Search Results

Search found 105167 results on 4207 pages for 'class file'.

Page 46/4207 | < Previous Page | 42 43 44 45 46 47 48 49 50 51 52 53  | Next Page >

  • Loading a class into a function ?

    - by Adrian
    I`m currently working on a script, and I have the following situation. function somnicefunction() { require 'someexternalclass.php'; $somevar = new SomeExternalClass(); } For some reason, the above breaks the function. I'm not sure why, I haven't seen much documentation in php.net regarding this, plus google returned no real results. Does anyone have any idea ?

    Read the article

  • PHP template class with variables?

    - by Josh
    I want to make developing on my new projects easier, and I wanted a bare bones very simple template engine solution. I looked around on the net and everything is either too bloated, or makes me cringe. My HTML files will be like so: <html> <head> <title>{PAGE_TITLE}</title> </head> <body> <h1>{PAGE_HEADER}</h1> <p>Some random content that is likely not to be parsed with PHP.</p> </body> </html> Obviously, I want to replace {PAGE_TITLE} and {PAGE_HEADER} with something I set with PHP. Like this: <?php $pageElements = array( '{PAGE_TITLE}' => 'Some random title.', '{PAGE_HEADER}' => 'A page header!' ); ?> And I'd use something like str_replace and load the replaced HTML into a string, then print it to the page? This is what I'm on the path towards doing at the moment... does anyone have any advice or a way I can do this better? Thanks.

    Read the article

  • Class generation on the fly

    - by James P.
    Is it possible to generate subclasses at runtime or while an application is running? If so, how is this achieved and what precautions should be taken to prevent a rogue object wreaking havoc inside an application?

    Read the article

  • Using jquery append() in <head> (in a function/class)

    - by Anonymous
    I want to use the append() function from inside the <head>, in a function to be specific, like so: function custom_img(src_img) { $("div").append("<img src='"+src_img+"'>"); } var myimg = new custom_img("test.jpg"); This is a quick example that I just wrote out. I want my function to make a new image like that every time I create a new object like this. Obviously this doesn't work, since the append() requires to be in the body (I've tried this). How would I do this?

    Read the article

  • How do you set a "Document class" from an SWC in Flash CS4?

    - by Flash Challenge
    I have an SWC with a class called Content. I want to set it as the "Document Class" in Flash. However, after setting up the SWC in the .fla, I am receiving an error message saying that "A definition for the document class could not be found in the classpath,..." Setting up the direct class folder works fine, but I need to distribute this SWC and do not want to include the sources. Is it possible to use a class as the Document Class if it resides in an SWC? I've found some links that seem to indicate no, but I need to find out definitively. http://balazs.sebesteny.com/document-class-from-swc/ forums.adobe.com/thread/452045

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Iphone -- init method of an abstract class

    - by William Jockusch
    I want to create classes Car, Vehicle, and Airplane with the following properties: Car and Airplane are both subclasses of Vehicle. Car and Airplane both have an initWithString method. The acceptable input strings for Car's and Airplane's initWithString methods do not overlap. Vehicle is "almost abstract", in the sense that any initialized instance should be either a Car or an Airplane. It is possible to pass a string into Vehicle and get back an instance of Car, an instance of Airplane, or nil, depending on the input string. Any particular design pattern I should prefer? In particular for Vehicle's initWithString and/or newVehicleWithString methods.

    Read the article

  • PHP multiuser login class or script

    - by FFish
    I am looking for a simple but secure login script with mySQL PHP: sessions, MD5 that I can use with my exsisting database. Cookies to store password + password recovery by email. Change login/pass. I do not need registering, I register the user myself with temp login/pass. table agents agent1 agent2 table albums album1, owner: agent1 album2, owner: agent1 album3, owner: agent2 ... login.php agent1 logs in and has access to his albums: - album1 - album2 agent1 can edit his albums: edit.php?ref=album1 but NOT edit.php?ref=album3 by changing the ?ref variable

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Class Cast Exception

    - by iaagty
    why do i get this exception? Map myHash = null myHash = (HashMap)Collections.synchronizedMap(new HashMap()); If i try to use this hashmap, i get java.lang.ClassCastException

    Read the article

  • Initializing PHP class property declarations with simple expressions yields syntax error

    - by user171929
    According to the PHP docs, one can initialize properties in classes with the following restriction: "This declaration may include an initialization, but this initialization must be a constant value--that is, it must be able to be evaluated at compile time and must not depend on run-time information in order to be evaluated." I'm trying to initialize an array and having some issues. While this works fine: public $var = array( 1 => 4, 2 => 5, ); This creates a syntax error: public $var = array( 1 => 4, 2 => (4+1), ); Even this isn't accepted: public $var = 4+1; which suggests it's not a limitation of the array() language construct. Now, the last time I checked, "4+1" equated to a constant value that not only should be accepted, but should in fact be optimized away. In any case, it's certainly able to be evaluated at compile-time. So what's going on here? Is the limitation really along the lines of "cannot be any calculated expression at all", versus any expression "able to be evaluated at compile time"? The use of "evaluated" in the doc's language suggests that simple calculations are permitted, but alas.... If this is a bug in PHP, does anyone have a bug ID? I tried to find one but didn't have any luck.

    Read the article

  • How to override inner class methods if the inner class is defined as a property of the top class

    - by Maddy
    I have a code snippet like this class A(object): class b: def print_hello(self): print "Hello world" b = property(b) And I want to override the inner class b (please dont worry about the lowercase name) behaviour. Say, I want to add a new method or I want to change an existing method, like: class C(A): class b(A.b): def print_hello(self): print "Inner Class: Hello world" b = property(b) Now if I create C's object as c = C(), and call c.b I get TypeError: 'property' object is not callable error. How would I get pass this and call print_hello of the extended inner class? Disclaimer: I dont want to change the code for A class.

    Read the article

  • Objective-C Basic class related question, retaining the value of a specific object using a class fil

    - by von steiner
    Members, scholars, code gurus. My background is far from any computer programming thus my question may seems basic and somewhat trivial to you. Nevertheless it seems that I can't put my head around it. I have googled and searched for the answer, just to get myself confused even more. With that, I would kindly ask for a simple explanation suitable for a non technical person such as myself and for other alike arriving to this thread. I have left a comment with the text "Here is the issue" below, referring to my question. // character.h #import <Foundation/Foundation.h> @interface character : NSObject { NSString *name; int hitPoints; int armorClass; } @property (nonatomic,retain) NSString *name; @property int hitPoints,armorClass; -(void)giveCharacterInfo; @end // character.m #import "character.h" @implementation character @synthesize name,hitPoints,armorClass; -(void)giveCharacterInfo{ NSLog(@"name:%@ HP:%i AC:%i",name,hitPoints,armorClass); } @end // ClassAtLastViewController.h #import <UIKit/UIKit.h> @interface ClassAtLastViewController : UIViewController { } -(void)callAgain; @end // ClassAtLastViewController.m #import "ClassAtLastViewController.h" #import "character.h" @implementation ClassAtLastViewController - (void)viewDidLoad { //[super viewDidLoad]; character *player = [[character alloc]init]; player.name = @"Minsc"; player.hitPoints = 140; player.armorClass = 10; [player giveCharacterInfo]; [player release]; // Up until here, All peachy! [self performSelector:@selector(callAgain) withObject:nil afterDelay:2.0]; } -(void)callAgain{ // Here is the issue, I assume that since I init the player again I loss everything // Q1. I loss all the data I set above, where is it than? // Q2. What is the proper way to implement this character *player = [[character alloc]init]; [player giveCharacterInfo]; } Many thanks in advance, Kindly remember that my background is more related to Salmons breeding than to computer code, try and lower your answer to my level if it's all the same to you.

    Read the article

  • C++/CLI value class constraint won't compile. Why?

    - by Simon
    Hello, a few weeks ago a co-worker of mine spent about two hours finding out why this piece of C++/CLI code won't compile with Visual Studio 2008 (I just tested it with Visual Studio 2010... same story). public ref class Test { generic<class T> where T : value class void MyMethod(Nullable<T> nullable) { } }; The compiler says: Error 1 error C3214: 'T' : invalid type argument for generic parameter 'T' of generic 'System::Nullable', does not meet constraint 'System::ValueType ^' C:\Users\Simon\Desktop\Projektdokumentation\GridLayoutPanel\Generics\Generics.cpp 11 1 Generics Adding ValueType will make the code compile. public ref class Test { generic<class T> where T : value class, ValueType void MyMethod(Nullable<T> nullable) { } }; My question is now. Why? What is the difference between value class and ValueType?

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

  • C++, Ifstream opens local file but not file on HTTP Server

    - by fammi
    Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

    Read the article

< Previous Page | 42 43 44 45 46 47 48 49 50 51 52 53  | Next Page >