Search Results

Search found 22358 results on 895 pages for 'django raw query'.

Page 461/895 | < Previous Page | 457 458 459 460 461 462 463 464 465 466 467 468  | Next Page >

  • How to Import flip video to Final Cut Pro and edit flip video in Final Cut Pro?

    - by Yinahd
    Final Cut Pro is a professional video editing application for Mac users and it is widely used even by many Hollywood people on professional movie post-production. If you are a flip video fan and you want to give professional editing to your flip videos, Final Cut Pro is a great choice. However, Final Cut Pro does not allow raw flip videos to be imported to Final Cut Pro and you will need to convert flip video to Final Cut Pro supported formats.

    Read the article

  • HATEOAS - Discovery and URI Templating

    - by Paul Kirby
    I'm designing a HATEOAS API for internal data at my company, but have been having troubles with the discovery of links. Consider the following set of steps for someone to retrieve information about a specific employee in this system: User sends GET to http://coredata/ to get all available resources, returns a number of links including one tagged as rel = "http://coredata/rels/employees" User follows HREF on the rel from the first request, performing a GET at (for example) http://coredata/employees The data returned from this last call is my conundrum and a situation where I've heard mixed suggestions. Here are some of them: That GET will return all employees (with perhaps truncated data), and the client would be responsible for picking the one it wants from that list. That GET would return a number of URI templated links describing how to query / get one employee / get all employees. Something like: "_links": { "http://coredata/rels/employees#RetrieveOne": { "href": "http://coredata/employees/{id}" }, "http://coredata/rels/employees#Query": { "href": "http://coredata/employees{?login,firstName,lastName}" }, "http://coredata/rels/employees#All": { "href": "http://coredata/employees/all" } } I'm a little stuck here with what remains closest to HATEOAS. For option 1, I really do not want to make my clients retrieve all employees every time for the sake of navigation, but I can see how using URI templating in example two introduces some out-of-band knowledge. My other thought was to use the RetrieveOne, Query, and All operations as my cool URLs, but that seems to violate the concept that you should be able to navigate to the resources you want from one base URI. Has anyone else managed to come up with a good way to handle this? Navigation is dead simple once you've retrieved one resource or a set of resources, but it seems very difficult to use for discovery.

    Read the article

  • Selecting a whole database over an individual table to output to file

    - by Daniel Wrigley
    :::::::: EDIT :::::::: New code for people to have a look at, one question I have with this is where do I set were the *.gz file is saved? $backupFile = $dbname . date("Y-m-d-H-i-s") . '.gz'; $command = "mysqldump --opt -h $dbhost -u $dbuser -p $dbpass $dbname | gzip > $backupFile"; system($command); Also why the hell can you not reply yo your own post with answering it? :( :::::::: EDIT :::::::: Ok Im having trouble finding out how to select a full database for backup as an *.sql file rather than only an individual table. On the localhost I have several databases with one named "foo" and it is that which I want to backup and not any of the individual tables inside the database "foo". The code to connect to the database; //Database Information $dbhost = "localhost"; $dbname = "foo"; $dbuser = "bar"; $dbpass = "rulz"; //Connect to database mysql_connect ($dbhost, $dbuser, $dbpass) or die("Could not connect: ".mysql_error()); mysql_select_db($dbname) or die(mysql_error()); The code to backup the database; // Grab the time to know when this post was submitted $time = date('Y-m-d-H-i-s'); $tableName = 'foo'; $backupFile = '/sql/backup/'. $time .'.sql'; $query = "SELECT * INTO OUTFILE '". $backupFile ."' FROM ". $tableName .""; $result = mysql_query($query)or die("Database query died: " . mysql_error()); My brain is hurting near to the end of the day so no doubts i've missed something out very obvious. Thanks in advance to anyone helping me out.

    Read the article

  • How to handle pagination queries properly with mongodb and php?

    - by luckytaxi
    Am I doing this right? I went to look at some old PHP code w/ MySQL and I've managed to get it to work, however I'm wondering if there's a much "cleaner" and "faster" way of accomplishing this. First I would need to get the total number of "documents" $total_documents = $collection->find(array("tags" => $tag, "seeking" => $this->session->userdata('gender'), "gender" => $this->session->userdata('seeking')))->count(); $skip = (int)($docs_per_page * ($page - 1)); $limit = $docs_per_page; $total_pages = ceil($total_documents / $limit); // Query to populate array so I can display with pagination $data['result'] = $collection->find(array("tags" => $tag, "seeking" => $this->session->userdata('gender'), "gender" => $this->session->userdata('seeking')))->limit($limit)->skip($skip)->sort(array("_id" => -1)); My question is, can I run the query in one shot? I'm basically running the same query twice, except the second time I'm passing the value to skip between records.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Tell me SQL Server Full-Text searcher is crazy, not me.

    - by Ian Boyd
    i have some customers with a particular address that the user is searching for: 123 generic way There are 5 rows in the database that match: ResidentialAddress1 ============================= 123 GENERIC WAY 123 GENERIC WAY 123 GENERIC WAY 123 GENERIC WAY 123 GENERIC WAY i run a FT query to look for these rows. i'll show you each step as i add more criteria to the search: SELECT ResidentialAddress1 FROM Patrons WHERE CONTAINS(Patrons.ResidentialAddress1, '"123*"') ResidentialAddress1 ========================= 123 MAPLE STREET 12345 TEST 123 MINE STREET 123 GENERIC WAY 123 FAKE STREET ... (30 row(s) affected) Okay, so far so good, now adding the word "generic": SELECT ResidentialAddress1 FROM Patrons WHERE CONTAINS(Patrons.ResidentialAddress1, '"123*"') AND CONTAINS(Patrons.ResidentialAddress1, '"generic*"') ResidentialAddress1 ============================= 123 GENERIC WAY 123 GENERIC WAY 123 GENERIC WAY 123 GENERIC WAY 123 GENERIC WAY (5 row(s) affected) Excellent. And now i'l add the final keyword that the user wants to make sure exists: SELECT ResidentialAddress1 FROM Patrons WHERE CONTAINS(Patrons.ResidentialAddress1, '"123*"') AND CONTAINS(Patrons.ResidentialAddress1, '"generic*"') AND CONTAINS(Patrons.ResidentialAddress1, '"way*"') ResidentialAddress1 ------------------------------ (0 row(s) affected) Huh? No rows? What if i query for just "way*": SELECT ResidentialAddress1 FROM Patrons WHERE CONTAINS(Patrons.ResidentialAddress1, '"way*"') ResidentialAddress1 ------------------------------ (0 row(s) affected) At first i thought that perhaps it's because of the *, and it's requiring that the root way have more characters after it. But that's not true: Searching for "123*" matches "123" Searching for "generic*" matches "generic" Books online says, The asterisk matches zero, one, or more characters What if i remove the * just for s&g: SELECT ResidentialAddress1 FROM Patrons WHERE CONTAINS(Patrons.ResidentialAddress1, '"way"') Server: Msg 7619, Level 16, State 1, Line 1 A clause of the query contained only ignored words. So one might think that you are just not allowed to even search for way, either alone, or as a root. But this isn't true either: SELECT * FROM Patrons WHERE CONTAINS(Patrons.*, '"way*"') AccountNumber FirstName Lastname ------------- --------- -------- 33589 JOHN WAYNE So sum up, the user is searching for rows that contain all the words: 123 generic way Which i, correctly, translate into the WHERE clauses: SELECT * FROM Patrons WHERE CONTAINS(Patrons.*, '"123*"') AND CONTAINS(Patrons.*, '"generic*"') AND CONTAINS(Patrons.*, '"way*"') which returns no rows. Tell me this just isn't going to work, that it's not my fault, and SQL Server is crazy. Note: i've emptied the FT index and rebuilt it.

    Read the article

  • Advantage Database Server ORDER BY behaviour

    - by ie
    I'm using ADS v10 beta. I'm trying to numerate ordered resultset. 1) ORDER BY in nested queries. I need to use nested SELECT for some calculations: SELECT Name, Value, ROWNUM() FROM (SELECT * FROM MainTable WHERE Value > 0 ORDER BY Value) a And I'm getting Expected lexical element not found: ) There was a problem parsing the table names after the FROM keyword in your SELECT statement. Everything is working well when the ORDER BY is removed. Although, I found the sample in the Help, it looks like my query (more complex, indeed): SELECT * FROM (SELECT TOP 10 empid, fullname FROM branch1 ORDER BY empid) a UNION SELECT empid, fullname FROM branch2 ORDER BY empid 2) ORDER BY + ROWNUM(). I used the nested query in the example above, to numerate ordered rows. Is there are any chance to avoid nested query? In the SQL Server I can do something like this: SELECT Name, Value, ROW_NUMBER() OVER(ORDER BY Value) FROM MainTable WHERE Value > 1 ORDER BY Value Please advice. Thanks.

    Read the article

  • Strategy for locale sensitive sort with pagination

    - by Thom Birkeland
    Hi, I work on an application that is deployed on the web. Part of the app is search functions where the result is presented in a sorted list. The application targets users in several countries using different locales (= sorting rules). I need to find a solution for sorting correctly for all users. I currently sort with ORDER BY in my SQL query, so the sorting is done according to the locale (or LC_LOCATE) set for the database. These rules are incorrect for those users with a locale different than the one set for the database. Also, to further complicate the issue, I use pagination in the application, so when I query the database I ask for rows 1 - 15, 16 - 30, etc. depending on the page I need. However, since the sorting is wrong, each page contains entries that are incorrectly sorted. In a worst case scenario, the entire result set for a given page could be out of order, depending on the locale/sorting rules of the current user. If I were to sort in (server side) code, I need to retrieve all rows from the database and then sort. This results in a tremendous performance hit given the amount of data. Thus I would like to avoid this. Does anyone have a strategy (or even technical solution) for attacking this problem that will result in correctly sorted lists without having to take the performance hit of loading all data? Tech details: The database is PostgreSQL 8.3, the application an EJB3 app using EJB QL for data query, running on JBoss 4.5.

    Read the article

  • visusal studio embedded crystal report keeps prompting database login?

    - by phill
    I'm using visual studio 2005 to develop a form with a combobox passing a value into the parameter of an embedded crystal report. I'm trying to figure out why it keeps prompting me for a database login every single time you try to run the report with a different combobox selection. Here is my code: private Sub Form1_load... Dim ConnName As String Dim ServerName As String Dim DBName As String Dim user As String Dim pass As String Dim gDBA As ADODB.Connection Dim records As ADODB.Recordset Dim datver As ADODB.Recordset Dim query As String '---OPEN THE DATABASE CONNECTIONS gDBA = New ADODB.Connection ': gDBA.CursorLocation = adUseServer 'Added to prevent time out error gDBA.CommandTimeout = 1000 : gDBA.ConnectionTimeout = 1000 gDBA.ConnectionString = "Server=svr13;Database=subscribers;User ID=KViews;Password=Solution;Trusted_Connection=True;" gDBA.Open("Data Source=Kaseya;Initial Catalog=subscribers;User Id=KViews;Password=Solution;", "KViews", "Solution") records = New ADODB.Recordset query = "select distinct groupname from _v_k order by groupname desc" 'records.ActiveConnection = gDBA.ConnectionString records.CursorType = CursorTypeEnum.adOpenForwardOnly records.LockType = LockTypeEnum.adLockReadOnly records.Open(query, gDBA) Do While Not records.EOF ComboBox1.Items.Add(records.Fields("groupname").Value) records.MoveNext() Loop end Sub Private Sub Button1_Click(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles Button1.Click Dim selected As String selected = ComboBox1.Text Dim cryRpt As New ReportDocument cryRpt.Load("C:\Visual Studio 2005\Projects\WindowsApplication1\WindowsApplication1\CrystalReport1.rpt") cryRpt.SetDatabaseLogon("KViews", "Solutions", "svr13", "subscribers") cryRpt.SetParameterValue("companyname", selected) CrystalReportViewer1.ReportSource = cryRpt CrystalReportViewer1.Refresh() End Sub I looked at this previous posting http://stackoverflow.com/questions/1132314/database-login-prompt-with-crystal-reports but this wasn't very helpful. I couldn't find where a CMC was to disable the prompt. Any ideas? thanks in advance

    Read the article

  • Hierarchical/Nested Database Structure for Comments

    - by Stephen Melrose
    Hi, I'm trying to figure out the best approach for a database schema for comments. The problem I'm having is that the comments system will need to allow nested/hierarchical comments, and I'm not sure how to design this out properly. My requirements are, Comments can be made on comments, so I need to store the tree hierarchy I need to be able to query the comments in the tree hierarchy order, but efficiently, preferably in a fast single query, but I don't know if this is possible I'd need to make some wierd queries, e.g. pull out the latest 5 root comments, and a maximum of 3 children for each one of those I read an article on the MySQL website on this very subject, http://dev.mysql.com/tech-resources/articles/hierarchical-data.html The "Nested Set Model" in theory sounds like it will do what I need, except I'm worried about querying the thing, and also inserting. If this is the right approach, How would I do my 3rd requirement above? If I have 2000 comments, and I add a new sub-comment on the first comment, that will be a LOT of updating to do. This doesn't seem right to me? Or is there a better approach for the type of data I'm wanting to store and query? Thank you

    Read the article

  • I need to monitor a physical RS232 port on an appliance?

    - by Kendor
    I need to verify what's being output on an RS232 port of an appliance that's running proprietary software (e.g. NOT Windows or Linux). The port is sending data to a target app on another appliance, but I need to verify/log the actual data raw outside of the appliances. Would appreciate a recommendation on process/software to attach to the physical sending port (I have a straight through RS232 cable) and grab sample output of that port.

    Read the article

  • Why i cant save a long text on my MySQL database?

    - by DomingoSL
    im trying to save to my data base a long text (about 2500 chars) input by my users using a web form and passed to the server using php. When i look in phpmyadmin, the text gets crop. How can i config my table in order to get the complete text? This is my table config: CREATE TABLE `extra_879` ( `id` bigint(20) NOT NULL auto_increment, `id_user` bigint(20) NOT NULL, `title` varchar(300) NOT NULL, `content` varchar(3000) NOT NULL, PRIMARY KEY (`id`), UNIQUE KEY `id_user` (`id_user`) ) ENGINE=MyISAM DEFAULT CHARSET=latin1 AUTO_INCREMENT=4 ; Take a look of the field content that have a limit of 3000 chars, but the texts always gets crop at 690 chars. Thanks for any help! EDIT: I found the problem but i dont know how to solve it. The query is getting crop always in the same char, an special char: ù EDIT 2: This is the cropped query: INSERT INTO extra_879 (id,id_user,title,content) VALUES (NULL,'1','Informazione Extra',' Riconoscimenti Laurea di ingegneria presa a le 22 anni e in il terso posto della promozione Diploma analista di sistemi ottenuto il rating massimo 20/20, primo posto della promozione. Borsa di Studio (offerta dal Ministero Esteri Italiano) vinta nel 2010 (Valutazione del territorio attraverso le nueve tecnologie) Pubblicazione di paper; Stima del RCS della nave CCGS radar sulla base dei risultati di H. Leong e H. Wilson. http://www.ing.uc.edu.vek-azozayalarchivospdf/PAPER-Sarmiento.pdf Tesi di laurea: PROGETTAZIONE E REALIZZAZIONE DI UN SIS-TEMA DI TELEMETRIA GSM PER IL CONTROLLO DELLO STATO DI TRANSITO VEICOLARE E CLIMA (ottenuto il punteggio pi') It gets crop just when the (ottenuto il punteggio più alto) phrase, just when ù appear... EDIT 3: I using jquery + ajax to send the query $.ajax({type: "POST", url: "handler.php", data: "e_text="+ $('#e_text').val() + "&e_title="+ $('#extra_title').val(),

    Read the article

  • Install Python 2.4 or newer on Centos 4.x

    - by TomA
    I would like to use Python 2.4 features in my Django apps running on CentOS 4.7. The default version of Python is 2.3 and I think it would be best not to try replace it. Is there a way to install a newer version of Python alongside and somehow tell Apache to use that for mod_python?

    Read the article

  • uploading image & getting back from database

    - by Anup Prakash
    Putting a set of code which is pushing image to database and fetching back from database: <!-- <?php error_reporting(0); // Connect to database $errmsg = ""; if (! @mysql_connect("localhost","root","")) { $errmsg = "Cannot connect to database"; } @mysql_select_db("test"); $q = <<<CREATE create table image ( pid int primary key not null auto_increment, title text, imgdata longblob, friend text) CREATE; @mysql_query($q); // Insert any new image into database if (isset($_POST['submit'])) { move_uploaded_file($_FILES['imagefile']['tmp_name'],"latest.img"); $instr = fopen("latest.img","rb"); $image = addslashes(fread($instr,filesize("latest.img"))); if (strlen($instr) < 149000) { $image_query="insert into image (title, imgdata,friend) values (\"". $_REQUEST['title']. "\", \"". $image. "\",'".$_REQUEST['friend']."')"; mysql_query ($image_query) or die("query error"); } else { $errmsg = "Too large!"; } $resultbytes=''; // Find out about latest image $query = "select * from image where pid=1"; $result = @mysql_query("$query"); $resultrow = @mysql_fetch_assoc($result); $gotten = @mysql_query("select * from image order by pid desc limit 1"); if ($row = @mysql_fetch_assoc($gotten)) { $title = htmlspecialchars($row[title]); $bytes = $row[imgdata]; $resultbytes = $row[imgdata]; $friend=$row[friend]; } else { $errmsg = "There is no image in the database yet"; $title = "no database image available"; // Put up a picture of our training centre $instr = fopen("../wellimg/ctco.jpg","rb"); $bytes = fread($instr,filesize("../wellimg/ctco.jpg")); } if ($resultbytes!='') { echo $resultbytes; } } ?> <html> <head> <title>Upload an image to a database</title> </head> <body bgcolor="#FFFF66"> <form enctype="multipart/form-data" name="file_upload" method="post"> <center> <div id="image" align="center"> <h2>Heres the latest picture</h2> <font color=red><?php echo $errmsg; ?></font> <b><?php echo $title ?></center> </div> <hr> <h2>Please upload a new picture and title</h2> <table align="center"> <tr> <td>Select image to upload: </td> <td><input type="file" name="imagefile"></td> </tr> <tr> <td>Enter the title for picture: </td> <td><input type="text" name="title"></td> </tr> <tr> <td>Enter your friend's name:</td> <td><input type="text" name="friend"></td> </tr> <tr> <td><input type="submit" name="submit" value="submit"></td> <td></td> </tr> </table> </form> </body> </html> --> Above set of code has one problem. The problem is whenever i pressing the "submit" button. It is just displaying the image on a page. But it is leaving all the html codes. even any new line message after the // Printing image on browser echo $resultbytes; //************************// So, for this i put this set of code in html tag: This is other sample code: <!-- <?php error_reporting(0); // Connect to database $errmsg = ""; if (! @mysql_connect("localhost","root","")) { $errmsg = "Cannot connect to database"; } @mysql_select_db("test"); $q = <<<CREATE create table image ( pid int primary key not null auto_increment, title text, imgdata longblob, friend text) CREATE; @mysql_query($q); // Insert any new image into database if (isset($_POST['submit'])) { move_uploaded_file($_FILES['imagefile']['tmp_name'],"latest.img"); $instr = fopen("latest.img","rb"); $image = addslashes(fread($instr,filesize("latest.img"))); if (strlen($instr) < 149000) { $image_query="insert into image (title, imgdata,friend) values (\"". $_REQUEST['title']. "\", \"". $image. "\",'".$_REQUEST['friend']."')"; mysql_query ($image_query) or die("query error"); } else { $errmsg = "Too large!"; } $resultbytes=''; // Find out about latest image $query = "select * from image where pid=1"; $result = @mysql_query("$query"); $resultrow = @mysql_fetch_assoc($result); $gotten = @mysql_query("select * from image order by pid desc limit 1"); if ($row = @mysql_fetch_assoc($gotten)) { $title = htmlspecialchars($row[title]); $bytes = $row[imgdata]; $resultbytes = $row[imgdata]; $friend=$row[friend]; } else { $errmsg = "There is no image in the database yet"; $title = "no database image available"; // Put up a picture of our training centre $instr = fopen("../wellimg/ctco.jpg","rb"); $bytes = fread($instr,filesize("../wellimg/ctco.jpg")); } } ?> <html> <head> <title>Upload an image to a database</title> </head> <body bgcolor="#FFFF66"> <form enctype="multipart/form-data" name="file_upload" method="post"> <center> <div id="image" align="center"> <h2>Heres the latest picture</h2> <?php if ($resultbytes!='') { // Printing image on browser echo $resultbytes; } ?> <font color=red><?php echo $errmsg; ?></font> <b><?php echo $title ?></center> </div> <hr> <h2>Please upload a new picture and title</h2> <table align="center"> <tr> <td>Select image to upload: </td> <td><input type="file" name="imagefile"></td> </tr> <tr> <td>Enter the title for picture: </td> <td><input type="text" name="title"></td> </tr> <tr> <td>Enter your friend's name:</td> <td><input type="text" name="friend"></td> </tr> <tr> <td><input type="submit" name="submit" value="submit"></td> <td></td> </tr> </table> </form> </body> </html> --> ** But in this It is showing the image in format of special charaters and digits. 1) So, Please help me to print the image with some HTML code. So that i can print it in my form to display the image. 2) Is there any way to convert the database image into real image, so that i can store it into my hard-disk and call it from tag? Please help me.

    Read the article

  • Better way to summarize data about stop times?

    - by Vimvq1987
    This question is close to this: http://stackoverflow.com/questions/2947963/find-the-period-of-over-speed Here's my table: Longtitude Latitude Velocity Time 102 401 40 2010-06-01 10:22:34.000 103 403 50 2010-06-01 10:40:00.000 104 405 0 2010-06-01 11:00:03.000 104 405 0 2010-06-01 11:10:05.000 105 406 35 2010-06-01 11:15:30.000 106 403 60 2010-06-01 11:20:00.000 108 404 70 2010-06-01 11:30:05.000 109 405 0 2010-06-01 11:35:00.000 109 405 0 2010-06-01 11:40:00.000 105 407 40 2010-06-01 11:50:00.000 104 406 30 2010-06-01 12:00:00.000 101 409 50 2010-06-01 12:05:30.000 104 405 0 2010-06-01 11:05:30.000 I want to summarize times when vehicle had stopped (velocity = 0), include: it had stopped since "when" to "when" in how much minutes, how many times it stopped and how much time it stopped. I wrote this query to do it: select longtitude, latitude, MIN(time), MAX(time), DATEDIFF(minute, MIN(Time), MAX(time)) as Timespan from table_1 where velocity = 0 group by longtitude,latitude select DATEDIFF(minute, MIN(Time), MAX(time)) as minute into #temp3 from table_1 where velocity = 0 group by longtitude,latitude select COUNT(*) as [number]from #temp select SUM(minute) as [totaltime] from #temp3 drop table #temp This query return: longtitude latitude (No column name) (No column name) Timespan 104 405 2010-06-01 11:00:03.000 2010-06-01 11:10:05.000 10 109 405 2010-06-01 11:35:00.000 2010-06-01 11:40:00.000 5 number 2 totaltime 15 You can see, it works fine, but I really don't like the #temp table. Is there anyway to query this without use a temp table? Thank you.

    Read the article

  • IIS Restrict Access to Directory for table of users

    - by Dave
    I am trying to restrict access to files in a directory and it's sub directories based user rights. My user rights are stored in an MS SQL database in a custom format, however it is easy to query the list of users with rights to this directory. I need to know how to apply this to a web config on the server to authenticate against a query of a database table to determine if the username is authenticated and allowed to view the file. Of course if they are not they should be blocked / given a 404. I am using IIS and ASP.Net MVC3 with a form based security as opposed to the built in roles and responsibilities that was custom made for us and that works great. There are over 10k users tied to this non-Active Directory authentication so I am not planning to change my authentication type so please don't go there. It is not my decision on the choice of platform, or I would have gone with a LAMP server and been done with this. Edit 11-13-2012 @ 8:57a: In the web config can you put the result of an SQL query?

    Read the article

  • Improve speed of a JOIN in MySQL

    - by ran2
    Dear all, I know there a similar threads around, but this is really the first time I realize that query speed might affect me - so it´s not that easy for me to really make the transfer from other folks problems. That being said I have using the following query successfully with smaller data, but if I use it on what are mildly large tables (about 120,000 records). I am waiting for hours. INSERT INTO anothertable (id,someint1,someint1,somevarchar1,somevarchar1) SELECT DISTINCT md.id,md.someint1,md.someint1,md.somevarchar1,pd.somevarchar1 from table1 AS md JOIN table2 AS pd ON (md.id = pd.id); Tables 1 and 2 contain about 120,000 records. The query has been running for almost 2 hours right now. Is this normal? Do I just have to wait. I really have no idea, but I am pretty sure that one could do it better since it´s my very first try. I read about indexing, but dont know yet what to index in my case? Thanks for any suggestions - feel free to point my to the very beginners guides ! best matt

    Read the article

  • How to keep group-writeable shares on Samba with OSX clients?

    - by Oliver Salzburg
    I have a FreeNAS server on a network with OSX and Windows clients. When the OSX clients interact with SMB/CIFS shares on the server, they are causing permission problems for all other clients. Update: I can no longer verify any answers because we abandoned the project, but feel free to post any help for future visitors. The details of this behavior seem to also be dependent on the version of OSX the client is running. For this question, let's assume a client running 10.8.2. When I mount the CIFS share on an OSX client and create a new directory on it, the directory will be created with drwxr-x-rx permissions. This is undesirable because it will not allow anyone but me to write to the directory. There are other users in my group which should have write permissions as well. This behavior happens even though the following settings are present in smb.conf on the server: [global] create mask= 0666 directory mask= 0777 [share] force directory mode= 0775 force create mode= 0660 I was under the impression that these settings should make sure that directories are at least created with rwxrwxr-x permissions. But, I guess, that doesn't stop the client from changing the permissions after creating the directory. When I create a folder on the same share from a Windows client, the new folder will have the desired access permissions (rwxrwxrwx), so I'm currently assuming that the problem lies with the OSX client. I guess this wouldn't be such an issue if you could easily change the permissions of the directories you've created, but you can't. When opening the directory info in Finder, I get the old "You have custom access" notice with no ability to make any changes. I'm assuming that this is caused because we're using Windows ACLs on the share, but that's just a wild guess. Changing the write permissions for the group through the terminal works fine, but this is unpractical for the deployment and unreasonable to expect from anyone to do. This is the complete smb.conf: [global] encrypt passwords = yes dns proxy = no strict locking = no read raw = yes write raw = yes oplocks = yes max xmit = 65535 deadtime = 15 display charset = LOCALE max log size = 10 syslog only = yes syslog = 1 load printers = no printing = bsd printcap name = /dev/null disable spoolss = yes smb passwd file = /var/etc/private/smbpasswd private dir = /var/etc/private getwd cache = yes guest account = nobody map to guest = Bad Password obey pam restrictions = Yes # NOTE: read smb.conf. directory name cache size = 0 max protocol = SMB2 netbios name = freenas workgroup = COMPANY server string = FreeNAS Server store dos attributes = yes hostname lookups = yes security = user passdb backend = ldapsam:ldap://ldap.company.local ldap admin dn = cn=admin,dc=company,dc=local ldap suffix = dc=company,dc=local ldap user suffix = ou=Users ldap group suffix = ou=Groups ldap machine suffix = ou=Computers ldap ssl = off ldap replication sleep = 1000 ldap passwd sync = yes #ldap debug level = 1 #ldap debug threshold = 1 ldapsam:trusted = yes idmap uid = 10000-39999 idmap gid = 10000-39999 create mask = 0666 directory mask = 0777 client ntlmv2 auth = yes dos charset = CP437 unix charset = UTF-8 log level = 1 [share] path = /mnt/zfs0 printable = no veto files = /.snap/.windows/.zfs/ writeable = yes browseable = yes inherit owner = no inherit permissions = no vfs objects = zfsacl guest ok = no inherit acls = Yes map archive = No map readonly = no nfs4:mode = special nfs4:acedup = merge nfs4:chown = yes hide dot files force directory mode = 0775 force create mode = 0660

    Read the article

  • boost::asio::async_resolve Problem

    - by Moo-Juice
    Hi All, I'm in the process of constructing a Socket class that uses boost::asio. To start with, I made a connect method that took a host and a port and resolved it to an IP address. This worked well, so I decided to look in to async_resolve. However, my callback always gets an error code of 995 (using the same destination host/port as when it worked synchronously). code: Function that starts the resolution: // resolve a host asynchronously template<typename ResolveHandler> void resolveHost(const String& _host, Port _port, ResolveHandler _handler) const { boost::asio::ip::tcp::endpoint ret; boost::asio::ip::tcp::resolver::query query(_host, boost::lexical_cast<std::string>(_port)); boost::asio::ip::tcp::resolver r(m_IOService); r.async_resolve(query, _handler); }; // eo resolveHost Code that calls this function: void Socket::connect(const String& _host, Port _port) { // Anon function for resolution of the host-name and asynchronous calling of the above auto anonResolve = [this](const boost::system::error_code& _errorCode, boost::asio::ip::tcp::resolver_iterator _epIt) { // raise event onResolve.raise(SocketResolveEventArgs(*this, !_errorCode ? (*_epIt).host_name() : String(""), _errorCode)); // perform connect, calling back to anonymous function if(!_errorCode) connect(*_epIt); }; // Resolve the host calling back to anonymous function Root::instance().resolveHost(_host, _port, anonResolve); }; // eo connect The message() function of the error_code is: The I/O operation has been aborted because of either a thread exit or an application request And my main.cpp looks like this: int _tmain(int argc, _TCHAR* argv[]) { morse::Root root; TextSocket s; s.connect("somehost.com", 1234); while(true) { root.performIO(); // calls io_service::run_one() } return 0; } Thanks in advance!

    Read the article

  • Access report not showing data

    - by Brian Smith
    I have two queries that I am using to generate a report from, the problem is when I run the report, three fields do not show any data at all for some reason. Query 1: SELECT ClientSummary.Field3 AS PM, ClientSummary.[Client Nickname 2] AS [Project #], ClientSummary.[Client Nickname 1] AS Customer, ClientSummary.[In Reference To] AS [Job Name], ClientSummary.Field10 AS Contract, (select sum([Billable Slip Value]) from Util_bydate as U1 where U1.[Client Nickname 2] = ClientSummary.[Client Nickname 2]) AS [This Week], (select sum([Billable Slip Value]) from Util as U2 where U2.[Client Nickname 2] = ClientSummary.[Client Nickname 2] ) AS [To Date], [To Date]/[Contract] AS [% Spent], 0 AS Backlog, ClientSummary.[Total Slip Fees & Costs] AS Billed, ClientSummary.Payments AS Paid, ClientSummary.[Total A/R] AS Receivable, [Forms]![ReportMenu]![StartDate] AS [Start Date], [Forms]![ReportMenu]![EndDate] AS [End Date] FROM ClientSummary; Query 2: SELECT JobManagement_Summary.pm, JobManagement_Summary.[project #], JobManagement_Summary.Customer, JobManagement_Summary.[Job Name], JobManagement_Summary.Contract, IIf(IsNull([This Week]),0,[This Week]) AS [N_This Week], IIf(IsNull([To Date]),0,[To Date]) AS [N_To Date], [% Spent], JobManagement_Summary.Backlog, JobManagement_Summary.Billed, JobManagement_Summary.Paid, JobManagement_Summary.Receivable, JobManagement_Summary.[Start Date], JobManagement_Summary.[End Date] FROM JobManagement_Summary; When I run the report from query 2 these 3 fields don't appear. N_This Week, N_To Date and % Spent. All have no data. It isn't the IIF functions, as it doesn't matter if I have those in there or remove them. Any thoughts? If I connect directly to the first recordset it works fine, but then SQL throws the error message: Multi-level GROUP BY cause not allowed in subquery. Is there any way to get around that message to link to it directly or does anyone have ANY clue why these fields are coming back blank? I am at wits end here!

    Read the article

  • How can I compress a movie to a specific file size in Windows 7's Live Movie Maker?

    - by Nathan Fellman
    In previous versions of Windows Movie Maker I could take a raw video file and specify the file size to compress it to, and Movie Maker would compress it accordingly (with the appropriate loss in quality). Live Movie Maker, which comes with Windows 7, doesn't seem to have this option. I can only set specify the requested quality. Is there any way to specify the size of the target file for Windows Live Movie Maker?

    Read the article

  • SOLR - wildcard search with capital letter

    - by Yurish
    I have a problem with SOLR searching. When i`am searching query: dog* everything is ok, but when query is Dog*(with first capital letter), i get no results. Any advice? My config: <fieldType name="text" class="solr.TextField" positionIncrementGap="100"> <analyzer type="index"> <tokenizer class="solr.WhitespaceTokenizerFactory"/> <filter class="solr.StopFilterFactory" ignoreCase="true" words="stopwords.txt"/> <filter class="solr.WordDelimiterFilterFactory" generateWordParts="1" generateNumberParts="1" catenateWords="1" catenateNumbers="1" catenateAll="0" splitOnCaseChange="0"/> <filter class="solr.LowerCaseFilterFactory"/> <filter class="solr.RemoveDuplicatesTokenFilterFactory"/> </analyzer> <analyzer type="query"> <tokenizer class="solr.WhitespaceTokenizerFactory"/> <filter class="solr.SynonymFilterFactory" synonyms="synonyms.txt" ignoreCase="true" expand="true"/> <filter class="solr.StopFilterFactory" ignoreCase="true" words="stopwords.txt"/> <filter class="solr.WordDelimiterFilterFactory" generateWordParts="1" generateNumberParts="1" catenateWords="0" catenateNumbers="0" catenateAll="0" splitOnCaseChange="0"/> <filter class="solr.LowerCaseFilterFactory"/> <filter class="solr.RemoveDuplicatesTokenFilterFactory"/> </analyzer> </fieldType>

    Read the article

  • Can I clone an IQueryable in linq? For UNION purposes?

    - by user169867
    I have a table of WorkOrders. The table has a PrimaryWorker & PrimaryPay field. It also has a SecondaryWorker & SecondaryPay field (which can be null). I wish to run 2 very similar queries & union them so that it will return a Worker Field & Pay field. So if a single WorkOrder record had both the PrimaryWorker and SecondaryWorker field populated I would get 2 records back. The "where clause" part of these 2 queries is very similar and long to construct. Here's a dummy example var q = ctx.WorkOrder.Where(w => w.WorkDate >= StartDt && w.WorkDate <= EndDt); if(showApprovedOnly) { q = q.Where(w => w.IsApproved); } //...more filters applied Now I also have a search flag called "hideZeroPay". If that's true I don't want to include the record if the worker was payed $0. But obviously for 1 query I need to compare the PrimaryPay field and in the other I need to compare the SecondaryPay field. So I'm wondering how to do this. Can I clone my base query "q" and make a primary & secondary worker query out of it and then union those 2 queries together? I'd greatly appreciate an example of how to correctly handle this. Thanks very much for any help.

    Read the article

  • Algorithm for finding similar users through a join table

    - by Gdeglin
    I have an application where users can select a variety of interests from around 300 possible interests. Each selected interest is stored in a join table containing the columns user_id and interest_id. Typical users select around 50 interests out of the 300. I would like to build a system where users can find the top 20 users that have the most interests in common with them. Right now I am able to accomplish this using the following query: SELECT i2.user_id, count(i2.interest_id) AS count FROM interests_users as i1, interests_users as i2 WHERE i1.interest_id = i2.interest_id AND i1.user_id = 35 GROUP BY i2.user_id ORDER BY count DESC LIMIT 20; However, this query takes approximately 500 milliseconds to execute with 10,000 users and 500,000 rows in the join table. All indexes and database configuration settings have been tuned to the best of my ability. I have also tried avoiding the use of joins altogether using the following query: select user_id,count(interest_id) count from interests_users where interest_id in (13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54,55,56,57,58,59,60,61,62,63,64,65,66,68,69,70,71,72,73,74,75,76,77,78,79,80,81,82,83,84,85,86,87,88,89,90,91,92,93,94,95,96,97,98,508) group by user_id order by count desc limit 20; But this one is even slower (~800 milliseconds). How could I best lower the time that I can gather this kind of data to below 100 milliseconds? I have considered putting this data into a graph database like Neo4j, but I am not sure if that is the easiest solution or if it would even be faster than what I am currently doing.

    Read the article

  • NHibernate Criteria question

    - by Jeneatte Jolie
    I have a person object, which can have unlimited number of first names. So the first names are another object. ie person --- name             --- name             --- name What I want to do is write an nhiberate query using which will get me a person who has certain names. so one query might be find someone whose names are alison and jane and philippa, then next query may be one to find someone whose names are alison and jane. I only want to return people who have all the names I'm search on. So far I've got ICriteria criteria = session.CreateCriteria(typeof (Person)); criteria.CreateAlias("Names", "name"); ICriterion expression = null; foreach (string name in namesToFind) { if (expression == null) { expression = Expression.Like("name.Value", "%" + name + "%"); } else { expression = Expression.Or( expression, Expression.Like("name.Value", "%" + name + "%")); } } if (expression != null) criteria.Add(expression); But this is returning every person with ANY of the names I'm searching on, not ALL the names. Can anyone help me out with this? Thanks!

    Read the article

< Previous Page | 457 458 459 460 461 462 463 464 465 466 467 468  | Next Page >