Search Results

Search found 22358 results on 895 pages for 'django raw query'.

Page 460/895 | < Previous Page | 456 457 458 459 460 461 462 463 464 465 466 467  | Next Page >

  • Combining aggregate functions in an (ANSI) SQL statement

    - by morpheous
    I have aggregate functions foo(), foobar(), fredstats(), barneystats() I want to create a domain specific query language (DSQL) above my DB, to facilitate using using a domain language to query the DB. The 'language' comprises of boolean expressions (or more specifically SQL like criteria) which I then 'translate' back into pure (ANSI) SQL and send to the underlying Db. The following lines are examples of what the language statements will look like, and hopefully, it will help further clarify the concept: **Example 1** DQL statement: foobar('yellow') between 1 and 3 and fredstats('weight') > 42 Translation: fetch all rows in an underlying table where computed values for aggregate function foobar() is between 1 and 3 AND computed value for AGG FUNC fredstats() is greater than 42 **Example 2** DQL statement: fredstats('weight') < barneystats('weight') AND foo('fighter') in (9,10,11) AND foobar('green') <> 42 Translation: Fetch all rows where the specified criteria matches **Example 3** DQL statement: foobar('green') / foobar('red') <> 42 Translation: Fetch all rows where the specified criteria matches **Example 4** DQL statement: foobar('green') - foobar('red') >= 42 Translation: Fetch all rows where the specified criteria matches Given the following information: The table upon which the queries above are being executed is called 'tbl' table 'tbl' has the following structure (id int, name varchar(32), weight float) The result set returns only the tbl.id, tbl.name and the names of the aggregate functions as columns in the result set - so for example the foobar() AGG FUNC column will be called foobar in the result set. So for example, the first DQL query will return a result set with the following columns: id, name, foobar, fredstats Given the above, my questions then are: What would be the underlying SQL required for Example1 ? What would be the underlying SQL required for Example3 ? Given an algebraic equation comprising of AGGREGATE functions, Is there a way of generalizing the algorithm needed to generate the required ANSI SQL statement(s)? I am using PostgreSQL as the db, but I would prefer to use ANSI SQL wherever possible.

    Read the article

  • Oracle doesn't remove cursors after closing result set

    - by Vladimir
    Note: we reuse single connection. ************************************************ public Connection connection() {                try {            if ((connection == null) || (connection.isClosed()))            {               if (connection!=null) log.severe("Connection was closed !");                connection = DriverManager.getConnection(jdbcURL, username, password);            }        } catch (SQLException e) {            log.severe("can't connect: " + e.getMessage());        }        return connection;            } ************************************************** public IngisObject[] select(String query, String idColumnName, String[] columns) { Connection con = connection(); Vector<IngisObject> objects = new Vector<IngisObject>(); try {     Statement stmt = con.createStatement();     String sql = query;     ResultSet rs =stmt.executeQuery(sql);//oracle increases cursors count here     while(rs.next()) {        IngisObject o = new IngisObject("New Result");        o.setIdColumnName(idColumnName);                    o.setDatabase(this);        for(String column: columns) o.attrs().put(column, rs.getObject(column));        objects.add(o);        }     rs.close();// oracle don't decrease cursor count here, while it's expected     stmt.close();     } catch (SQLException ex) {     System.out.println(query);     ex.printStackTrace(); }

    Read the article

  • dig works but dig +trace <domain_name> not working

    - by anoopmathew
    In my local system i can't get the proper result of dig +trace , but dig works fine. I'm using Ubuntu 10.04 LTS version. I'll attach the result of dig and dig +trace along with this updates. dig +trace gmail.com ; << DiG 9.7.0-P1 << +trace gmail.com ;; global options: +cmd ;; Received 12 bytes from 4.2.2.4#53(4.2.2.4) in 291 ms dig gmail.com ; << DiG 9.7.0-P1 << gmail.com ;; global options: +cmd ;; Got answer: ;; -HEADER<<- opcode: QUERY, status: NOERROR, id: 59528 ;; flags: qr rd ra; QUERY: 1, ANSWER: 2, AUTHORITY: 0, ADDITIONAL: 0 ;; QUESTION SECTION: ;gmail.com. IN A ;; ANSWER SECTION: gmail.com. 49 IN A 74.125.236.118 gmail.com. 49 IN A 74.125.236.117 ;; Query time: 302 msec ;; SERVER: 4.2.2.4#53(4.2.2.4) ;; WHEN: Sat Oct 13 14:57:56 2012 ;; MSG SIZE rcvd: 59 Please anyone update a solution for this issue. I'm just worried about my issue.

    Read the article

  • How to let mod_wsgi only handle certain URLs under Apache?

    - by Frederik
    I have a Django app that handles "/admin/" and "/myapp/". All the other requests should be handled by Apache. I've tried using LocationMatch but then I'd have to write a negative regex. I've tried WSGIScriptAlias with the /admin/ prefix but then the wsgi_handler receives the request with the /admin/ part cut off. Is there a cleaner way to make mod_wsgi only handle certain requests?

    Read the article

  • SQL Server search filter and order by performance issues

    - by John Leidegren
    We have a table value function that returns a list of people you may access, and we have a relation between a search and a person called search result. What we want to do is that wan't to select all people from the search and present them. The query looks like this SELECT qm.PersonID, p.FullName FROM QueryMembership qm INNER JOIN dbo.GetPersonAccess(1) ON GetPersonAccess.PersonID = qm.PersonID INNER JOIN Person p ON p.PersonID = qm.PersonID WHERE qm.QueryID = 1234 There are only 25 rows with QueryID=1234 but there are almost 5 million rows total in the QueryMembership table. The person table has about 40K people in it. QueryID is not a PK, but it is an index. The query plan tells me 97% of the total cost is spent doing "Key Lookup" witht the seek predicate. QueryMembershipID = Scalar Operator (QueryMembership.QueryMembershipID as QM.QueryMembershipID) Why is the PK in there when it's not used in the query at all? and why is it taking so long time? The number of people total 25, with the index, this should be a table scan for all the QueryMembership rows that have QueryID=1234 and then a JOIN on the 25 people that exists in the table value function. Which btw only have to be evaluated once and completes in less than 1 second.

    Read the article

  • bing search api ajax does not work

    - by jhon
    Hi guys, I want to use the Bing's search api with javascript. Actually, I want the user to write something and query Bing in order to get just images. so, I tried it using ajax. If I try the url http://api.search.live.net/xml.aspx?Appid=[YOURAPIKEY]&sources=image&query=home directly (with the browser) I do get an xml document. but if I use XMLHttpRequest it does not work. <html> <body> <script> var xhr = new XMLHttpRequest(); var url="http://api.search.live.net/xml.aspx?Appid=[YOURAPIKEY]&sources=image&query=home" xhr.open("GET", url, true ); xhr.onreadystatechange=function(){ /*if( xhr.readyState == 4 && xhr.status == 200) { document.write( xhr.responseText ); }*/ alert( xhr.readyState +" "+xhr.status +xhr.statusText +xhr); }; xhr.send(null); </script> </body> </html> Questions: 1) why does the code from above does not work? 2) any other way to do this without XMLHttpRequest? thanks. btw. I'm just interested in fix this for Firefox and without external libraries (jquery and so on).

    Read the article

  • Is there a standard for storing normalized phone numbers in a database?

    - by Eric Z Beard
    What is a good data structure for storing phone numbers in database fields? I'm looking for something that is flexible enough to handle international numbers, and also something that allows the various parts of the number to be queried efficiently. [Edit] Just to clarify the use case here: I currently store numbers in a single varchar field, and I leave them just as the customer entered them. Then, when the number is needed by code, I normalize it. The problem is that if I want to query a few million rows to find matching phone numbers, it involves a function, like where dbo.f_normalizenum(num1) = dbo.f_normalizenum(num2) which is terribly inefficient. Also queries that are looking for things like the area code become extremely tricky when it's just a single varchar field. [Edit] People have made lots of good suggestions here, thanks! As an update, here is what I'm doing now: I still store numbers exactly as they were entered, in a varchar field, but instead of normalizing things at query time, I have a trigger that does all that work as records are inserted or updated. So I have ints or bigints for any parts that I need to query, and those fields are indexed to make queries run faster.

    Read the article

  • Optimal two variable linear regression SQL statement

    - by Dave Jarvis
    Problem Am looking to apply the y = mx + b equation (where m is SLOPE, b is INTERCEPT) to a data set, which is retrieved as shown in the SQL code. The values from the (MySQL) query are: SLOPE = 0.0276653965651912 INTERCEPT = -57.2338357550468 SQL Code SELECT ((sum(t.YEAR) * sum(t.AMOUNT)) - (count(1) * sum(t.YEAR * t.AMOUNT))) / (power(sum(t.YEAR), 2) - count(1) * sum(power(t.YEAR, 2))) as SLOPE, ((sum( t.YEAR ) * sum( t.YEAR * t.AMOUNT )) - (sum( t.AMOUNT ) * sum(power(t.YEAR, 2)))) / (power(sum(t.YEAR), 2) - count(1) * sum(power(t.YEAR, 2))) as INTERCEPT FROM (SELECT D.AMOUNT, Y.YEAR FROM CITY C, STATION S, YEAR_REF Y, MONTH_REF M, DAILY D WHERE -- For a specific city ... -- C.ID = 8590 AND -- Find all the stations within a 5 unit radius ... -- SQRT( POW( C.LATITUDE - S.LATITUDE, 2 ) + POW( C.LONGITUDE - S.LONGITUDE, 2 ) ) <15 AND -- Gather all known years for that station ... -- S.STATION_DISTRICT_ID = Y.STATION_DISTRICT_ID AND -- The data before 1900 is shaky; and insufficient after 2009. -- Y.YEAR BETWEEN 1900 AND 2009 AND -- Filtered by all known months ... -- M.YEAR_REF_ID = Y.ID AND -- Whittled down by category ... -- M.CATEGORY_ID = '001' AND -- Into the valid daily climate data. -- M.ID = D.MONTH_REF_ID AND D.DAILY_FLAG_ID <> 'M' GROUP BY Y.YEAR ORDER BY Y.YEAR ) t Data The data is visualized here: Questions How do I return the y value against all rows without repeating the same query to collect and collate the data? That is, how do I "reuse" the list of t values? How would you change the query to eliminate outliers (at an 85% confidence interval)? The following results (to calculate the start and end points of the line) appear incorrect. Why are the results off by ~10 degrees (e.g., outliers skewing the data)? (1900 * 0.0276653965651912) + (-57.2338357550468) = -4.66958228 (2009 * 0.0276653965651912) + (-57.2338357550468) = -1.65405406 I would have expected the 1900 result to be around 10 (not -4.67) and the 2009 result to be around 11.50 (not -1.65). Thank you!

    Read the article

  • MySQL FULLTEXT not working

    - by Ross
    I'm attempting to add searching support for my PHP web app using MySQL's FULLTEXT indexes. I created a test table (using the MyISAM type, with a single text field a) and entered some sample data. Now if I'm right the following query should return both those rows: SELECT * FROM test WHERE MATCH(a) AGAINST('databases') However it returns none. I've done a bit of research and I'm doing everything right as far as I can tell - the table is a MyISAM table, the FULLTEXT indexes are set. I've tried running the query from the prompt and from phpMyAdmin, with no luck. Am I missing something crucial? UPDATE: Ok, while Cody's solution worked in my test case it doesn't seem to work on my actual table: CREATE TABLE IF NOT EXISTS `uploads` ( `id` int(11) NOT NULL AUTO_INCREMENT, `name` text NOT NULL, `size` int(11) NOT NULL, `type` text NOT NULL, `alias` text NOT NULL, `md5sum` text NOT NULL, `uploaded` datetime NOT NULL, PRIMARY KEY (`id`) ) ENGINE=MyISAM DEFAULT CHARSET=latin1 AUTO_INCREMENT=6 ; And the data I'm using: INSERT INTO `uploads` (`id`, `name`, `size`, `type`, `alias`, `md5sum`, `uploaded`) VALUES (1, '04 Sickman.mp3', 5261182, 'audio/mp3', '1', 'df2eb6a360fbfa8e0c9893aadc2289de', '2009-07-14 16:08:02'), (2, '07 Dirt.mp3', 5056435, 'audio/mp3', '2', 'edcb873a75c94b5d0368681e4bd9ca41', '2009-07-14 16:08:08'), (3, 'header_bg2.png', 16765, 'image/png', '3', '5bc5cb5c45c7fa329dc881a8476a2af6', '2009-07-14 16:08:30'), (4, 'page_top_right2.png', 5299, 'image/png', '4', '53ea39f826b7c7aeba11060c0d8f4e81', '2009-07-14 16:08:37'), (5, 'todo.txt', 392, 'text/plain', '5', '7ee46db77d1b98b145c9a95444d8dc67', '2009-07-14 16:08:46'); The query I'm now running is: SELECT * FROM `uploads` WHERE MATCH(name) AGAINST ('header' IN BOOLEAN MODE) Which should return row 3, header_bg2.png. Instead I get another empty result set. My options for boolean searching are below: mysql> show variables like 'ft_%'; +--------------------------+----------------+ | Variable_name | Value | +--------------------------+----------------+ | ft_boolean_syntax | + -><()~*:""&| | | ft_max_word_len | 84 | | ft_min_word_len | 4 | | ft_query_expansion_limit | 20 | | ft_stopword_file | (built-in) | +--------------------------+----------------+ 5 rows in set (0.02 sec) "header" is within the word length restrictions and I doubt it's a stop word (I'm not sure how to get the list). Any ideas?

    Read the article

  • .NET 4.0 Implementing OutputCacheProvider

    - by azamsharp
    I am checking out the OutputCacheProvider in ASP.NET 4.0 and using it to store my output cache into the MongoDb database. I am not able to understand the purpose of Add method which is one of the override methods for OutputCacheProvider. The Add method is invoked when you have VaryByParam set to something. So, if I have VaryByParam = "id" then the Add method will be invoked. But after the Add the Set is also invoked and I can insert into the MongoDb database inside the Set method. public override void Set(string key, object entry, DateTime utcExpiry) { // if there is something in the query and use the path and query to generate the key var url = HttpContext.Current.Request.Url; if (!String.IsNullOrEmpty(url.Query)) { key = url.PathAndQuery; } Debug.WriteLine("Set(" + key + "," + entry + "," + utcExpiry + ")"); _service.Set(new CacheItem() { Key = MD5(key), Item = entry, Expires = utcExpiry }); } Inside the Set method I use the PathAndQuery to get the params of the QueryString and then do a MD5 on the key and save it into the MongoDb database. It seems like the Add method will be useful if I am doing something like VaryByParam = "custom" or something. Can anyone shed some light on the Add method of OutputCacheProvider?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Grub Error 18 - Solid State Drive

    - by clint
    I recently used Raw Copy to make an image of my 300gb Raptor Hd to a OCZ Vertex SSD 60GB. And When I pluged in the SSD to boot I get a Grub Error 18. I have tried to changed in the BIOS setting to LBA, Large, Auto, trying different combination's. Any advice. thanks, Clint

    Read the article

  • Counting computers for each lab

    - by Irvin
    Alright I have a problem with having to count PCs, and Macs from different labs. In each lab I need to display how many PC and Macs there is available. The data is coming from a SQL server, right am trying sub queries and the use of union, this the closest I can get to what I need. The query below shows me the number of PCs, and Macs in two different columns, but of course, the PCs will be in one row and the Macs on another right below it. Having the lab come up twice. EX: LabName -- PC / MAC Lab1 -- 5 / 0 Lab1 -- 0 / 2 Query SELECT Labs.LabName, COUNT(*),0 AS Mac FROM HardWare INNER JOIN Labs ON HardWare.LabID = Labs.LabID WHERE ComputerStatus = 'AVAILABLE' GROUP BY Labs.LabName UNION SELECT Labs.LabName, COUNT(*), (SELECT COUNT(Manufacturer)) AS Mac FROM HardWare INNER JOIN Labs ON HardWare.LabID = Labs.LabID WHERE ComputerStatus = 'AVAILABLE' AND Manufacturer = 'Apple' GROUP BY Labs.LabName ORDER BY Labs.LabName So is there any way to get them together in one row as in Lab1 -- 5 / 2 or is there a different way to write the query? anything will be a big help, am pretty much stuck here. Cheers

    Read the article

  • Ubuntu says FAT16, windows says NTF?

    - by myforwik
    I created a partition on USB harddisk in windows and it reports to be an NTFS partition. Yet in ubuntu 9.10 fdisk says it a FAT16 partition. If I mount with -t ntfs I see nothing, but if I mount without it I see all the files. Can anyone tell me whats going on here? Windows computer disk management definately says its NTFS, and a quick look at the raw data suggests it is NTFS, as I know the FAT16 very well.

    Read the article

  • i am getting error like mysql_connect() acces denied for system@localhost(using password NO)

    - by user309381
    class MySQLDatabase { public $connection; function _construct() { $this->open_connection();} public function open_connection() {$this->connection = mysql_connect(DB_SERVER,DB_USER,DB_PASS); if(!$this->connection){die("Database Connection Failed" . mysql_error());} else{$db_select = mysql_select_db(DB_NAME,$this->connection); if(!$db_select){die("Database Selection Failed" . mysql_error()); } }} public function close_connection({ if(isset($this->connection)){ mysql_close($this->connection); unset($this->connection);}} public function query(/*$sql*/){ $sql = "SELECT*FROM users where id = 1"; $result = mysql_query($sql); $this->confirm_query($result); //return $result;while( $found_user = mysql_fetch_assoc($result)) { echo $found_user ['username']; } } private function confirm_query($result) { if(!$result) { die("The Query has problem" . mysql_error()); } } } $database = new MySQLDatabase(); $database->open_connection(); $database->query(); $database->close_connection(); ?>

    Read the article

  • sending email with codeigniter

    - by Maru
    I have this MODEL and I get the email which I want to send class Cliente_Model extends CI_Model{ public function getInfo($id){ $this->db->select('*'); $this->db->from('pendientes'); $query = $this->db->get(); if($query->num_rows() > 0) { foreach ($query->result_array() as $row) { return $row['email']; } } else { return FALSE; } } } CONTROLLER $this->load->model('cliente_model', 'client'); $clientInfo = $this->client->getInfo($id); $this->email->from('[email protected]', 'Demo'); $this->email->to($clientInfo); $this->email->subject('Email Test'); $this->email->message('your user is '.$clientInfo.' and your password is '.$clave); $this->email->send(); and I need some help here, I can get the email and it can send it perfectly but in the message I need to send the password also and I don't know how I can get it from the model. thanks in advance!

    Read the article

  • Recover harddrive data

    - by gameshints
    I have a dell laptop that recently "died" (It would get the blue screen of death upon starting) and the hard drive would make a weird cyclic clicking noises. I wanted to see if I could use some tools on my linux machine to recover the data, so I plugged it into there. If I run "fdisk" I get: Disk /dev/sdb: 20.0 GB, 20003880960 bytes 64 heads, 32 sectors/track, 19077 cylinders Units = cylinders of 2048 * 512 = 1048576 bytes Disk identifier: 0x64651a0a Disk /dev/sdb doesn't contain a valid partition table Fine, the partition table is messed up. However if I run "testdisk" in attempt to fix the table, it freezes at this point, making the same cyclical clicking noises: Disk /dev/sdb - 20 GB / 18 GiB - CHS 19078 64 32 Analyse cylinder 158/19077: 00% I don't really care about the hard drive working again, and just the data, so I ran "gpart" to figure out where the partitions used to be. I got this: dev(/dev/sdb) mss(512) chs(19077/64/32)(LBA) #s(39069696) size(19077mb) * Warning: strange partition table magic 0x2A55. Primary partition(1) type: 222(0xDE)(UNKNOWN) size: 15mb #s(31429) s(63-31491) chs: (0/1/1)-(3/126/63)d (0/1/32)-(15/24/4)r hex: 00 01 01 00 DE 7E 3F 03 3F 00 00 00 C5 7A 00 00 Primary partition(2) type: 007(0x07)(OS/2 HPFS, NTFS, QNX or Advanced UNIX) (BOOT) size: 19021mb #s(38956987) s(31492-38988478) chs: (4/0/1)-(895/126/63)d (15/24/5)-(19037/21/31)r hex: 80 00 01 04 07 7E FF 7F 04 7B 00 00 BB 6F 52 02 So I tried to mount just to the old NTFS partition, but got an error: sudo mount -o loop,ro,offset=16123904 -t ntfs /dev/sdb /mnt/usb NTFS signature is missing. Ugh. Okay. But then I tried to get a raw data dump by running dd if=/dev/sdb of=/home/erik/brokenhd skip=31492 count=38956987 But the file got up to 59885568 bytes, and made the same cyclical clicking noises. Obviously there is a bad sector, but I don't know what to do about it! The data is still there... if I view that 57MB file in textpad... I can see raw data from files. How can I get my data back? Thanks for any suggestions, Solution: I was able to recover about 90% of my data: Froze harddrive in freezer Used Ddrescue to make a copy of the drive Since Ddrescue wasn't able to get enough of my drive to use testdisk to recover my partitions/file system, I ended up using photorec to recover most of my files

    Read the article

  • Selecting a whole database over an individual table to output to file

    - by Daniel Wrigley
    :::::::: EDIT :::::::: New code for people to have a look at, one question I have with this is where do I set were the *.gz file is saved? $backupFile = $dbname . date("Y-m-d-H-i-s") . '.gz'; $command = "mysqldump --opt -h $dbhost -u $dbuser -p $dbpass $dbname | gzip > $backupFile"; system($command); Also why the hell can you not reply yo your own post with answering it? :( :::::::: EDIT :::::::: Ok Im having trouble finding out how to select a full database for backup as an *.sql file rather than only an individual table. On the localhost I have several databases with one named "foo" and it is that which I want to backup and not any of the individual tables inside the database "foo". The code to connect to the database; //Database Information $dbhost = "localhost"; $dbname = "foo"; $dbuser = "bar"; $dbpass = "rulz"; //Connect to database mysql_connect ($dbhost, $dbuser, $dbpass) or die("Could not connect: ".mysql_error()); mysql_select_db($dbname) or die(mysql_error()); The code to backup the database; // Grab the time to know when this post was submitted $time = date('Y-m-d-H-i-s'); $tableName = 'foo'; $backupFile = '/sql/backup/'. $time .'.sql'; $query = "SELECT * INTO OUTFILE '". $backupFile ."' FROM ". $tableName .""; $result = mysql_query($query)or die("Database query died: " . mysql_error()); My brain is hurting near to the end of the day so no doubts i've missed something out very obvious. Thanks in advance to anyone helping me out.

    Read the article

  • How to Import flip video to Final Cut Pro and edit flip video in Final Cut Pro?

    - by Yinahd
    Final Cut Pro is a professional video editing application for Mac users and it is widely used even by many Hollywood people on professional movie post-production. If you are a flip video fan and you want to give professional editing to your flip videos, Final Cut Pro is a great choice. However, Final Cut Pro does not allow raw flip videos to be imported to Final Cut Pro and you will need to convert flip video to Final Cut Pro supported formats.

    Read the article

  • I need to monitor a physical RS232 port on an appliance?

    - by Kendor
    I need to verify what's being output on an RS232 port of an appliance that's running proprietary software (e.g. NOT Windows or Linux). The port is sending data to a target app on another appliance, but I need to verify/log the actual data raw outside of the appliances. Would appreciate a recommendation on process/software to attach to the physical sending port (I have a straight through RS232 cable) and grab sample output of that port.

    Read the article

  • Ruby on Rails - Primary and Foreign key

    - by Eef
    Hey, I am creating a site in Ruby on Rails, I have two models a User model and a Transaction model. These models both belong to an account so they both have a field called account_id I am trying to setup a association between them like so: class User < ActiveRecord::Base belongs_to :account has_many :transactions end class Transaction < ActiveRecord::Base belongs_to :account belongs_to :user end I am using these associations like so: user = User.find(1) transactions = user.transactions At the moment the application is trying to find the transactions with the user_id, here is the SQL it generates: Mysql::Error: Unknown column 'transactions.user_id' in 'where clause': SELECT * FROM `transactions` WHERE (`transactions`.user_id = 1) This is incorrect as I would like the find the transactions via the account_id, I have tried setting the associations like so: class User < ActiveRecord::Base belongs_to :account has_many :transactions, :primary_key => :account_id, :class_name => "Transaction" end class Transaction < ActiveRecord::Base belongs_to :account belongs_to :user, :foreign_key => :account_id, :class_name => "User" end This almost achieves what I am looking to do and generates the following SQL: Mysql::Error: Unknown column 'transactions.user_id' in 'where clause': SELECT * FROM `transactions` WHERE (`transactions`.user_id = 104) The number 104 is the correct account_id but it is still trying to query the transaction table for a user_id field. Could someone give me some advice on how I setup the associations to query the transaction table for the account_id instead of the user_id resulting in a SQL query like so: SELECT * FROM `transactions` WHERE (`transactions`.account_id = 104) Cheers Eef

    Read the article

  • Using Partitions for a large MySQL table

    - by user293594
    An update on my attempts to implement a 505,000,000-row table on MySQL on my MacBook Pro: Following the advice given, I have partitioned my table, tr: i UNSIGNED INT NOT NULL, j UNSIGNED INT NOT NULL, A FLOAT(12,8) NOT NULL, nu BIGINT NOT NULL, KEY (nu), key (A) with a range on nu. nu ought to be a real number, but because I only have 6-d.p. accuracy and the maximum value of nu is 30000. I multiplied it by 10^8 made it a BIGINT - I gather one can't use FLOAT or DOUBLE values to PARTITION a MySQL table. Anyway, I have 15 partitions (p0: nu<25,000,000,000, p1: nu<50,000,000,000, etc.). I was thinking that this should speed up a typical to SELECT: SELECT * FROM tr WHERE nu>95000000000 AND nu<100000000000 AND A.>1. to something of the order of the same query on a table consisting of only the data in the relevant partition (<30 secs). But it's taking 30mins+ to return rows for queries within a partition and double that if the query is for rows spanning two (contiguous) partitions. I realise I could just have 15 different tables, and query them separately, but is there a way to do this 'automatically' with partitions? Has anyone got any suggestions?

    Read the article

  • HATEOAS - Discovery and URI Templating

    - by Paul Kirby
    I'm designing a HATEOAS API for internal data at my company, but have been having troubles with the discovery of links. Consider the following set of steps for someone to retrieve information about a specific employee in this system: User sends GET to http://coredata/ to get all available resources, returns a number of links including one tagged as rel = "http://coredata/rels/employees" User follows HREF on the rel from the first request, performing a GET at (for example) http://coredata/employees The data returned from this last call is my conundrum and a situation where I've heard mixed suggestions. Here are some of them: That GET will return all employees (with perhaps truncated data), and the client would be responsible for picking the one it wants from that list. That GET would return a number of URI templated links describing how to query / get one employee / get all employees. Something like: "_links": { "http://coredata/rels/employees#RetrieveOne": { "href": "http://coredata/employees/{id}" }, "http://coredata/rels/employees#Query": { "href": "http://coredata/employees{?login,firstName,lastName}" }, "http://coredata/rels/employees#All": { "href": "http://coredata/employees/all" } } I'm a little stuck here with what remains closest to HATEOAS. For option 1, I really do not want to make my clients retrieve all employees every time for the sake of navigation, but I can see how using URI templating in example two introduces some out-of-band knowledge. My other thought was to use the RetrieveOne, Query, and All operations as my cool URLs, but that seems to violate the concept that you should be able to navigate to the resources you want from one base URI. Has anyone else managed to come up with a good way to handle this? Navigation is dead simple once you've retrieved one resource or a set of resources, but it seems very difficult to use for discovery.

    Read the article

  • Generalizing Fibonacci sequence with SICStus Prolog

    - by Christophe Herreman
    I'm trying to find a solution for a query on a generalized Fibonacci sequence (GFS). The query is: are there any GFS that have 885 as their 12th number? The initial 2 numbers may be restricted between 1 and 10. I already found the solution to find the Nth number in a sequence that starts at (1, 1) in which I explicitly define the initial numbers. Here is what I have for this: fib(1, 1). fib(2, 1). fib(N, X) :- N #> 1, Nmin1 #= N - 1, Nmin2 #= N - 2, fib(Nmin1, Xmin1), fib(Nmin2, Xmin2), X #= Xmin1 + Xmin2. For the query mentioned I thought the following would do the trick, in which I reuse the fib method without defining the initial numbers explicitly since this now needs to be done dynamically: fib2 :- X1 in 1..10, X2 in 1..10, fib(1, X1), fib(2, X2), fib(12, 885). ... but this does not seem to work. Is it not possible this way to define the initial numbers, or am I doing something terribly wrong? I'm not asking for the solution, but any advice that could help me solve this would be greatly appreciated.

    Read the article

  • facebook javascript api

    - by ngreenwood6
    I am trying to get my status from facebook using the javascript api. I have the following code: <div id="fb-root"></div> <div id="data"></div> <script src="http://connect.facebook.net/en_US/all.js"></script> <script type="text/javascript"> (function(){ FB.init({ appId : 'SOME ID', status : true, // check login status cookie : true, // enable cookies to allow the server to access the session xfbml : true // parse XFBML }); }); getData(); function getData(){ var query = FB.Data.query('SELECT message FROM status WHERE uid=12345 LIMIT 10'); query.wait(function(rows) { for(i=0;i<rows.length;i++){ document.getElementById('data').innerHTML += 'Your status is ' + rows[i].message + '<br />'; } }); } </script> When i try to get my name it works fine but the status is not working. Can someone please tell me what I am doing wrong because the documentation for this is horrible. And yes I replaced the uid with a fake one and yes i put in my app id because like i said when i try to get my name it works fine. Any help is appreciated.

    Read the article

< Previous Page | 456 457 458 459 460 461 462 463 464 465 466 467  | Next Page >