen) Then flag = oDB.Open("", "") If Not flag Then MsgBox "Can't open mail file: " & oDB.SERVER & " " & oDB.FILEPATH End If On Error GoTo err_handler 'Building Message Set oDoc = oDB.CREATEDOCUMENT Set oItem = oDoc.CREATERICHTEXTITEM("BODY") oDoc.Form = "Memo" 'mail subject oDoc.Subject = "subject" 'mail body oDoc.sendto = "[email protected]" oDoc.body = "my text" oDoc.postdate = Date oDoc.SaveMessageOnSend = True oDoc.visable = True 'Sending Message oDoc.SEND False Does anybody has an idea about how to send a stylesheet ? Thanks alot.

    Read the article

  • JSF HIBERNATE POSTGRESQL

    - by user312619
    When I press "Save" button I get an exception like that ; javax.servlet.ServletException: org.hibernate.exception.JDBCConnectionException: Cannot open connection javax.faces.webapp.FacesServlet.service(FacesServlet.java:325) root cause javax.faces.el.EvaluationException: org.hibernate.exception.JDBCConnectionException: Cannot open connection javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:102) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312) root cause org.hibernate.exception.JDBCConnectionException: Cannot open connection org.hibernate.exception.SQLStateConverter.convert(SQLStateConverter.java:98) org.hibernate.exception.JDBCExceptionHelper.convert(JDBCExceptionHelper.java:66) org.hibernate.exception.JDBCExceptionHelper.convert(JDBCExceptionHelper.java:52) org.hibernate.jdbc.ConnectionManager.openConnection(ConnectionManager.java:449) org.hibernate.jdbc.ConnectionManager.getConnection(ConnectionManager.java:167) org.hibernate.jdbc.JDBCContext.connection(JDBCContext.java:142) org.hibernate.transaction.JDBCTransaction.begin(JDBCTransaction.java:85) org.hibernate.impl.SessionImpl.beginTransaction(SessionImpl.java:1463) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.hibernate.context.ThreadLocalSessionContext$TransactionProtectionWrapper.invoke(ThreadLocalSessionContext.java:344) $Proxy108.beginTransaction(Unknown Source) com.yemex.beans.CompanyBean.saveOrUpdate(CompanyBean.java:52) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.apache.el.parser.AstValue.invoke(AstValue.java:196) org.apache.el.MethodExpressionImpl.invoke(MethodExpressionImpl.java:276) com.sun.faces.facelets.el.TagMethodExpression.invoke(TagMethodExpression.java:98) javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:88) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312) root cause java.sql.SQLException: No suitable driver found for jdbc:postgresql://localhost/postgres java.sql.DriverManager.getConnection(Unknown Source) java.sql.DriverManager.getConnection(Unknown Source) org.hibernate.connection.DriverManagerConnectionProvider.getConnection(DriverManagerConnectionProvider.java:133) org.hibernate.jdbc.ConnectionManager.openConnection(ConnectionManager.java:446) org.hibernate.jdbc.ConnectionManager.getConnection(ConnectionManager.java:167) org.hibernate.jdbc.JDBCContext.connection(JDBCContext.java:142) org.hibernate.transaction.JDBCTransaction.begin(JDBCTransaction.java:85) org.hibernate.impl.SessionImpl.beginTransaction(SessionImpl.java:1463) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.hibernate.context.ThreadLocalSessionContext$TransactionProtectionWrapper.invoke(ThreadLocalSessionContext.java:344) $Proxy108.beginTransaction(Unknown Source) com.yemex.beans.CompanyBean.saveOrUpdate(CompanyBean.java:52) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.apache.el.parser.AstValue.invoke(AstValue.java:196) org.apache.el.MethodExpressionImpl.invoke(MethodExpressionImpl.java:276) com.sun.faces.facelets.el.TagMethodExpression.invoke(TagMethodExpression.java:98) javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:88) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312)

    Read the article

  • simple python file writing question

    - by aharon
    I'm learning Python, and have run into a bit of a problem. On my OSX install of Python 3.1, this happens in the console: >>> filename = "test" >>> reader = open(filename, 'r') >>> writer = open(filename, 'w') >>> reader.read() '' >>> writer.write("hello world\n") 12 >>> reader.read() '' And calling more test in BASH confirms that there is nothing in test. What's going on? Thanks.

    Read the article

  • Visio 2010 Reverse Engineer Oracle

    - by digitall
    I have used Visio 2007 in the past to reverse engineer Oracle databases to get a flow scheme. I believe all Office 2007 products were x86 as well which is where I suspect my issue currently lies. I have since upgraded to Visio 2010 x64 and when I go to reverse engineer something from Oracle it shows up under Installed Visio Drivers but I can't seem to create a data source using it. My assumption here is it is because Oracle doesn't play nicely with x64 and with Visio being compiled as x64 I don't even get the option to use it. Has anyone done this with Visio 2010 x64 and Oracle yet? Or are there other tools you would recommend to reverse engineer and get a model such as the one generated by Visio?

    Read the article

  • Avoiding nesting two for loops

    - by chavanak
    Hi, Please have a look at the code below: import string from collections import defaultdict first_complex=open( "residue_a_chain_a_b_backup.txt", "r" ) first_complex_lines=first_complex.readlines() first_complex_lines=map( string.strip, first_complex_lines ) first_complex.close() second_complex=open( "residue_a_chain_a_c_backup.txt", "r" ) second_complex_lines=second_complex.readlines() second_complex_lines=map( string.strip, second_complex_lines ) second_complex.close() list_1=[] list_2=[] for x in first_complex_lines: if x[0]!="d": list_1.append( x ) for y in second_complex_lines: if y[0]!="d": list_2.append( y ) j=0 list_3=[] list_4=[] for a in list_1: pass for b in list_2: pass if a==b: list_3.append( a ) kvmap=defaultdict( int ) for k in list_3: kvmap[k]+=1 print kvmap Normally I use izip or izip_longest to club two for loops, but this time the length of the files are different. I don't want a None entry. If I use the above method, the run time becomes incremental and useless. How am I supposed to get the two for loops going? Cheers, Chavanak

    Read the article

  • Connection to website interrupted/reset. Why?

    - by Goje87
    When navigating to some websites (like victorsosea.com, citibank.co.in etc.) on Google Chrome, I get a message that the 'connection to www.site.com was interrupted'. If I try on Firefox, it says 'The connection to the server was reset'. This happens no matter what internet connection I use on my laptop. Be it my home internet or office internet. I have tried using Google DNS address as well but that does not seem to solve the problem. I have been facing this problem randomly for some websites. Kindly let me know how I can resolve the issue. My laptop configuration: Windows 7, 64-bit

    Read the article

  • VPN doesn't have access to drives unless I use the default gateway

    - by Seb
    I am trying to setup a VPN connection on one of our office servers so that many of our employees can access our drives when out of town or for important business meetings. However I have a weird glitch in where if the default gateway option is checked they can see the drives and files, but get no internet access. If I have the default gateway option unchecked then they have there internet and can successfully connect to the VPN, but they are not able to see any of the drives or files. The server is running Windows Server 2003 Standard while the employees run either XP or 7 Professional. Any help is greatly appreciated. Thank you. EDIT The VPN setup is PPTP and the main server is behind a SonicWall if that is of any importance.

    Read the article

  • Upload and parse csv file with "universal newline" in python on Google App Engine

    - by greg
    Hi, I'm uploading a csv/tsv file from a form in GAE, and I try to parse the file with python csv module. Like describe here, uploaded files in GAE are strings. So I treat my uploaded string a file-like object : file = self.request.get('catalog') catalog = csv.reader(StringIO.StringIO(file),dialect=csv.excel_tab) But new lines in my files are not necessarily '\n' (thanks to excel..), and it generated an error : Error: new-line character seen in unquoted field - do you need to open the file in universal-newline mode? Does anyone know how to use StringIO.StringIO to treat strings like files open in universal-newline?

    Read the article

  • Creating and writing file from a FileOutputStream in Java

    - by Althane
    Okay, so I'm working on a project where I use a Java program to initiate a socket connection between two classes (a FileSender and FileReceiver). My basic idea was that the FileSender would look like this: try { writer = new DataOutputStream(connect.getOutputStream()); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } //While we have bytes to send while(filein.available() >0){ //We write them out to our buffer writer.write(filein.read(outBuffer)); writer.flush(); } //Then close our filein filein.close(); //And then our socket; connect.close(); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); The constructor contains code that checks to see if the file exists, and that the socket is connected, and so on. Inside my FileReader is this though: input = recvSocket.accept(); BufferedReader br = new BufferedReader(new InputStreamReader(input.getInputStream())); FileOutputStream fOut= new FileOutputStream(filename); String line = br.readLine(); while(line != null){ fOut.write(line.getBytes()); fOut.flush(); line = br.readLine(); } System.out.println("Before RECV close statements"); fOut.close(); input.close(); recvSocket.close(); System.out.println("After RECV clsoe statements"); All inside a try-catch block. So, what I'm trying to do is have the FileSender reading in the file, converting to bytes, sending and flushing it out. FileReceiver, then reads in the bytes, writes to the fileOut, flushes, and continues waiting for more. I make sure to close all the things that I open, so... here comes the weird part. When I try and open the created text file in Eclipse, it tells me "An SWT error has occured ... recommended to exit the workbench... see .log for more details.". Another window pops up saying "Unhandled event loop exception, (no more handles)". However, if I try to open the sent text file in notepad2, I get ThisIsASentTextfile Which is good (well, minus the fact that there should be line breaks, but I'm working on that...). Does anyone know why this is happening? And while we're checking, how to add the line breaks? (And is this a particularly bad way to transfer files over java without getting some other libraries?)

    Read the article

  • How do I run a vim script that alters the current buffer?

    - by Dan
    I'm trying to write a beautify.vim script that makes C-like code adhere to a standard that I can easily read. My file contains only substitution commands that all begin with %s/... However, when I try to run the script with my file open, in the manner :source beautify.vim, or :runtime beautify.vim, it runs but all the substitute commands state that their pattern wasn't found (patterns were tested by entering them manually and should work). Is there some way to make vim run the commands in the context of the current buffer? beautify.vim: " add spaces before open braces sil! :%s/\%>1c>\s\@<!{/ {/g " beautify for sil! :%s/for *( *\([^;]*\) *; *\([^;]*\) *; *\([^;]*\) *)/for (\1; \2; \3)/ " add spaces after commas sil! :%s/,\s\@!/, /g In my tests the first :s command should match (it matches when applied manually).

    Read the article

  • Python file input string: how to handle escaped unicode characters?

    - by Michi
    In a text file (test.txt), my string looks like this: Gro\u00DFbritannien Reading it, python escapes the backslash: >>> file = open('test.txt', 'r') >>> input = file.readline() >>> input 'Gro\\u00DFbritannien' How can I have this interpreted as unicode? decode() and unicode() won't do the job. The following code writes Gro\u00DFbritannien back to the file, but I want it to be Großbritannien >>> input.decode('latin-1') u'Gro\\u00DFbritannien' >>> out = codecs.open('out.txt', 'w', 'utf-8') >>> out.write(input)

    Read the article

  • Authorization error when testing FTP to UNC

    - by user64204
    We have a Windows Server 2008 R2 with Active Directory (hereafter called DC) running as a domain controller on which we have IIS and an FTP site installed. We have a second Server 2008 (hereafter called SHARE) which is joined to that domain and has a disk shared as a network share (\\share\Office). That network share is used as the ftp's physical path on DC. We've tested the FTP from the IIS FTP configuration panel, by clicking on Basic Settings... then Test Settings.... When setting Administrator as a username with the Connect as... option, everything is fine: When no user is provided we can the below error: Q1: Could someone explain in more understandable terms what is written in the Details text area?

    Read the article

  • Posting an action works... but no image

    - by Brian Rice
    I'm able to post an open graph action to facebook using the following url: https://graph.facebook.com/me/video.watches with the following post data: video=http://eqnetwork.com/home/video.html?f=8e7b4f27-8cbd-4430-84df-d9ccb46da45f.mp4 It seems to be getting the title from the open graph metatags at the "video" object. But, it's not getting the image (even though one is specified in the metatag "og:image"). Also, if I add this to the post data: picture=http://eqnetwork.com/icons/mgen/overplayThumbnail.ms?drid=14282&subType=ljpg&w=120&h=120&o=1&thumbnail= still no image. Any thoughts? Brian

    Read the article

  • How to cache streaming video and silverlight with squid windows reverse proxy

    - by V. Romanov
    We have an intranet web server running a silverlight application (ACTUS media monitor if anyone cares to know). The server is used to record video and stream it to clients through a CDN solution. We want to put a reverse proxy in between the server and CDN provider in order to remove the office network bottleneck that's currently strangling us. I've set up SQUID for windows on a separate machine outside the network using squid BasicAccelerator configuration setting. It seems to work as far as the reverse proxy is concerned, requests are forwarded and the application is working but it doesn't seem to cache anything (no space is used on the drive where squid is installed). I found to explicit setting to turn caching on in squid, so i assume it's on by default. Perhaps I need some other trick to make the video and/or silverlight cacheable? Any help will be appreciated. Any info you need to help me will be provided at once. Thanks in advance!

    Read the article

  • RODC password replication and A/D sites and subnets

    - by Gregory Thomson
    I work at a school district with about 30 school sites. Windows 2008 A/D setup - all central at the district office. In A/D, all is under one site, and no subnets defined. One A/D forest and only one domain under that. We're now looking to start putting RODCs at the schools to put the authentication and DNS out there closer to them. I haven't worked with A/D sites and subnets, and only a little with RODC password replication. But just got an invite to a meeting to talk about this tomorrow... If we start breaking down the A/D pieces into sites/subnets, can we also use that as a way to help apply an RODC password replication policy in a way that matches so that only each school sites' users passwords are replicated/cached on their RODC?

    Read the article

  • FTP Access Denied when uploading to server

    - by Albert
    Ok, here's the story. I have a server running FTP 'out there' I can connect to it using the admin account, browse files, download files. When I try to upload files, I get 550 Access Denied. I have tried through FileZilla and command line. I have windows firewall turned off (on my machine) I can UPLOAD files from another machine (using the same admin account) on our local network (that means, same public IP) what is the problem? I am running Windows 7, Build 7100 and the other machine on the network is running XP SP3 The thing that gets me though, is that this worked for the last probably 4 months, without a problem, I get back in the office after a weekend today and it won't work...

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Reading a file with a supplied name in C++

    - by Cosmina
    I must read a file with a given name (it's caled "hamlet.txt"). The class used to read the file is defined like this #ifndef READWORDS_H #define READWORDS_H /** * ReadWords class. Provides mechanisms to read a text file, and return * capitalized words from that file. */ using namespace std; #include <string> #include <fstream> class ReadWords { public: /** * Constructor. Opens the file with the default name "text.txt". * Program exits with an error message if the file does not exist. */ ReadWords(); /** * Constructor. Opens the file with the given filename. * Program exits with an error message if the file does not exist. * @param filename - a C string naming the file to read. */ ReadWords(char *filename); My definition of the members of the classis this: #include<string> #include<fstream> #include<iostream> #include "ReadWords.h" using namespace std; ReadWords::ReadWords() { wordfile.open("text.txt"); if( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } } ReadWords::ReadWords(char *filename) { wordfile.open(filename); if ( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } wordfile>>nextword; } And the main to test it. using namespace std; #include #include #include "ReadWords.h" int main() { char name[30]; cout<<"Please input a name for the file that you wish to open"; cin>>name; ReadWords x( name[] ); } When I complie it gives me the error: main.cpp:14: error: expected primary-expression before ']' token I know it's got something to do with the function ReadWords( char *filename), but I do not know what. Any help please?

    Read the article

  • IF commands in a batch file

    - by Rossaluss
    I'm writing a small batch file to replace users' themes and charts in Office and I have the below batch file that works just fine. cd c:\documents and settings\%username%\application data\microsoft\templates echo Y|rmdir charts /s mkdir charts echo Y|del "c:\documents and settings\%username%\application data\microsoft\templates\document themes\*.*" net use o: \\servername\sms copy "o:\ppt themes\charts\*.*" "c:\documents and settings\%username%\application data\microsoft\templates\charts" copy "o:\ppt themes\Document Themes\*.*" "c:\documents and settings\%username%\application data\microsoft\templates\document themes" c: net use o: /delete Now what I want is the above to only run if it hasn't run before as we'll be pushing this out to all users for around 2 weeks to catch people that aren't in every day. Is there any way to begin the command with something to look for one of the new themes/charts already pushed down, and if it's present, then have it not run? Any help on this would be greatly appreciated as I'm pretty new to these batch files.

    Read the article

< Previous Page | 439 440 441 442 443 444 445 446 447 448 449 450  | Next Page >