Search Results

Search found 77947 results on 3118 pages for 'i dont know'.

Page 451/3118 | < Previous Page | 447 448 449 450 451 452 453 454 455 456 457 458  | Next Page >

• How to remove .htaccess virus? [closed]

  - by bleepingcrows

  Possible Duplicate: My server's been hacked EMERGENCY First time posting so bear with me please! My friend's site has been hacked and the .htaccess file (which I really know nothing about) has been injected with a malicious redirect that forces search engines to the see the site as a "harmful website." If you look at the .htaccess file you can see it's Russian or at least ends in .ru. Seeing as I know very little about this stuff, I simply tried to restore the good .htaccess file back with his host. This doesn't work as the virus just recreates the infected .htaccess file. When I searched through the rest of his directories, I can see the same bad .htaccess file in most of the folders. I can't seem to help him get rid of this virus.

  Read the article

• How to measure that a host is good for users in Egypt ?

  - by Sherif Buzz

  Hi all, I currently have a site that's hosted in Texas. The majority of my users are from Egypt and I'm a bit concerned that the current hosting is not the optimal in terms of performance. The site is not slow but for how can I know if, for example, hosting it in Europe or Asia is better ? To clarify I need to know there is a way that I can test different hosting options - for example how can I test the average response time between Egypt and a host in Texas, the average response time between Egypt and a host in the UK ?

  Read the article

• How much does SQL Server Web Edition cost? + other related questions

  - by Goma

  Hello. I visited Microsoft pricing page about SQL Server databases, but it was not that clear for me. I want to know the exact cost of SQL Server Web Edition. Furthermore, I would like to know how can I get it if I am with VPS hosting? Should I install it by myself or will they install it for me? And finally, is there a web host that provide SQL Server Web edition so I pay for them directly with the hosting package?

  Read the article

• Textwrangler (OS X) -- Simple Text Macro Help Needed

  - by bobber205

  I often, when parsing log/error files, need to replace < and < and > with in order to be able to efficiently understand what's going on in the files. I know TextWrangler has a macro ability but I can't figure out a efficient way to do this. Since I have to do it so often I'd love to just have a simple keybinding or menu item to do this simple replace/find all for me. Anyone know how to do this? ^_^

  Read the article

• How can I too many files upload more fast way to Cloud files in Rasckspace?

  - by andy kim

  I have a lot of image files, it's all I want to upload to RackSpace cloud files about a million in a single directory the fastest and most efficient way. but I'm use uploading python-cloudfiles script is very slow and I want to know different ways or python script code. because one by one connection upload is very slow. I think one files tar and uncompress directory is better way. but cloudfiles do not support this way. Who know any other way?

  Read the article

• Bacula configuration for clients that are turned on and off randomly

  - by Rastloser

  I'm evaluating Bacula as a centralized backup tool for a small network where users will turn machines on and off unpredictably. Some of the headless Linux boxes I need to back up are intended to be turned off by pressing the on/off-button on the case, without any way of telling the user to wait for a backup job to finish. So, we don't know when backup jobs may run (anacron might help with this, right?) and we don't know whether they'll be allowed to finish. Is Bacula a reasonable choice for such an environment?

  Read the article

• How to identify who is using Hardware Reserved Memory in Windows 7

  - by blasteralfred

  I run Windows 7 x86 Home Premium. I have an installed physical memory of 4 GB, out of which, 2.96 GB is usable (My Computer Properties). I checked the memory usage using Resource Monitor and found 3036 MB / 4096 MB is available. I noticed that 1060 MB is unavailable since it is reserved by some "Hardware component(s)". I would like to know which hardware component is using this 1060 MB. Is there any way or tool to identify this? Note: I know that Windows 7 Home Premium x86 supports a maximum of 4GB RAM.

  Read the article

• Mail Secure & Stable Open Source Mail Server

  - by Fanar ALHAYALI

  I have asked question on http://stackoverflow.com/questions/9868426/i-need-to-know-which-email-server-i-have-to-use and someone tell me my question would be better on serverfault. I know that this is a common question and asked many times. but there are so many available mail servers that i am not able to decide the one. Kindly tell that which is the Secure, Stable and fast open source mail server for Centos or Redhat Server. Is there any guide which can be used to deploy the mail server with all its components e.g. smtp, pop3, imap, spam, calender server, antivirus, DNS Setting. Currently I'm using sun messaging V6 which installed on Solaris 10 and my boss ask me to make a report for the best mail server today in the marketing? I tried to have a look on Google but I couldn't find interesting information for my report. Any advice would be appreciated.

  Read the article

• Why Netbeans 6.8 remote project (php) uploads all files by default

  - by xaguilars

  Hi I wanted to know if there's some option for disabling Netbeans to upload all files of a recently imported remote (php) project. I always check "Upload files on run", in the project configuration. But when I click on run Netbeans selects all files by default (I modified only some). The file checkboxes cannot be disabled at once and you have to do this one by one (imagine you have 5000 files...). That's annoying. Do you know any solution? thank you

  Read the article

• How is the PHP extensions/modules file structure logic based?

  - by dotpointer

  I'm trying to configure/build PHP 5.3.10 on Linux/Slackware 12 but the extensions appear in the wrong directory when I run make install. In the php.ini file is the extension dir defined: /usr/lib/php/extensions Problem is that when I run "make install" the newly built extensions are copied to a subfolder in extensions directory: /usr/lib/php/extensions/no-debug-non-zts-20090626 What am I supposed to do with this... copy the files down from the no-debug-non-zts-20090626 directory into the extensions directory, create symlinks from extensions to the modules in the no-debug-non-zts-20090626 directory (which will take a lot of time) or what? (I know I can do any of them, but I want to know the correct way...)

  Read the article

• How do I turn of "auto-echo" in bash when I 'cd'?

  - by Avery Chan

  I don't know when this started happening but now, every time I cd to a directory it echoes the path right before it changes directories. This happens when I log into a server but doesn't happen on my local machine. The server is running Linux. My local machine is running Mac OS X. I searched the Google as well as looked at the bash man page but I couldn't find anything. My .bashrc/.bash_profile doesn't have anything related to 'cd' (that I know of). How do I modify this "feature"?

  Read the article

• Audible Books does not install my books into my iTunes and wants me to do it manually, I can't figure out how

  - by Alice

  Audible Books fails to install into iTunes I am using a desktop with Windows 7 64 bit. I have been downloading Audible Books for 3 years and have 85 installed. Several months ago downloading them did not put them in iTunes and the system wants me to import them manually. You start with "C\Program Files\iTunes\ and add two lines..... I know I need to choose the destination for 64 bit, but I do not see iTunes and I do not know how to put this title into iTunes if I can locate it? The folks at Audible wasted a lot of my time but were zero help! How can I get these books into my computer?

  Read the article

• Snort monitoring of spanning interface

  - by aHunter

  I have configured a Cisco 3500 switch with a port SPAN and have my snort node (fedora 13) plugged into it. I am running snort as a daemon and have configured a rule to log all tcp traffic but I am only seeing traffic with a destination of the snort node. I know that the SPAN port is working and wanted to know if there is a specific option that I needed to start snort with in order for it to pickup all the traffic? Or is there something that I have missed here? Many thanks.

  Read the article

• Make the recycle bin of the SSD on a RAID0 drive?

  - by Rolnik

  I don't know about you folks, but I hate the idea of junk sitting on my tiny 30GB SSD. Any way to designate another drive to be the host of the Recycle Bin for items formerly on the SSD? Basically, I need to know how to make a lower-priority drive receive the recycled materials from the 'main' drive, which happens to be short on space. The best thing I can think of is a batch file that a) syncs 'recycle' to another drive; and b) empties the recycle bin. ... but that's too much work for me.

  Read the article

• AD Local Admins without password sharing

  - by Cocoabean

  My team is building out an Active Directory environment in a small grad school with support for general computer labs, and staff/faculty machine and account management. We have a team of student consultants that are hired to do general help desk work. As of now we have a local admin account on every machine. It has the same password and all of us know it. I know it's not best practice and I want to avoid this with the new setup. We want to have local admin accounts in case there are network issues that prevent AD authentication, but we do not want this account to be generic with a shared password. Is there a way we can get each machine to cache the necessary information to authenticate a group of local admins so that if AD is somehow inaccessible, student consultants can still login with their AD admin accounts?

  Read the article

• Python - How to remove/unimport libs was imported before

  - by Marslo

  As we know that, in python 2.x, integer would be got if we divide two integer values. However, if using the furture (it's might be a lib or something like that), just like from __future__ import division, we can get float value. E.g.: >>> 3/2 1 >>> from __future__ import division >>> 3/2 1.5 >>> >>> >>> 3//2 1 >>> 4/3 1.3333333333333333 >>> So, '//' instead of '/' should be used if getting integer after imported division, but I want to know how to using '/' to get integer again. That is mean, whether there is some way to un-import or remove the libs which was imported before.

  Read the article

• PNY ExpressCard SATA II 2-port card - drivers?

  - by stewartwb

  I bought a couple of PNY eSATA cards for notebook computers, model P-NSA2-EC-RF. I mistakenly thought that they would be a bit more plug-and-play, like cards that supply USB or Firewire ports. They did not ship with the Driver CD, and the drivers I found on the PNY web site didn't work. I've emailed their support group, but we all know how likely it is that they will respond before the end of the decade. Does anyone have a driver disc handy for this model card, or know where I might download a driver ISO? (Dell XPS M1330 laptop running Windows 7 x64 and sometimes Windows 7 x86)

  Read the article

• Where does truecrypt store the backup volume header?

  - by happygolucky

  When using WDE, where does (if anywhere) truecrypt store a backup volume header? As i know there is always a backup header for regular truecrypt volumes, however i am not sure if this applies when system encryption is used. Because if i damage the volume header in track 0, my password won't boot my system anymore. So there is no backup header on the drive? I read somewhere on a forum that truecrypt might have a backup header relative to some position from the END of the HDD, however this doesn't make sense as it could easily be wiped over by programs running in Windows. And how would truecrypt know where this backup is anyway?

  Read the article

• C Language preprocessing doubt

  - by khanna_param

  Hi, There are different kind of macros in C language, nested macro is one of them. Considering a program with the following macro define HYPE(x,y) (SQUR(x)+SQUR(y)) define SQUR(x) (x*x) using this we can successfully complile to get the result. My question:- As we all know the C preprocessor replaces all the occurrence of the identifiers with the replacement-string. Considering the above example i would like to know how many times the C compiler traverses the program to replace the macro with the replacement values. I assume it cannot be done in one go. Thanks.

  Read the article

• HP Pavillion dv6 laptop - 15 beeps on startup and a black screen?

  - by dunc

  Usual story - girlfriend's step-brother's laptop is broken. I don't know a huge amount about what occurred before it broke, but I do know the following: When you try to turn the laptop on, it beeps 15 times exactly. The screen remains black. The LED on the Caps Lock key flashes continuously. If left on, the laptop never boots - as far as I can see. If left on, on a stable surface with decent ventilation for a relatively short period of time, the laptop (below keyboard, but not where the RAM/HDD are) gets very hot. I've tried doing what most websites appear to recommend for similar problems, which is to disconnect AC and battery then hold the power button down for a minute before reconnecting the AC and trying to turn the laptop on - no difference. EDIT I've also tried re-seating the RAM, to no avail. Any ideas? Thanks in advance,

  Read the article

• How to verify if my copy operation is complete in Windows 7?

  - by Tim

  Yesterday, I was leaving some job of copying a directory to run overnight. This morning however, I found the computer had restarted because of Windows Update or something. I was wondering if there is some way to check if the copy is complete? One way I guess would be check the last modified time of the copy, and when the system restarted. But I was wondering where to find the time when the system restarted? I was also wondering if where to find some logging files that have the records. I know Event Viewer, but don't know where to find within it. Other methods are welcome too. I also would like to hear suggestions for other ways to accomplish the copy instead of just simple copy and paste. Thanks and regards!

  Read the article

• Got root, now how should I configure my server?

  - by L. De Leo

  I've been a developer for years and by trade I had to know a little bit of server side configuration. But now I find myself needing to manage my own VPS instance (Amazon EC2) and I'm lost. I'd like to know what are the common ways to configure an Apache and MySQL server that is secure and efficient. For example right now I'm doing everything as root but I doubt that's the best way at all. My whole Apache is configured to serve 1 site when I'd like it to be able to serve multiple sites. Where do I start?

  Read the article

• Exchange 2007 automatically adding IP to block list

  - by Tim Anderson

  This puzzled me. We have all mail directed to an ISP's spam filter, then delivered to SBS 2008 Exchange. One of the ISP's IP numbers suddenly appeared in the ES2007 block list, set to expire in 24 hours I think, so emails started bouncing. Quick look through the typically ponderous docs, and I can't see anything that says Exchange will auto-block an IP number, but nobody is admitting to adding it manually and I think it must have done. Anyone know about this or where it is configured? Obviously one could disable block lists completely but I'd like to know exactly why this happened.

  Read the article

• How do I find out when and by whom a particular user was deleted in linux?

  - by executor21

  I've recently ran into a very odd occurrence on one system I'm using. For no apparent reason, my user account was deleted, although the home directory is still there. I have root access, so I can restore the account, but first, I want to know how this happened, and exactly when. Inspecting the root's .bash_history file and the "last" command gave nothing, and I'm (well, was) the only sudoer on the system. How would I know when this deletion happened? The distro is CentOS release 5.4 (Final), if that helps.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

< Previous Page | 447 448 449 450 451 452 453 454 455 456 457 458  | Next Page >