Search Results

Search found 4384 results on 176 pages for '1000'.

Page 47/176 | < Previous Page | 43 44 45 46 47 48 49 50 51 52 53 54  | Next Page >

  • What kind of hosting is used for *tube sites?

    - by playcat
    Hello, When a site grows from a just-a-fun project to a site with bigger load of visitor, and you want to enable them to upload videos, you might find yourself in a need of a better hosting, including dedicated server and a no-limit web traffic (or some reasonable limit). So, if people can upload their videos, and if page has around 1000-10000 visitors per day, what kind of hosting is there to choose from? What is needed in that case? Thx

    Read the article

  • Does Control Zone touchpad in HP notebooks have standard LMB/RMB clicks at the bottom of touchpad?

    - by user1825608
    I wanted to buy: http://www.x-kom.pl/p/203762-ultrabook-15-6-hp-envy-15-x360-u000ew-i5-4210u-4gb-1000-win81.html# but now I see it does not have normal touchpad but this one which does not work as it should in Spectre 13. The deal is that every video says about those new features (which will be outdated when Windows 9 will come by) not about if it still has standard LMB/RMB click. Question: Does or does not Control Zone touchpade have mechanical left and right mouse button area at the bottom of it as every other touchpad?

    Read the article

  • No external network on ubuntu 9.10, though dns works..

    - by user29368
    Hi, I have a weird problem I cant solve. I have several computers, two with xubuntu 9.10 One of them, acting as a media server, has stopped to work when it comes to external network.. I can do for example: ping google.com Which gives me an ip adress back, like: name@Media:/etc$ ping google.com PING google.com (66.102.9.147) 56(84) bytes of data. That tells me it reaches the dns?, but I get no response at all... If I ping a local computer all works fine. I can also reach the computer via ssh without any problems. I have always used network manager, but now I uninstalled it and made the settings manually like this: /etc/network/interfaces auto lo iface lo inet loopback auto eth0 iface eth0 inet static address 192.168.1.52 netmask 255.255.255.0 network 192.168.1.0 broadcast 192.168.1.255 gateway 192.168.1.1 Still no luck. I have no specific settings for this one in my router, and all the other computers, including my win laptop works fine. This is very annoying since I cant even do an update or anything.. ifconfig looks like this: eth0 Link encap:Ethernet HWaddr 00:24:1d:9f:10:89 inet addr:192.168.1.52 Bcast:192.168.1.255 Mask:255.255.255.0 inet6 addr: fe80::224:1dff:fe9f:1089/64 Scope:Link UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:15410 errors:0 dropped:0 overruns:0 frame:0 TX packets:2693 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:1167398 (1.1 MB) TX bytes:694973 (694.9 KB) Interrupt:27 Base address:0xe000 lo Link encap:Local Loopback inet addr:127.0.0.1 Mask:255.0.0.0 inet6 addr: ::1/128 Scope:Host UP LOOPBACK RUNNING MTU:16436 Metric:1 RX packets:2150 errors:0 dropped:0 overruns:0 frame:0 TX packets:2150 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:0 RX bytes:143456 (143.4 KB) TX bytes:143456 (143.4 KB) route -n like this Kernel IP routing table Destination Gateway Genmask Flags Metric Ref Use Iface 192.168.1.0 0.0.0.0 255.255.255.0 U 0 0 0 eth0 169.254.0.0 0.0.0.0 255.255.0.0 U 1000 0 0 eth0 0.0.0.0 192.168.1.1 0.0.0.0 UG 100 0 0 eth0 I do not know where the adress starting with 169.254 comes from.. Could that be a part of the problem? Hoping for some assistance since Im totally stuck here.. /george

    Read the article

  • Site down, SSH and FTP work fine

    - by Euskadi
    I cannot access my site through my web browser, using either the domain name or IP address (which also pings fine). My site was working last night when I went to bed, so I can't think what might have done it. I have tried restarting apache to no avail. update: I've noticed that http://[IP Address]/phpymyadmin works but [domain name]/phpmyadmin does not, and the same happens for webmin (https://[IP]:1000). Could this be a problem with BIND?

    Read the article

  • Mount network drive

    - by user971155
    I'm using linux(ubuntu), there's a linux(fedora) server, that I can log in with ssh, is there any possibility //server/dir /mnt/my_mount_dir cifs username=loginpassword=11111,uid=1000,iocharset=utf8,codepage=unicode,unicode 0 0 As far as I'm concerned, this construction uses SMB as primary tool. Is there any possibility to use NFS or any another approach, because in case of SMB it tends to have permission, symlink collisions. PS It would be great if you also provide some links. Thanks.

    Read the article

  • How to change default user (ubuntu) via CloudInit on AWS

    - by Gui Ambros
    I'm using CloudInit to automate the startup of my instances on AWS. I followed the (scarce) documentation available at http://bazaar.launchpad.net/~cloud-init-dev/cloud-init/trunk/annotate/head%3A/doc/examples/cloud-config.txt and examples on /usr/share/doc/cloud-init, but still haven't figured out how to change the default username (ubuntu, id:1000). I know I can create a script to manually delete the default ubuntu and add my user, but seems counter intuitive given that CloudInit exist exactly to automate the initial setup. Any ideas?

    Read the article

  • JavaScript tree / treegrid libraries

    - by desau
    I'm looking for a good JavaScript tree / treegrid package. Now -- before you answer: It needs to be able to perform well with lots of nodes. Perhaps 1,000 sibling nodes. It needs to be able to draw to a usable state within 2 or 3 seconds with 1,000 nodes. It doesn't necessarily need to draw all 1,000 nodes at once -- if it supports some sort of "smart rendering" or fake scrolling. Beyond that, column resizing, drag and drop, inline editing would all be nice, although I could probably add that functionality myself. I've already tried dojo's tree and yahoo's YUI treeview. Both are too slow.

    Read the article

  • Advice on my jQuery Ajax Function

    - by NessDan
    So on my site, a user can post a comment on 2 things: a user's profile and an app. The code works fine in PHP but we decided to add Ajax to make it more stylish. The comment just fades into the page and works fine. I decided I wanted to make a function so that I wouldn't have to manage 2 (or more) blocks of codes in different files. Right now, the code is as follows for the two pages (not in a separate .js file, they're written inside the head tags for the pages.): // App page $("input#comment_submit").click(function() { var comment = $("#comment_box").val(); $.ajax({ type: "POST", url: "app.php?id=<?php echo $id; ?>", data: {comment: comment}, success: function() { $("input#comment_submit").attr("disabled", "disabled").val("Comment Submitted!"); $("textarea#comment_box").attr("disabled", "disabled") $("#comments").prepend("<div class=\"comment new\"></div>"); $(".new").prepend("<a href=\"profile.php?username=<?php echo $_SESSION['username']; ?>\" class=\"commentname\"><?php echo $_SESSION['username']; ?></a><p class=\"commentdate\"><?php echo date("M. d, Y", time()) ?> - <?php echo date("g:i A", time()); ?></p><p class=\"commentpost\">" + comment + "</p>").hide().fadeIn(1000); } }); return false; }); And next up, // Profile page $("input#comment_submit").click(function() { var comment = $("#comment_box").val(); $.ajax({ type: "POST", url: "profile.php?username=<?php echo $user; ?>", data: {comment: comment}, success: function() { $("input#comment_submit").attr("disabled", "disabled").val("Comment Submitted!"); $("textarea#comment_box").attr("disabled", "disabled") $("#comments").prepend("<div class=\"comment new\"></div>"); $(".new").prepend("<a href=\"profile.php?username=<?php echo $_SESSION['username']; ?>\" class=\"commentname\"><?php echo $_SESSION['username']; ?></a><p class=\"commentdate\"><?php echo date("M. d, Y", time()) ?> - <?php echo date("g:i A", time()); ?></p><p class=\"commentpost\">" + comment + "</p>").hide().fadeIn(1000); } }); return false; }); Now, on each page the box names will always be the same (comment_box and comment_submit) so what do you guys think of this function (Note, the postComment is in the head tag on the page.): // On the page, (profile.php) $(function() { $("input#comment_submit").click(function() { postComment("profile", "<?php echo $user ?>", "<?php echo $_SESSION['username']; ?>", "<?php echo date("M. d, Y", time()) ?>", "<?php echo date("g:i A", time()); ?>"); }); }); Which leads to this function (which is stored in a separate file called functions.js): function postComment(page, argvalue, username, date, time) { if (page == "app") { var arg = "id"; } if (page == "profile") { var arg = "username"; } var comment = $("#comment_box").val(); $.ajax({ type: "POST", url: page + ".php?" + arg + "=" + argvalue, data: {comment: comment}, success: function() { $("textarea#comment_box").attr("disabled", "disabled") $("input#comment_submit").attr("disabled", "disabled").val("Comment Submitted!"); $("#comments").prepend("<div class=\"comment new\"></div>"); $(".new").prepend("<a href=\"" + page + ".php?" + arg + "=" + username + "\" class=\"commentname\">" + username + "</a><p class=\"commentdate\">" + date + " - " + time + "</p><p class=\"commentpost\">" + nl2br(comment) + "</p>").hide().fadeIn(1000); } }); return false; } That's what I came up with! So, some problems: When I hit the button the page refreshes. What fixed this was taking the return false from the function and putting it into the button click. Any way to keep it in the function and have the same effect? But my real question is this: Can any coders out there that are familiar to jQuery tell me techniques, coding practices, or ways to write my code more efficiently/elegantly? I've done a lot of work in PHP but I know that echoing the date may not be the most efficient way to get the date and time. So any tips that can really help me streamline this function and also make me better with writing jQuery are very welcome!

    Read the article

  • delphi idhttp post related question

    - by paul
    hello All im new to delphi. and also almost new to programming world. i was made some simple post software which using idhttp module. but when execute it , it not correctly working. this simple program is check for my account status. if account login successfully it return some source code which include 'top.location =' in source, and if login failed it return not included 'top.location =' inside account.txt is follow first and third account was alived account but only first account can check, after first account other account can't check i have no idea what wrong with it ph896011 pk1089 fsadfasdf dddddss ph896011 pk1089 following is source of delphi if any one help me much apprecated! unit Unit1; interface uses Windows, Messages, SysUtils, Variants, Classes, Graphics, Controls, Forms, Dialogs, StdCtrls, IdBaseComponent, IdComponent, IdTCPConnection, IdTCPClient, IdHTTP, IdCookieManager, ExtCtrls; type TForm1 = class(TForm) Button1: TButton; IdHTTP1: TIdHTTP; Memo1: TMemo; IdCookieManager1: TIdCookieManager; lstAcct: TListBox; result: TLabel; Edit1: TEdit; Timer1: TTimer; procedure Button1Click(Sender: TObject); //procedure FormCreate(Sender: TObject); //procedure FormClose(Sender: TObject; var Action: TCloseAction); private { Private declarations } public AccList: TStringList; IdCookie: TIdCookieManager; CookieList: TList; StartCnt: Integer; InputCnt: Integer; WordList: TStringList; WordNoList: TStringList; WordCntList: TStringList; StartTime: TDateTime; end; var Form1: TForm1; implementation {$R *.dfm} procedure TForm1.Button1Click(Sender: TObject); var i: Integer; //temp: String; lsttemp: TStringList; sl : tstringlist; //userId,userPass: string; begin InputCnt:= 0; WordList := TStringList.Create; CookieList := TList.create; IdCookie := TIdCookieManager.Create(self); if FileExists(ExtractFilePath(Application.ExeName) + 'account.txt') then WordList.LoadFromFile(ExtractFilePath(Application.ExeName) + 'account.txt'); WordNoList:= TStringList.Create; WordCntList := TStringList.Create; lsttemp := TStringList.create; sl :=Tstringlist.Create; try try for i := 0 to WordList.Count -1 do begin ExtractStrings([' '], [' '], pchar(WordList[i]), lsttemp); WordNoList.add(lsttemp[0]); //ShowMessage(lsttemp[0]); WordCntList.add(lsttemp[1]); //ShowMessage(lsttemp[1]); sl.Add('ID='+ lsttemp[0]); sl.add('PWD=' + lsttemp[1]); sl.add('SECCHK=0'); IdHTTP1.HandleRedirects := True; IdHTTP1.Request.ContentType := 'application/x-www-form-urlencoded'; memo1.Text:=idhttp1.Post('http://user.buddybuddy.co.kr/Login/Login.asp',sl); if pos('top.location =',Memo1.Text)> 0 then begin application.ProcessMessages; ShowMessage('Alive Acc!'); //result.Caption := 'alive acc' ; sleep(1000); Edit1.Text := 'alive acc'; lsttemp.Clear; Memo1.Text := ''; //memo1.Text := IdHTTP1.Get('https://user.buddybuddy.co.kr/Login/Logout.asp'); Sleep(1000); end; if pos('top.location =', memo1.Text) <> 1 then begin application.ProcessMessages; ShowMessage('bad'); Edit1.Text := 'bad'; //edit1.Text := 'bad'; lsttemp.Clear; memo1.Text := ''; sleep(1000) ; end; Edit1.Text := ''; end; finally lsttemp.free; end; StartCnt := lstAcct.items.Count; StartTime := Now; finally sl.Free; end; end; end.

    Read the article

  • Random Page Cost and Planning

    - by Dave Jarvis
    A query (see below) that extracts climate data from weather stations within a given radius of a city using the dates for which those weather stations actually have data. The query uses the table's only index, rather effectively: CREATE UNIQUE INDEX measurement_001_stc_idx ON climate.measurement_001 USING btree (station_id, taken, category_id); Reducing the server's configuration value for random_page_cost from 2.0 to 1.1 had a massive performance improvement for the given range (nearly an order of magnitude) because it suggested to PostgreSQL that it should use the index. While the results now return in 5 seconds (down from ~85 seconds), problematic lines remain. Bumping the query's end date by a single year causes a full table scan: sc.taken_start >= '1900-01-01'::date AND sc.taken_end <= '1997-12-31'::date AND How do I persuade PostgreSQL to use the indexes regardless of years between the two dates? (A full table scan against 43 million rows is probably not the best plan.) Find the EXPLAIN ANALYSE results below the query. Thank you! Query SELECT extract(YEAR FROM m.taken) AS year, avg(m.amount) AS amount FROM climate.city c, climate.station s, climate.station_category sc, climate.measurement m WHERE c.id = 5182 AND earth_distance( ll_to_earth(c.latitude_decimal,c.longitude_decimal), ll_to_earth(s.latitude_decimal,s.longitude_decimal)) / 1000 <= 30 AND s.elevation BETWEEN 0 AND 3000 AND s.applicable = TRUE AND sc.station_id = s.id AND sc.category_id = 1 AND sc.taken_start >= '1900-01-01'::date AND sc.taken_end <= '1996-12-31'::date AND m.station_id = s.id AND m.taken BETWEEN sc.taken_start AND sc.taken_end AND m.category_id = sc.category_id GROUP BY extract(YEAR FROM m.taken) ORDER BY extract(YEAR FROM m.taken) 1900 to 1996: Index "Sort (cost=1348597.71..1348598.21 rows=200 width=12) (actual time=2268.929..2268.935 rows=92 loops=1)" " Sort Key: (date_part('year'::text, (m.taken)::timestamp without time zone))" " Sort Method: quicksort Memory: 32kB" " -> HashAggregate (cost=1348586.56..1348590.06 rows=200 width=12) (actual time=2268.829..2268.886 rows=92 loops=1)" " -> Nested Loop (cost=0.00..1344864.01 rows=744510 width=12) (actual time=0.807..2084.206 rows=134893 loops=1)" " Join Filter: ((m.taken >= sc.taken_start) AND (m.taken <= sc.taken_end) AND (sc.station_id = m.station_id))" " -> Nested Loop (cost=0.00..12755.07 rows=1220 width=18) (actual time=0.502..521.937 rows=23 loops=1)" " Join Filter: ((sec_to_gc(cube_distance((ll_to_earth((c.latitude_decimal)::double precision, (c.longitude_decimal)::double precision))::cube, (ll_to_earth((s.latitude_decimal)::double precision, (s.longitude_decimal)::double precision))::cube)) / 1000::double precision) <= 30::double precision)" " -> Index Scan using city_pkey1 on city c (cost=0.00..2.47 rows=1 width=16) (actual time=0.014..0.015 rows=1 loops=1)" " Index Cond: (id = 5182)" " -> Nested Loop (cost=0.00..9907.73 rows=3659 width=34) (actual time=0.014..28.937 rows=3458 loops=1)" " -> Seq Scan on station_category sc (cost=0.00..970.20 rows=3659 width=14) (actual time=0.008..10.947 rows=3458 loops=1)" " Filter: ((taken_start >= '1900-01-01'::date) AND (taken_end <= '1996-12-31'::date) AND (category_id = 1))" " -> Index Scan using station_pkey1 on station s (cost=0.00..2.43 rows=1 width=20) (actual time=0.004..0.004 rows=1 loops=3458)" " Index Cond: (s.id = sc.station_id)" " Filter: (s.applicable AND (s.elevation >= 0) AND (s.elevation <= 3000))" " -> Append (cost=0.00..1072.27 rows=947 width=18) (actual time=6.996..63.199 rows=5865 loops=23)" " -> Seq Scan on measurement m (cost=0.00..25.00 rows=6 width=22) (actual time=0.000..0.000 rows=0 loops=23)" " Filter: (m.category_id = 1)" " -> Bitmap Heap Scan on measurement_001 m (cost=20.79..1047.27 rows=941 width=18) (actual time=6.995..62.390 rows=5865 loops=23)" " Recheck Cond: ((m.station_id = sc.station_id) AND (m.taken >= sc.taken_start) AND (m.taken <= sc.taken_end) AND (m.category_id = 1))" " -> Bitmap Index Scan on measurement_001_stc_idx (cost=0.00..20.55 rows=941 width=0) (actual time=5.775..5.775 rows=5865 loops=23)" " Index Cond: ((m.station_id = sc.station_id) AND (m.taken >= sc.taken_start) AND (m.taken <= sc.taken_end) AND (m.category_id = 1))" "Total runtime: 2269.264 ms" 1900 to 1997: Full Table Scan "Sort (cost=1370192.26..1370192.76 rows=200 width=12) (actual time=86165.797..86165.809 rows=94 loops=1)" " Sort Key: (date_part('year'::text, (m.taken)::timestamp without time zone))" " Sort Method: quicksort Memory: 32kB" " -> HashAggregate (cost=1370181.12..1370184.62 rows=200 width=12) (actual time=86165.654..86165.736 rows=94 loops=1)" " -> Hash Join (cost=4293.60..1366355.81 rows=765061 width=12) (actual time=534.786..85920.007 rows=139721 loops=1)" " Hash Cond: (m.station_id = sc.station_id)" " Join Filter: ((m.taken >= sc.taken_start) AND (m.taken <= sc.taken_end))" " -> Append (cost=0.00..867005.80 rows=43670150 width=18) (actual time=0.009..79202.329 rows=43670079 loops=1)" " -> Seq Scan on measurement m (cost=0.00..25.00 rows=6 width=22) (actual time=0.001..0.001 rows=0 loops=1)" " Filter: (category_id = 1)" " -> Seq Scan on measurement_001 m (cost=0.00..866980.80 rows=43670144 width=18) (actual time=0.008..73312.008 rows=43670079 loops=1)" " Filter: (category_id = 1)" " -> Hash (cost=4277.93..4277.93 rows=1253 width=18) (actual time=534.704..534.704 rows=25 loops=1)" " -> Nested Loop (cost=847.87..4277.93 rows=1253 width=18) (actual time=415.837..534.682 rows=25 loops=1)" " Join Filter: ((sec_to_gc(cube_distance((ll_to_earth((c.latitude_decimal)::double precision, (c.longitude_decimal)::double precision))::cube, (ll_to_earth((s.latitude_decimal)::double precision, (s.longitude_decimal)::double precision))::cube)) / 1000::double precision) <= 30::double precision)" " -> Index Scan using city_pkey1 on city c (cost=0.00..2.47 rows=1 width=16) (actual time=0.012..0.014 rows=1 loops=1)" " Index Cond: (id = 5182)" " -> Hash Join (cost=847.87..1352.07 rows=3760 width=34) (actual time=6.427..35.107 rows=3552 loops=1)" " Hash Cond: (s.id = sc.station_id)" " -> Seq Scan on station s (cost=0.00..367.25 rows=7948 width=20) (actual time=0.004..23.529 rows=7949 loops=1)" " Filter: (applicable AND (elevation >= 0) AND (elevation <= 3000))" " -> Hash (cost=800.87..800.87 rows=3760 width=14) (actual time=6.416..6.416 rows=3552 loops=1)" " -> Bitmap Heap Scan on station_category sc (cost=430.29..800.87 rows=3760 width=14) (actual time=2.316..5.353 rows=3552 loops=1)" " Recheck Cond: (category_id = 1)" " Filter: ((taken_start >= '1900-01-01'::date) AND (taken_end <= '1997-12-31'::date))" " -> Bitmap Index Scan on station_category_station_category_idx (cost=0.00..429.35 rows=6376 width=0) (actual time=2.268..2.268 rows=6339 loops=1)" " Index Cond: (category_id = 1)" "Total runtime: 86165.936 ms"

    Read the article

  • How to use CLEAR USB internet connection in Ubuntu (host) and WindowsXP (guest) using VirtualBox

    - by bithacker
    I'm trying to use CLEAR Motorola WiMax USB in Ubuntu as there is no support for linux as yet. I've installed windowsxp as guest in ubuntu and the version I'm using is 3.2.2. USB is connecting fine in WindowsXP but I can't use internet in Ubuntu. Can you please tell me how to do it. Here is the configuration that could help you guys. Thanks in advance. I'm using Two Network Adapters. Network Adapter 1: PCnet-FAST III (NAT) Adapter 2: PCnet-FAST III (Host-only adapter, 'vboxnet0') ipconfig [on Guest windowsXP] Windows IP Configuration Ethernet adapter Local Area Connection: PCnet-FAST III (NAT) Connection-specific DNS Suffix . : IP Address. . . . . . . . . . . . : 10.0.2.15 Subnet Mask . . . . . . . . . . . : 255.255.255.0 Default Gateway . . . . . . . . . : 10.0.2.2 Ethernet adapter Local Area Connection 3: PCnet-FAST III (Host-only adapter, 'vboxnet0') Connection-specific DNS Suffix . : IP Address. . . . . . . . . . . . : 192.168.56.101 Subnet Mask . . . . . . . . . . . : 255.255.255.0 Default Gateway . . . . . . . . . : Ethernet adapter Local Area Connection 2: Connection-specific DNS Suffix . : CLEAR Motorola USB IP Address. . . . . . . . . . . . : 10.168.242.33 Subnet Mask . . . . . . . . . . . : 255.255.192.0 Default Gateway . . . . . . . . . : 10.168.192.2 IFCONFIG [on Host Ubuntu] (Ethernet) eth0 Link encap:Ethernet HWaddr 00:14:22:b9:9d:76 UP BROADCAST MULTICAST MTU:1500 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:0 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:0 (0.0 B) TX bytes:0 (0.0 B) Interrupt:16 eth1 (Wireless) Link encap:Ethernet HWaddr 00:13:ce:f0:9b:0d inet6 addr: fe80::213:ceff:fef0:9b0d/64 Scope:Link UP BROADCAST MULTICAST MTU:1500 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:1 errors:0 dropped:5 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:0 (0.0 B) TX bytes:84 (84.0 B) Interrupt:17 Base address:0xe000 Memory:dfcff000-dfcfffff lo Link encap:Local Loopback inet addr:127.0.0.1 Mask:255.0.0.0 inet6 addr: ::1/128 Scope:Host UP LOOPBACK RUNNING MTU:16436 Metric:1 RX packets:2292 errors:0 dropped:0 overruns:0 frame:0 TX packets:2292 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:0 RX bytes:171952 (171.9 KB) TX bytes:171952 (171.9 KB) vboxnet0 Link encap:Ethernet HWaddr 0a:00:27:00:00:00 inet addr:192.168.56.1 Bcast:192.168.56.255 Mask:255.255.255.0 inet6 addr: fe80::800:27ff:fe00:0/64 Scope:Link UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:137 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:0 (0.0 B) TX bytes:21174 (21.1 KB)

    Read the article

  • Why is insertion into my tree faster on sorted input than random input?

    - by Juliet
    Now I've always heard binary search trees are faster to build from randomly selected data than ordered data, simply because ordered data requires explicit rebalancing to keep the tree height at a minimum. Recently I implemented an immutable treap, a special kind of binary search tree which uses randomization to keep itself relatively balanced. In contrast to what I expected, I found I can consistently build a treap about 2x faster and generally better balanced from ordered data than unordered data -- and I have no idea why. Here's my treap implementation: http://pastebin.com/VAfSJRwZ And here's a test program: using System; using System.Collections.Generic; using System.Linq; using System.Diagnostics; namespace ConsoleApplication1 { class Program { static Random rnd = new Random(); const int ITERATION_COUNT = 20; static void Main(string[] args) { List<double> rndTimes = new List<double>(); List<double> orderedTimes = new List<double>(); rndTimes.Add(TimeIt(50, RandomInsert)); rndTimes.Add(TimeIt(100, RandomInsert)); rndTimes.Add(TimeIt(200, RandomInsert)); rndTimes.Add(TimeIt(400, RandomInsert)); rndTimes.Add(TimeIt(800, RandomInsert)); rndTimes.Add(TimeIt(1000, RandomInsert)); rndTimes.Add(TimeIt(2000, RandomInsert)); rndTimes.Add(TimeIt(4000, RandomInsert)); rndTimes.Add(TimeIt(8000, RandomInsert)); rndTimes.Add(TimeIt(16000, RandomInsert)); rndTimes.Add(TimeIt(32000, RandomInsert)); rndTimes.Add(TimeIt(64000, RandomInsert)); rndTimes.Add(TimeIt(128000, RandomInsert)); string rndTimesAsString = string.Join("\n", rndTimes.Select(x => x.ToString()).ToArray()); orderedTimes.Add(TimeIt(50, OrderedInsert)); orderedTimes.Add(TimeIt(100, OrderedInsert)); orderedTimes.Add(TimeIt(200, OrderedInsert)); orderedTimes.Add(TimeIt(400, OrderedInsert)); orderedTimes.Add(TimeIt(800, OrderedInsert)); orderedTimes.Add(TimeIt(1000, OrderedInsert)); orderedTimes.Add(TimeIt(2000, OrderedInsert)); orderedTimes.Add(TimeIt(4000, OrderedInsert)); orderedTimes.Add(TimeIt(8000, OrderedInsert)); orderedTimes.Add(TimeIt(16000, OrderedInsert)); orderedTimes.Add(TimeIt(32000, OrderedInsert)); orderedTimes.Add(TimeIt(64000, OrderedInsert)); orderedTimes.Add(TimeIt(128000, OrderedInsert)); string orderedTimesAsString = string.Join("\n", orderedTimes.Select(x => x.ToString()).ToArray()); Console.WriteLine("Done"); } static double TimeIt(int insertCount, Action<int> f) { Console.WriteLine("TimeIt({0}, {1})", insertCount, f.Method.Name); List<double> times = new List<double>(); for (int i = 0; i < ITERATION_COUNT; i++) { Stopwatch sw = Stopwatch.StartNew(); f(insertCount); sw.Stop(); times.Add(sw.Elapsed.TotalMilliseconds); } return times.Average(); } static void RandomInsert(int insertCount) { Treap<double> tree = new Treap<double>((x, y) => x.CompareTo(y)); for (int i = 0; i < insertCount; i++) { tree = tree.Insert(rnd.NextDouble()); } } static void OrderedInsert(int insertCount) { Treap<double> tree = new Treap<double>((x, y) => x.CompareTo(y)); for(int i = 0; i < insertCount; i++) { tree = tree.Insert(i + rnd.NextDouble()); } } } } And here's a chart comparing random and ordered insertion times in milliseconds: Insertions Random Ordered RandomTime / OrderedTime 50 1.031665 0.261585 3.94 100 0.544345 1.377155 0.4 200 1.268320 0.734570 1.73 400 2.765555 1.639150 1.69 800 6.089700 3.558350 1.71 1000 7.855150 4.704190 1.67 2000 17.852000 12.554065 1.42 4000 40.157340 22.474445 1.79 8000 88.375430 48.364265 1.83 16000 197.524000 109.082200 1.81 32000 459.277050 238.154405 1.93 64000 1055.508875 512.020310 2.06 128000 2481.694230 1107.980425 2.24 I don't see anything in the code which makes ordered input asymptotically faster than unordered input, so I'm at a loss to explain the difference. Why is it so much faster to build a treap from ordered input than random input?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Lua metatable Objects cannot be purge from memory?

    - by Prometheus3k
    Hi there, I'm using a proprietary platform that reported memory usage in realtime on screen. I decided to use a Class.lua I found on http://lua-users.org/wiki/SimpleLuaClasses However, I noticed memory issues when purging object created by this using a simple Account class. Specifically, I would start with say 146k of memory used, create 1000 objects of a class that just holds an integer instance variable and store each object into a table. The memory used is now 300k I would then exit, iterating through the table and setting each element in the table to nil. But would never get back the 146k, usually after this I am left using 210k or something similar. If I run the load sequence again during the same session, it does not exceed 300k so it is not a memory leak. I have tried creating 1000 integers in a table and setting these to nil, which does give me back 146k. In addition I've tried a simpler class file (Account2.lua) that doesn't rely on a class.lua. This still incurs memory fragmentation but not as much as the one that uses Class.lua Can anybody explain what is going on here? How can I purge these objects and get back the memory? here is the code --------Class.lua------ -- class.lua -- Compatible with Lua 5.1 (not 5.0). --http://lua-users.org/wiki/SimpleLuaClasses function class(base,ctor) local c = {} -- a new class instance if not ctor and type(base) == 'function' then ctor = base base = nil elseif type(base) == 'table' then -- our new class is a shallow copy of the base class! for i,v in pairs(base) do c[i] = v end c._base = base end -- the class will be the metatable for all its objects, -- and they will look up their methods in it. c.__index = c -- expose a ctor which can be called by () local mt = {} mt.__call = function(class_tbl,...) local obj = {} setmetatable(obj,c) if ctor then ctor(obj,...) else -- make sure that any stuff from the base class is initialized! if base and base.init then base.init(obj,...) end end return obj end c.init = ctor c.instanceOf = function(self,klass) local m = getmetatable(self) while m do if m == klass then return true end m = m._base end return false end setmetatable(c,mt) return c end --------Account.lua------ --Import Class template require 'class' local classname = "Account" --Declare class Constructor Account = class(function(acc,balance) --Instance variables declared here. if(balance ~= nil)then acc.balance = balance else --default value acc.balance = 2097 end acc.classname = classname end) --------Account2.lua------ local account2 = {} account2.classname = "unnamed" account2.balance = 2097 -----------Constructor 1 do local metatable = { __index = account2; } function Account2() return setmetatable({}, metatable); end end --------Main.lua------ require 'Account' require 'Account2' MAX_OBJ = 5000; test_value = 1000; Obj_Table = {}; MODE_ACC0 = 0 --integers MODE_ACC1 = 1 --Account MODE_ACC2 = 2 --Account2 TEST_MODE = MODE_ACC0; Lua_mem = ""; print("##1) collectgarbage('count'): " .. collectgarbage('count')); function Load() for i=1, MAX_OBJ do if(TEST_MODE == MODE_ACC0 )then table.insert(Obj_Table, test_value); elseif(TEST_MODE == MODE_ACC1 )then table.insert(Obj_Table, Account(test_value)); --Account.lua elseif(TEST_MODE == MODE_ACC2 )then table.insert(Obj_Table, Account2()); --Account2.lua Obj_Table[i].balance = test_value; end end print("##2) collectgarbage('count'): " .. collectgarbage('count')); end function Purge() --metatable purge if(TEST_MODE ~= MODE_ACC0)then --purge stage 0: print("set each elements metatable to nil") for i=1, MAX_OBJ do setmetatable(Obj_Table[i], nil); end end --purge stage 1: print("set table element to nil") for i=1, MAX_OBJ do Obj_Table[i] = nil; end --purge stage 2: print("start table.remove..."); for i=1, MAX_OBJ do table.remove(Obj_Table, i); end print("...end table.remove"); --purge stage 3: print("create new object_table {}"); Obj_Table= {}; --purge stage 4: print("collectgarbage('collect')"); collectgarbage('collect'); print("##3) collectgarbage('count'): " .. collectgarbage('count')); end --Loop callback function OnUpdate() collectgarbage('collect'); Lua_mem = collectgarbage('count'); end ------------------- --NOTE: --On start of game runs Load(), another runs Purge() --Update I've updated the code with suggestions from comments below, and will post my findings later today.

    Read the article

  • Fetch image from folder via datatable does not work after placing image in subdirectory

    - by Arnold Bishkoff
    I am having trouble wrapping my head around the following I have code that fetches an image via smarty in a line img src="getsnap.php?picid={$data[$smarty.section.sec.index].picno|default:$nextpic}&typ=pic&width={$config.disp_snap_width}&height={$config.disp_snap_height}" class="smallpic" alt="" / this works if i pull the image from /temp/userimages/userid/imageNo.ext but because an OS can segfault if you store too many folders or images in a directory i have code that assigns the user image to a subdirectory based upon division of a subdir per 1000 userids. so in thise case i have user id 94 whos images get stored in /siteroot/temp/userimages/000000/94/pic_1.jpg (through 10) or tn_1 (through 10).jpg here is the code for getsnap.php <?php ob_start(); if ( !defined( 'SMARTY_DIR' ) ) { include_once( 'init.php' ); } include('core/snaps_functions.php'); if (isset($_REQUEST['username']) && $_REQUEST['username'] != '') { $userid = $osDB-getOne('select id from ! where username = ?',array(USER_TABLE, $_REQUEST['username']) ); } else { // include ( 'sessioninc.php' ); if( !isset($_GET['id']) || (isset($_GET['id'])&& (int)$_GET['id'] <= 0 ) ) { $userid = $_SESSION['UserId']; } else { $userid = $_GET['id']; } } if (!isset($_GET['picid']) ) { if ((isset($_REQUEST['type']) && $_REQUEST['type'] != 'gallery') || !isset($_REQUEST['type']) ) { $defpic = $osDB-getOne('select picno from ! where userid = ? and ( album_id is null or album_id = ?) and default_pic = ? and active = ? ',array(USER_SNAP_TABLE, $userid,'0','Y','Y' ) ); if ($defpic != '') { $picid = $defpic; } else { $picid = $osDB-getOne('select picno from ! where userid = ? and ( album_id is null or album_id = ?) and active=? order by rand()',array(USER_SNAP_TABLE, $userid,'0','Y' ) ); } unset( $defpic); } } else { $picid = $_GET['picid']; } $typ = isset( $_GET['typ'])?$_GET['typ']:'pic' ; $cond = ''; if ( ($config['snaps_require_approval'] == 'Y' || $config['snaps_require_approval'] == '1') && $userid != $_SESSION['UserId'] ) { $cond = " and active = 'Y' "; } $sql = 'select * from ! where userid = ? and picno = ? '.$cond; //Get the pic $row =& $osDB-getRow ( $sql, array( USER_SNAP_TABLE, $userid, $picid ) ); //Okay pic was found in the DB, Lets actually do something // $id = $userid; $dir = str_pad(($id - ($id % 1000))/100000,6,'0',STR_PAD_LEFT); $zimg = USER_IMAGES_DIR.$dir; $img = getPicture($zimg, $userid, $picid, $typ, $row); //$img = getPicture($userid, $picid, $typ, $row); //$img = getPicture($dir, $userid, $picid, $typ, $row); $ext = ($typ = 'tn')?$row['tnext']:$row['picext']; // Now pic is built as // something pic_x.ext ie pic_2.jpg if ( $img != '' && ( ( hasRight('seepictureprofile') && ( $config['snaps_require_approval'] == 'Y' && $row['active'] == 'Y' ) ||$config['snaps_require_approval'] == 'N' ) || $userid == $_SESSION['UserId'] ) ) { $img2 = $img; //$img2 = $dir.'/'.$img; } else { $gender = $osDB-getOne( 'select gender from ! where id = ?', array( USER_TABLE, $userid ) ) ; if ($gender == 'M') { $nopic = SKIN_IMAGES_DIR.'male.jpg'; } elseif ($gender == 'F') { $nopic = SKIN_IMAGES_DIR.'female.jpg'; } elseif ($gender == 'D') { $nopic = SKIN_IMAGES_DIR.'director.jpg'; } $img2 = imagecreatefromjpeg($nopic); $ext = 'jpg'; } ob_end_clean(); header("Pragma: public"); header("Content-Type: image/".$ext); header("Content-Transfer-Encoding: binary"); header("Cache-Control: must-revalidate"); $ExpStr = "Expires: " . gmdate("D, d M Y H:i:s", time() - 30) . " GMT"; header($ExpStr); $id = $userid; $dir = str_pad(($id - ($id % 1000))/100000,6,'0',STR_PAD_LEFT); $zimg = USER_IMAGES_DIR.$dir; //header("Content-Disposition: attachment; filename=profile_".$userid."_".$typ.".".$ext); //header("Content-Disposition: attachment; filename=$dir.'/'.profile_".$userid."".$typ.".".$ext); //header("Content-Disposition: attachment; filename=profile"$dir".'/'.".$userid."_".$typ.".".$ext); header("Content-Disposition: attachment; filename=profile_".$userid."_".$typ.".".$ext); /* if ($_SESSION['browser'] != 'MSIE') { header("Content-Disposition: inline" ); } */ if ($ext == 'jpg') { imagejpeg($img2); } elseif ($ext == 'gif') { imagegif($img2); } elseif ($ext == 'png') { imagepng($img2); } elseif ($ext == 'bmp') { imagewbmp($img2); } imagedestroy($img2); ?

    Read the article

  • How to move the mouse

    - by GroundZero
    I'm making a little bot in C#. At the moment it works pretty well, it can load text from a file and type it for you. But for now, I need to manualy click the textfield to put the focus on it, remaximize my form and then click the Type-button. After the typing, I need to manualy slide the scorebar and press submit. I'd like to know how I can move my mouse with C# and if possible, if possible I'd like to load the mouse positions from a xml-file. I need to move to the textfield, click in it to focus on it, start the type script, move to the slider, hold the mouse down on it while dragging, releasing it on the correct position & clicking on the submitbutton This is what I have for now: To load in the variables, I'm using this script: private void Initialize() { XmlTextReader reader = new XmlTextReader(Application.StartupPath + @"..\..\..\CursorPositions.xml"); while (reader.Read()) { switch (reader.NodeType) { case XmlNodeType.Element: // The node is an element. element = reader.Value; break; case XmlNodeType.Text: //Display the text in each element. switch (element) { case "Textbox-X": textX = int.Parse(reader.Value); break; case "Textbox-Y": textY = int.Parse(reader.Value); break; case "SliderBegin-X": sliderX = int.Parse(reader.Value); break; case "SliderBegin-Y": sliderY = int.Parse(reader.Value); break; case "SubmitButton-X": submitX = int.Parse(reader.Value); break; case "SubmitButton-Y": submitY = int.Parse(reader.Value); break; } break; } } This is the xml-file: <?xml version="1.0" encoding="utf-8" ?> <CursorPositions> <Textbox-X>430</Textbox-X> <Textbox-Y>270</Textbox-Y> <SliderBegin-X>430</SliderBegin-X> <SliderBegin-Y>470</SliderBegin-Y> <SubmitButton-X>860</SubmitButton-X> <SubmitButton-Y>365</SubmitButton-Y> </CursorPositions> To move the mouse I'm using this piece of code: public partial class FrmMain : Form { [System.Runtime.InteropServices.DllImport("user32.dll")] public static extern void mouse_event(int dwFlags, int dx, int dy, int cButtons, int dwExtraInfo); public const int MOUSEEVENTF_LEFTDOWN = 0x0002; public const int MOUSEEVENTF_LEFTUP = 0x0004; public const int MOUSEEVENTF_RIGHTDOWN = 0x0008; public const int MOUSEEVENTF_RIGHTUP = 0x0010; ... private void btnStart_Click(object sender, EventArgs e) { // start button (de)activates loop if (!running) { btnStart.Text = "Stop"; btnStart.Cursor = Cursors.No; running = true; } else { btnStart.Text = "Start"; btnStart.Cursor = Cursors.AppStarting; running = false; } while (running) { // move to textbox & type Cursor.Position = new Point(textX, textY); mouse_event(MOUSEEVENTF_LEFTDOWN, textX, textY, 0, 0); mouse_event(MOUSEEVENTF_LEFTUP, textX, textY, 0, 0); Type(); // wait 90 seconds till slider available Thread.Sleep(90 * 1000); // move to slider & slide according to score Cursor.Position = new Point(sliderX, sliderY); mouse_event(MOUSEEVENTF_LEFTDOWN, sliderX, sliderY, 0, 0); Cursor.Position = new Point(sliderX + 345 / 10 * score, sliderY); mouse_event(MOUSEEVENTF_LEFTUP, sliderX + 345 / 10 * score, sliderY, 0, 0); // submit Cursor.Position = new Point(submitX, submitY); mouse_event(MOUSEEVENTF_LEFTDOWN, submitX, submitY, 0, 0); mouse_event(MOUSEEVENTF_LEFTUP, submitX, submitY, 0, 0); // wait 10 sec to be sure it's submitted Thread.Sleep(10 * 1000); // refresh page SendKeys.SendWait("{F5}"); // get new text NewText(); // wait 10 sec to refresh and load song Thread.Sleep(10 * 1000); } } } PS: I get the coordinates via my form. I've got 2 labels that show my X & Y coordinates. To capture them outside the form, I press and hold my Left Mouse Button and 'drag' it outside the form to the correct place. This way I get the coordinates of my mouse outside the form

    Read the article

  • RFC Repository of programming RFC's with ability to direct-link sections or even lines?

    - by Lasse V. Karlsen
    Forgive me if this is the wrong place to ask this, I feel like the question is slightly off-topic even though it is also about programming. I am inputting todo-tasks for my WebDAV-project into my issue tracker, as I read through the relevant RFC's, and it would be nice to be able to add a link in my issue text directly to the relevant text, instead of just a link to the RFC file with a section number in the issue text, and then I have to use the find function to find it. For instance, a link like this: http://ieft.org/rfc2518.txt#1000 <-- line 1000 http://ieft.org/rfc2518.txt#9.8.3 <-- section 9.8.3 Neither of these two works, since they just post the full text files, so my question is this: Does anyone know of hosted versions of the RFC documents that contains such links?

    Read the article

  • php nested for statements?

    - by Dashiell0415
    I'm trying to process a for loop within a for loop, and just a little wary of the syntax... Will this work? Essentially, I want to run code for every 1,000 records while the count is equal to or less than the $count... Will the syntax below work, or is there a better way? for($x = 0; $x <= 700000; $x++) { for($i = 0; $i <= 1000; $i++) { //run the code } }

    Read the article

  • How to do elif statments more elegantly if appending to array in python

    - by user1741339
    I am trying to do a more elegant version of this code. This just basically appends a string to categorynumber depending on the number. Would appreciate any help. number = [100,150,200,500] categoryNumber = [] for i in range (0,len(number)): if (number [i] >=1000): categoryNumber.append('number > 1000') elif (number [i] >=200): categoryNumber.append('200 < number < 300') elif (number [i] >=100): categoryNumber.append('100 < number < 200') elif (number [i] >=50): categoryNumber.append('50 < number < 100') elif (number [i] < 50): categoryNumber.append('number < 50') for i in range(0,len(categoryNumber)): print i

    Read the article

  • Invalid algorithm specified on Windows 2003 Server only

    - by JL
    I am decoding a file using the following method: string outFileName = zfoFileName.Replace(".zfo", "_tmp.zfo"); FileStream inFile = null; FileStream outFile = null; inFile = File.Open(zfoFileName, FileMode.Open); outFile = File.Create(outFileName); LargeCMS.CMS cms = new LargeCMS.CMS(); cms.Decode(inFile, outFile); This is working fine on my Win 7 dev machine, but on a Windows 2003 server production machine it fails with the following exception: Exception: System.Exception: CryptMsgUpdate error #-2146893816 --- System.ComponentModel.Win32Exception: Invalid algorithm specified --- End of inner exception stack trace --- at LargeCMS.CMS.Decode(FileStream inFile, FileStream outFile) Here are the classes below which I call to do the decoding, if needed I can upload a sample file for decoding, its just strange it works on Win 7, and not on Win2k3 server: using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.IO; using System.Security.Cryptography; using System.Security.Cryptography.X509Certificates; using System.Runtime.InteropServices; using System.ComponentModel; namespace LargeCMS { class CMS { // File stream to use in callback function private FileStream m_callbackFile; // Streaming callback function for encoding private Boolean StreamOutputCallback(IntPtr pvArg, IntPtr pbData, int cbData, Boolean fFinal) { // Write all bytes to encoded file Byte[] bytes = new Byte[cbData]; Marshal.Copy(pbData, bytes, 0, cbData); m_callbackFile.Write(bytes, 0, cbData); if (fFinal) { // This is the last piece. Close the file m_callbackFile.Flush(); m_callbackFile.Close(); m_callbackFile = null; } return true; } // Encode CMS with streaming to support large data public void Encode(X509Certificate2 cert, FileStream inFile, FileStream outFile) { // Variables Win32.CMSG_SIGNER_ENCODE_INFO SignerInfo; Win32.CMSG_SIGNED_ENCODE_INFO SignedInfo; Win32.CMSG_STREAM_INFO StreamInfo; Win32.CERT_CONTEXT[] CertContexts = null; Win32.BLOB[] CertBlobs; X509Chain chain = null; X509ChainElement[] chainElements = null; X509Certificate2[] certs = null; RSACryptoServiceProvider key = null; BinaryReader stream = null; GCHandle gchandle = new GCHandle(); IntPtr hProv = IntPtr.Zero; IntPtr SignerInfoPtr = IntPtr.Zero; IntPtr CertBlobsPtr = IntPtr.Zero; IntPtr hMsg = IntPtr.Zero; IntPtr pbPtr = IntPtr.Zero; Byte[] pbData; int dwFileSize; int dwRemaining; int dwSize; Boolean bResult = false; try { // Get data to encode dwFileSize = (int)inFile.Length; stream = new BinaryReader(inFile); pbData = stream.ReadBytes(dwFileSize); // Prepare stream for encoded info m_callbackFile = outFile; // Get cert chain chain = new X509Chain(); chain.Build(cert); chainElements = new X509ChainElement[chain.ChainElements.Count]; chain.ChainElements.CopyTo(chainElements, 0); // Get certs in chain certs = new X509Certificate2[chainElements.Length]; for (int i = 0; i < chainElements.Length; i++) { certs[i] = chainElements[i].Certificate; } // Get context of all certs in chain CertContexts = new Win32.CERT_CONTEXT[certs.Length]; for (int i = 0; i < certs.Length; i++) { CertContexts[i] = (Win32.CERT_CONTEXT)Marshal.PtrToStructure(certs[i].Handle, typeof(Win32.CERT_CONTEXT)); } // Get cert blob of all certs CertBlobs = new Win32.BLOB[CertContexts.Length]; for (int i = 0; i < CertContexts.Length; i++) { CertBlobs[i].cbData = CertContexts[i].cbCertEncoded; CertBlobs[i].pbData = CertContexts[i].pbCertEncoded; } // Get CSP of client certificate key = (RSACryptoServiceProvider)certs[0].PrivateKey; bResult = Win32.CryptAcquireContext( ref hProv, key.CspKeyContainerInfo.KeyContainerName, key.CspKeyContainerInfo.ProviderName, key.CspKeyContainerInfo.ProviderType, 0 ); if (!bResult) { throw new Exception("CryptAcquireContext error #" + Marshal.GetLastWin32Error().ToString(), new Win32Exception(Marshal.GetLastWin32Error())); } // Populate Signer Info struct SignerInfo = new Win32.CMSG_SIGNER_ENCODE_INFO(); SignerInfo.cbSize = Marshal.SizeOf(SignerInfo); SignerInfo.pCertInfo = CertContexts[0].pCertInfo; SignerInfo.hCryptProvOrhNCryptKey = hProv; SignerInfo.dwKeySpec = (int)key.CspKeyContainerInfo.KeyNumber; SignerInfo.HashAlgorithm.pszObjId = Win32.szOID_OIWSEC_sha1; // Populate Signed Info struct SignedInfo = new Win32.CMSG_SIGNED_ENCODE_INFO(); SignedInfo.cbSize = Marshal.SizeOf(SignedInfo); SignedInfo.cSigners = 1; SignerInfoPtr = Marshal.AllocHGlobal(Marshal.SizeOf(SignerInfo)); Marshal.StructureToPtr(SignerInfo, SignerInfoPtr, false); SignedInfo.rgSigners = SignerInfoPtr; SignedInfo.cCertEncoded = CertBlobs.Length; CertBlobsPtr = Marshal.AllocHGlobal(Marshal.SizeOf(CertBlobs[0]) * CertBlobs.Length); for (int i = 0; i < CertBlobs.Length; i++) { Marshal.StructureToPtr(CertBlobs[i], new IntPtr(CertBlobsPtr.ToInt64() + (Marshal.SizeOf(CertBlobs[i]) * i)), false); } SignedInfo.rgCertEncoded = CertBlobsPtr; // Populate Stream Info struct StreamInfo = new Win32.CMSG_STREAM_INFO(); StreamInfo.cbContent = dwFileSize; StreamInfo.pfnStreamOutput = new Win32.StreamOutputCallbackDelegate(StreamOutputCallback); // TODO: CMSG_DETACHED_FLAG // Open message to encode hMsg = Win32.CryptMsgOpenToEncode( Win32.X509_ASN_ENCODING | Win32.PKCS_7_ASN_ENCODING, 0, Win32.CMSG_SIGNED, ref SignedInfo, null, ref StreamInfo ); if (hMsg.Equals(IntPtr.Zero)) { throw new Exception("CryptMsgOpenToEncode error #" + Marshal.GetLastWin32Error().ToString(), new Win32Exception(Marshal.GetLastWin32Error())); } // Process the whole message gchandle = GCHandle.Alloc(pbData, GCHandleType.Pinned); pbPtr = gchandle.AddrOfPinnedObject(); dwRemaining = dwFileSize; dwSize = (dwFileSize < 1024 * 1000 * 100) ? dwFileSize : 1024 * 1000 * 100; while (dwRemaining > 0) { // Update message piece by piece bResult = Win32.CryptMsgUpdate( hMsg, pbPtr, dwSize, (dwRemaining <= dwSize) ? true : false ); if (!bResult) { throw new Exception("CryptMsgUpdate error #" + Marshal.GetLastWin32Error().ToString(), new Win32Exception(Marshal.GetLastWin32Error())); } // Move to the next piece pbPtr = new IntPtr(pbPtr.ToInt64() + dwSize); dwRemaining -= dwSize; if (dwRemaining < dwSize) { dwSize = dwRemaining; } } } finally { // Clean up if (gchandle.IsAllocated) { gchandle.Free(); } if (stream != null) { stream.Close(); } if (m_callbackFile != null) { m_callbackFile.Close(); } if (!CertBlobsPtr.Equals(IntPtr.Zero)) { Marshal.FreeHGlobal(CertBlobsPtr); } if (!SignerInfoPtr.Equals(IntPtr.Zero)) { Marshal.FreeHGlobal(SignerInfoPtr); } if (!hProv.Equals(IntPtr.Zero)) { Win32.CryptReleaseContext(hProv, 0); } if (!hMsg.Equals(IntPtr.Zero)) { Win32.CryptMsgClose(hMsg); } } } // Decode CMS with streaming to support large data public void Decode(FileStream inFile, FileStream outFile) { // Variables Win32.CMSG_STREAM_INFO StreamInfo; Win32.CERT_CONTEXT SignerCertContext; BinaryReader stream = null; GCHandle gchandle = new GCHandle(); IntPtr hMsg = IntPtr.Zero; IntPtr pSignerCertInfo = IntPtr.Zero; IntPtr pSignerCertContext = IntPtr.Zero; IntPtr pbPtr = IntPtr.Zero; IntPtr hStore = IntPtr.Zero; Byte[] pbData; Boolean bResult = false; int dwFileSize; int dwRemaining; int dwSize; int cbSignerCertInfo; try { // Get data to decode dwFileSize = (int)inFile.Length; stream = new BinaryReader(inFile); pbData = stream.ReadBytes(dwFileSize); // Prepare stream for decoded info m_callbackFile = outFile; // Populate Stream Info struct StreamInfo = new Win32.CMSG_STREAM_INFO(); StreamInfo.cbContent = dwFileSize; StreamInfo.pfnStreamOutput = new Win32.StreamOutputCallbackDelegate(StreamOutputCallback); // Open message to decode hMsg = Win32.CryptMsgOpenToDecode( Win32.X509_ASN_ENCODING | Win32.PKCS_7_ASN_ENCODING, 0, 0, IntPtr.Zero, IntPtr.Zero, ref StreamInfo ); if (hMsg.Equals(IntPtr.Zero)) { throw new Exception("CryptMsgOpenToDecode error #" + Marshal.GetLastWin32Error().ToString(), new Win32Exception(Marshal.GetLastWin32Error())); } // Process the whole message gchandle = GCHandle.Alloc(pbData, GCHandleType.Pinned); pbPtr = gchandle.AddrOfPinnedObject(); dwRemaining = dwFileSize; dwSize = (dwFileSize < 1024 * 1000 * 100) ? dwFileSize : 1024 * 1000 * 100; while (dwRemaining > 0) { // Update message piece by piece bResult = Win32.CryptMsgUpdate( hMsg, pbPtr, dwSize, (dwRemaining <= dwSize) ? true : false ); if (!bResult) { throw new Exception("CryptMsgUpdate error #" + Marshal.GetLastWin32Error().ToString(), new Win32Exception(Marshal.GetLastWin32Error())); } // Move to the next piece pbPtr = new IntPtr(pbPtr.ToInt64() + dwSize); dwRemaining -= dwSize; if (dwRemaining < dwSize) { dwSize = dwRemaining; } } // Get signer certificate info cbSignerCertInfo = 0; bResult = Win32.CryptMsgGetParam( hMsg, Win32.CMSG_SIGNER_CERT_INFO_PARAM, 0, IntPtr.Zero, ref cbSignerCertInfo ); if (!bResult) { throw new Exception("CryptMsgGetParam error #" + Marshal.GetLastWin32Error().ToString(), new Win32Exception(Marshal.GetLastWin32Error())); } pSignerCertInfo = Marshal.AllocHGlobal(cbSignerCertInfo); bResult = Win32.CryptMsgGetParam( hMsg, Win32.CMSG_SIGNER_CERT_INFO_PARAM, 0, pSignerCertInfo, ref cbSignerCertInfo ); if (!bResult) { throw new Exception("CryptMsgGetParam error #" + Marshal.GetLastWin32Error().ToString(), new Win32Exception(Marshal.GetLastWin32Error())); } // Open a cert store in memory with the certs from the message hStore = Win32.CertOpenStore( Win32.CERT_STORE_PROV_MSG, Win32.X509_ASN_ENCODING | Win32.PKCS_7_ASN_ENCODING, IntPtr.Zero, 0, hMsg ); if (hStore.Equals(IntPtr.Zero)) { throw new Exception("CertOpenStore error #" + Marshal.GetLastWin32Error().ToString(), new Win32Exception(Marshal.GetLastWin32Error())); } // Find the signer's cert in the store pSignerCertContext = Win32.CertGetSubjectCertificateFromStore( hStore, Win32.X509_ASN_ENCODING | Win32.PKCS_7_ASN_ENCODING, pSignerCertInfo ); if (pSignerCertContext.Equals(IntPtr.Zero)) { throw new Exception("CertGetSubjectCertificateFromStore error #" + Marshal.GetLastWin32Error().ToString(), new Win32Exception(Marshal.GetLastWin32Error())); } // Set message for verifying SignerCertContext = (Win32.CERT_CONTEXT)Marshal.PtrToStructure(pSignerCertContext, typeof(Win32.CERT_CONTEXT)); bResult = Win32.CryptMsgControl( hMsg, 0, Win32.CMSG_CTRL_VERIFY_SIGNATURE, SignerCertContext.pCertInfo ); if (!bResult) { throw new Exception("CryptMsgControl error #" + Marshal.GetLastWin32Error().ToString(), new Win32Exception(Marshal.GetLastWin32Error())); } } finally { // Clean up if (gchandle.IsAllocated) { gchandle.Free(); } if (!pSignerCertContext.Equals(IntPtr.Zero)) { Win32.CertFreeCertificateContext(pSignerCertContext); } if (!pSignerCertInfo.Equals(IntPtr.Zero)) { Marshal.FreeHGlobal(pSignerCertInfo); } if (!hStore.Equals(IntPtr.Zero)) { Win32.CertCloseStore(hStore, Win32.CERT_CLOSE_STORE_FORCE_FLAG); } if (stream != null) { stream.Close(); } if (m_callbackFile != null) { m_callbackFile.Close(); } if (!hMsg.Equals(IntPtr.Zero)) { Win32.CryptMsgClose(hMsg); } } } } } and using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Runtime.InteropServices; using System.Security.Cryptography.X509Certificates; using System.ComponentModel; using System.Security.Cryptography; namespace LargeCMS { class Win32 { #region "CONSTS" public const int X509_ASN_ENCODING = 0x00000001; public const int PKCS_7_ASN_ENCODING = 0x00010000; public const int CMSG_SIGNED = 2; public const int CMSG_DETACHED_FLAG = 0x00000004; public const int AT_KEYEXCHANGE = 1; public const int AT_SIGNATURE = 2; public const String szOID_OIWSEC_sha1 = "1.3.14.3.2.26"; public const int CMSG_CTRL_VERIFY_SIGNATURE = 1; public const int CMSG_CERT_PARAM = 12; public const int CMSG_SIGNER_CERT_INFO_PARAM = 7; public const int CERT_STORE_PROV_MSG = 1; public const int CERT_CLOSE_STORE_FORCE_FLAG = 1; #endregion #region "STRUCTS" [StructLayout(LayoutKind.Sequential)] public struct CRYPT_ALGORITHM_IDENTIFIER { public String pszObjId; BLOB Parameters; } [StructLayout(LayoutKind.Sequential)] public struct CERT_ID { public int dwIdChoice; public BLOB IssuerSerialNumberOrKeyIdOrHashId; } [StructLayout(LayoutKind.Sequential)] public struct CMSG_SIGNER_ENCODE_INFO { public int cbSize; public IntPtr pCertInfo; public IntPtr hCryptProvOrhNCryptKey; public int dwKeySpec; public CRYPT_ALGORITHM_IDENTIFIER HashAlgorithm; public IntPtr pvHashAuxInfo; public int cAuthAttr; public IntPtr rgAuthAttr; public int cUnauthAttr; public IntPtr rgUnauthAttr; public CERT_ID SignerId; public CRYPT_ALGORITHM_IDENTIFIER HashEncryptionAlgorithm; public IntPtr pvHashEncryptionAuxInfo; } [StructLayout(LayoutKind.Sequential)] public struct CERT_CONTEXT { public int dwCertEncodingType; public IntPtr pbCertEncoded; public int cbCertEncoded; public IntPtr pCertInfo; public IntPtr hCertStore; } [StructLayout(LayoutKind.Sequential)] public struct BLOB { public int cbData; public IntPtr pbData; } [StructLayout(LayoutKind.Sequential)] public struct CMSG_SIGNED_ENCODE_INFO { public int cbSize; public int cSigners; public IntPtr rgSigners; public int cCertEncoded; public IntPtr rgCertEncoded; public int cCrlEncoded; public IntPtr rgCrlEncoded; public int cAttrCertEncoded; public IntPtr rgAttrCertEncoded; } [StructLayout(LayoutKind.Sequential)] public struct CMSG_STREAM_INFO { public int cbContent; public StreamOutputCallbackDelegate pfnStreamOutput; public IntPtr pvArg; } #endregion #region "DELEGATES" public delegate Boolean StreamOutputCallbackDelegate(IntPtr pvArg, IntPtr pbData, int cbData, Boolean fFinal); #endregion #region "API" [DllImport("advapi32.dll", CharSet = CharSet.Auto, SetLastError = true)] public static extern Boolean CryptAcquireContext( ref IntPtr hProv, String pszContainer, String pszProvider, int dwProvType, int dwFlags ); [DllImport("Crypt32.dll", SetLastError = true)] public static extern IntPtr CryptMsgOpenToEncode( int dwMsgEncodingType, int dwFlags, int dwMsgType, ref CMSG_SIGNED_ENCODE_INFO pvMsgEncodeInfo, String pszInnerContentObjID, ref CMSG_STREAM_INFO pStreamInfo ); [DllImport("Crypt32.dll", SetLastError = true)] public static extern IntPtr CryptMsgOpenToDecode( int dwMsgEncodingType, int dwFlags, int dwMsgType, IntPtr hCryptProv, IntPtr pRecipientInfo, ref CMSG_STREAM_INFO pStreamInfo ); [DllImport("Crypt32.dll", SetLastError = true)] public static extern Boolean CryptMsgClose( IntPtr hCryptMsg ); [DllImport("Crypt32.dll", SetLastError = true)] public static extern Boolean CryptMsgUpdate( IntPtr hCryptMsg, Byte[] pbData, int cbData, Boolean fFinal ); [DllImport("Crypt32.dll", SetLastError = true)] public static extern Boolean CryptMsgUpdate( IntPtr hCryptMsg, IntPtr pbData, int cbData, Boolean fFinal ); [DllImport("Crypt32.dll", SetLastError = true)] public static extern Boolean CryptMsgGetParam( IntPtr hCryptMsg, int dwParamType, int dwIndex, IntPtr pvData, ref int pcbData ); [DllImport("Crypt32.dll", SetLastError = true)] public static extern Boolean CryptMsgControl( IntPtr hCryptMsg, int dwFlags, int dwCtrlType, IntPtr pvCtrlPara ); [DllImport("advapi32.dll", SetLastError = true)] public static extern Boolean CryptReleaseContext( IntPtr hProv, int dwFlags ); [DllImport("Crypt32.dll", SetLastError = true)] public static extern IntPtr CertCreateCertificateContext( int dwCertEncodingType, IntPtr pbCertEncoded, int cbCertEncoded ); [DllImport("Crypt32.dll", SetLastError = true)] public static extern Boolean CertFreeCertificateContext( IntPtr pCertContext ); [DllImport("Crypt32.dll", SetLastError = true)] public static extern IntPtr CertOpenStore( int lpszStoreProvider, int dwMsgAndCertEncodingType, IntPtr hCryptProv, int dwFlags, IntPtr pvPara ); [DllImport("Crypt32.dll", SetLastError = true)] public static extern IntPtr CertGetSubjectCertificateFromStore( IntPtr hCertStore, int dwCertEncodingType, IntPtr pCertId ); [DllImport("Crypt32.dll", SetLastError = true)] public static extern IntPtr CertCloseStore( IntPtr hCertStore, int dwFlags ); #endregion } }

    Read the article

  • Why i disconnect every few seconds? using USB wireless adapter

    - by Rev3rse
    i know it's for ubuntu questions..but mint and ubuntu are very similiar and i had the same problem with linux ubuntu too..so i think this is the right place for my question anyway i don't have experience with drivers and other things,after installing Linux on my machine( i did dist-upgrade btw) everything seem to be great because i didn't have to install any driver, after a while i realized that my connection stop after few minutes(actually it shows that I'm connected but it's not) so i have to reconnect and after few minutes it disconnect again. I'm using Alfa USB wireless adapter AWS036H, and my Linux version is 11 i think the driver i'm using is Realtek i searched in the Internet and i found nothing. these are some outputs of few things people usually ask for: Note: I'm NOT using a laptop. dmsg: [19445.604448] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=2.174.220.77 DST=192.168.1.6 LEN=52 TOS=0x00 PREC=0x00 TTL=104 ID=10466 DF PROTO=TCP SPT=55150 DPT=6881 WINDOW=8192 RES=0x00 SYN URGP=0 [19448.164050] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=192.168.1.254 DST=192.168.1.6 LEN=56 TOS=0x00 PREC=0x00 TTL=255 ID=41982 PROTO=ICMP TYPE=3 CODE=0 [SRC=192.168.1.6 DST=91.189.88.33 LEN=52 TOS=0x00 PREC=0x00 TTL=63 ID=7566 DF PROTO=TCP INCOMPLETE [8 bytes] ] [19465.079565] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=80.128.216.31 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=113 ID=5100 DF PROTO=TCP SPT=50169 DPT=6881 WINDOW=8192 RES=0x00 SYN URGP=0 [19486.270328] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=90.130.13.122 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=109 ID=22207 PROTO=UDP SPT=6881 DPT=6881 LEN=28 [19497.480522] wlan0: deauthenticating from 00:24:c8:4b:46:e0 by local choice (reason=3) [19497.593276] cfg80211: All devices are disconnected, going to restore regulatory settings [19497.593282] cfg80211: Restoring regulatory settings [19497.593346] cfg80211: Calling CRDA to update world regulatory domain [19497.638740] cfg80211: Updating information on frequency 2412 MHz for a 20 MHz width channel with regulatory rule: [19497.638745] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [19497.638749] cfg80211: Updating information on frequency 2417 MHz for a 20 MHz width channel with regulatory rule: [19497.638753] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [19497.638756] cfg80211: Updating information on frequency 2422 MHz for a 20 MHz width channel with regulatory rule: [19497.638760] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [19497.638763] cfg80211: Updating information on frequency 2427 MHz for a 20 MHz width channel with regulatory rule: [19497.638766] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [19497.638770] cfg80211: Updating information on frequency 2432 MHz for a 20 MHz width channel with regulatory rule: [19497.638773] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [19497.638776] cfg80211: Updating information on frequency 2437 MHz for a 20 MHz width channel with regulatory rule: [19497.638780] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [19497.638783] cfg80211: Updating information on frequency 2442 MHz for a 20 MHz width channel with regulatory rule: [19497.638787] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [19497.638790] cfg80211: Updating information on frequency 2447 MHz for a 20 MHz width channel with regulatory rule: [19497.638794] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [19497.638797] cfg80211: Updating information on frequency 2452 MHz for a 20 MHz width channel with regulatory rule: [19497.638801] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [19497.638804] cfg80211: Updating information on frequency 2457 MHz for a 20 MHz width channel with regulatory rule: [19497.638807] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [19497.638811] cfg80211: Updating information on frequency 2462 MHz for a 20 MHz width channel with regulatory rule: [19497.638814] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [19497.638817] cfg80211: Updating information on frequency 2467 MHz for a 20 MHz width channel with regulatory rule: [19497.638821] cfg80211: 2457000 KHz - 2482000 KHz @ KHz), (300 mBi, 2000 mBm) [19497.638824] cfg80211: Updating information on frequency 2472 MHz for a 20 MHz width channel with regulatory rule: [19497.638828] cfg80211: 2457000 KHz - 2482000 KHz @ KHz), (300 mBi, 2000 mBm) [19497.638831] cfg80211: Updating information on frequency 2484 MHz for a 20 MHz width channel with regulatory rule: [19497.638835] cfg80211: 2474000 KHz - 2494000 KHz @ KHz), (300 mBi, 2000 mBm) [19497.638838] cfg80211: World regulatory domain updated: [19497.638841] cfg80211: (start_freq - end_freq @ bandwidth), (max_antenna_gain, max_eirp) [19497.638845] cfg80211: (2402000 KHz - 2472000 KHz @ 40000 KHz), (300 mBi, 2000 mBm) [19497.638848] cfg80211: (2457000 KHz - 2482000 KHz @ 20000 KHz), (300 mBi, 2000 mBm) [19497.638852] cfg80211: (2474000 KHz - 2494000 KHz @ 20000 KHz), (300 mBi, 2000 mBm) [19497.638855] cfg80211: (5170000 KHz - 5250000 KHz @ 40000 KHz), (300 mBi, 2000 mBm) [19497.638859] cfg80211: (5735000 KHz - 5835000 KHz @ 40000 KHz), (300 mBi, 2000 mBm) [19513.145150] wlan0: authenticate with 00:24:c8:4b:46:e0 (try 1) [19513.146910] wlan0: authenticated [19513.252775] wlan0: associate with 00:24:c8:4b:46:e0 (try 1) [19513.255149] wlan0: RX AssocResp from 00:24:c8:4b:46:e0 (capab=0x411 status=0 aid=2) [19513.255154] wlan0: associated [19515.675091] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=91.79.8.40 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x20 TTL=110 ID=42720 DF PROTO=TCP SPT=1945 DPT=6881 WINDOW=65535 RES=0x00 SYN URGP=0 [19525.684312] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=78.13.80.169 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=109 ID=49890 DF PROTO=TCP SPT=53401 DPT=6881 WINDOW=16384 RES=0x00 SYN URGP=0 [19551.856766] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=85.228.39.93 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=103 ID=1162 PROTO=UDP SPT=6881 DPT=6881 LEN=28 [19564.623005] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=90.202.21.238 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=114 ID=17881 PROTO=UDP SPT=6881 DPT=6881 LEN=28 [19584.855364] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=2.49.151.87 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=117 ID=31716 PROTO=UDP SPT=6881 DPT=6881 LEN=28 [19604.688647] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=109.225.124.155 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=112 ID=6656 PROTO=UDP SPT=6881 DPT=6881 LEN=28 [19626.362529] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=81.184.50.41 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=114 ID=23241 DF PROTO=TCP SPT=1416 DPT=6881 WINDOW=65535 RES=0x00 SYN URGP=0 [19645.040906] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=92.250.245.244 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=51 ID=0 DF PROTO=TCP SPT=50061 DPT=6881 WINDOW=16384 RES=0x00 SYN URGP=0 [19665.212659] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=87.183.3.18 DST=192.168.1.6 LEN=52 TOS=0x00 PREC=0x00 TTL=111 ID=1689 DF PROTO=TCP SPT=62817 DPT=6881 WINDOW=8192 RES=0x00 SYN URGP=0 [19685.036415] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=78.13.80.169 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=109 ID=50638 DF PROTO=TCP SPT=49624 DPT=6881 WINDOW=16384 RES=0x00 SYN URGP=0 [19705.487915] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=217.122.17.82 DST=192.168.1.6 LEN=56 TOS=0x00 PREC=0x00 TTL=112 ID=19070 DF PROTO=TCP SPT=54795 DPT=6881 WINDOW=8192 RES=0x00 SYN URGP=0 [19726.779185] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=80.88.116.239 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=109 ID=32168 DF PROTO=TCP SPT=57330 DPT=6881 WINDOW=8192 RES=0x00 SYN URGP=0 [19744.755673] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=109.124.5.43 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=113 ID=2288 DF PROTO=TCP SPT=6475 DPT=6881 WINDOW=65535 RES=0x00 SYN URGP=0 [19764.449183] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=79.216.35.19 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=113 ID=4281 PROTO=UDP SPT=6881 DPT=6881 LEN=28 [19784.456189] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=81.82.25.149 DST=192.168.1.6 LEN=52 TOS=0x00 PREC=0x00 TTL=114 ID=1866 DF PROTO=TCP SPT=59507 DPT=6881 WINDOW=8192 RES=0x00 SYN URGP=0 [19804.836687] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=81.56.199.3 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=108 ID=14749 PROTO=UDP SPT=6881 DPT=6881 LEN=28 [19824.812685] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=186.28.7.159 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=107 ID=44686 PROTO=UDP SPT=23418 DPT=6881 LEN=28 [19847.683314] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=78.13.80.169 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=108 ID=63046 DF PROTO=TCP SPT=52192 DPT=6881 WINDOW=16384 RES=0x00 SYN URGP=0 [19884.711455] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=84.146.24.238 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=113 ID=27914 PROTO=UDP SPT=6881 DPT=6881 LEN=28 [19884.983589] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=2.107.130.61 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=112 ID=7742 PROTO=UDP SPT=6881 DPT=6881 LEN=28 [19905.681078] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=95.21.11.121 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=114 ID=31775 PROTO=UDP SPT=6881 DPT=6881 LEN=28 [19926.035707] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=109.76.132.55 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=113 ID=28140 DF PROTO=TCP SPT=51905 DPT=6881 WINDOW=8192 RES=0x00 SYN URGP=0 [19945.668326] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=188.92.0.197 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=113 ID=7865 PROTO=UDP SPT=6881 DPT=6881 LEN=28 [19967.200339] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=83.252.102.172 DST=192.168.1.6 LEN=52 TOS=0x00 PREC=0x00 TTL=105 ID=28408 DF PROTO=TCP SPT=63505 DPT=6881 WINDOW=8192 RES=0x00 SYN URGP=0 [19999.752732] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=79.166.171.200 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=110 ID=36405 PROTO=UDP SPT=6881 DPT=6881 LEN=28 [20007.928719] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=79.235.59.16 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=112 ID=46415 DF PROTO=TCP SPT=4537 DPT=6881 WINDOW=16384 RES=0x00 SYN URGP=0 [20026.181726] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=81.182.169.36 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=106 ID=25126 PROTO=UDP SPT=6881 DPT=6881 LEN=28 [20048.845358] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=87.66.118.104 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=111 ID=18068 DF PROTO=TCP SPT=49928 DPT=6881 WINDOW=8192 RES=0x00 SYN URGP=0 [20064.341857] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=77.2.63.153 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=107 ID=7242 PROTO=UDP SPT=6881 DPT=6881 LEN=28 [20090.093490] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=93.16.17.210 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=108 ID=894 PROTO=UDP SPT=6881 DPT=6881 LEN=28 [20104.443995] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=89.83.235.99 DST=192.168.1.6 LEN=52 TOS=0x00 PREC=0x00 TTL=114 ID=17295 DF PROTO=TCP SPT=58979 DPT=6881 WINDOW=8192 RES=0x00 SYN URGP=0 [20128.625374] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=81.62.91.79 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=107 ID=21793 DF PROTO=TCP SPT=51446 DPT=6881 WINDOW=8192 RES=0x00 SYN URGP=0 [20151.055506] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=84.135.217.213 DST=192.168.1.6 LEN=52 TOS=0x00 PREC=0x00 TTL=112 ID=32452 DF PROTO=TCP SPT=55136 DPT=6881 WINDOW=8192 RES=0x00 SYN URGP=0 [20164.618874] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=91.79.8.40 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x20 TTL=110 ID=47784 DF PROTO=TCP SPT=2422 DPT=6881 WINDOW=65535 RES=0x00 SYN URGP=0 [20184.337745] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=83.252.212.71 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=107 ID=14544 PROTO=UDP SPT=6881 DPT=6881 LEN=28 [20205.007512] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=91.62.158.247 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=110 ID=21562 DF PROTO=TCP SPT=3933 DPT=6881 WINDOW=65535 RES=0x00 SYN URGP=0 [20225.204018] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=84.146.24.238 DST=192.168.1.6 LEN=52 TOS=0x00 PREC=0x00 TTL=113 ID=15045 DF PROTO=TCP SPT=49630 DPT=6881 WINDOW=8192 RES=0x00 SYN URGP=0 [20244.842290] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=82.82.190.168 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=112 ID=23741 DF PROTO=TCP SPT=50766 DPT=6881 WINDOW=8192 RES=0x00 SYN URGP=0 [20266.701649] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=88.153.108.124 DST=192.168.1.6 LEN=48 TOS=0x02 PREC=0x00 TTL=111 ID=206 DF PROTO=TCP SPT=2451 DPT=6881 WINDOW=65535 RES=0x00 SYN URGP=0 [20286.305414] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=78.240.86.73 DST=192.168.1.6 LEN=52 TOS=0x00 PREC=0x00 TTL=107 ID=325 DF PROTO=TCP SPT=65184 DPT=6881 WINDOW=8192 RES=0x00 SYN URGP=0 [20294.293989] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=192.168.1.254 DST=192.168.1.6 LEN=56 TOS=0x00 PREC=0x00 TTL=255 ID=43133 PROTO=ICMP TYPE=3 CODE=0 [SRC=192.168.1.6 DST=91.189.88.33 LEN=52 TOS=0x00 PREC=0x00 TTL=63 ID=56899 DF PROTO=TCP INCOMPLETE [8 bytes] ] [20294.297015] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=192.168.1.254 DST=192.168.1.6 LEN=56 TOS=0x00 PREC=0x00 TTL=255 ID=43134 PROTO=ICMP TYPE=3 CODE=0 [SRC=192.168.1.6 DST=91.189.88.40 LEN=52 TOS=0x00 PREC=0x00 TTL=63 ID=12080 DF PROTO=TCP INCOMPLETE [8 bytes] ] [20294.297242] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=192.168.1.254 DST=192.168.1.6 LEN=56 TOS=0x00 PREC=0x00 TTL=255 ID=43135 PROTO=ICMP TYPE=3 CODE=0 [SRC=192.168.1.6 DST=91.189.88.33 LEN=52 TOS=0x00 PREC=0x00 TTL=63 ID=25195 DF PROTO=TCP INCOMPLETE [8 bytes] ] [20295.478338] wlan0: deauthenticating from 00:24:c8:4b:46:e0 by local choice (reason=3) [20295.552735] cfg80211: All devices are disconnected, going to restore regulatory settings [20295.552742] cfg80211: Restoring regulatory settings [20295.552748] cfg80211: Calling CRDA to update world regulatory domain [20295.680635] cfg80211: Updating information on frequency 2412 MHz for a 20 MHz width channel with regulatory rule: [20295.680641] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [20295.680644] cfg80211: Updating information on frequency 2417 MHz for a 20 MHz width channel with regulatory rule: [20295.680648] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [20295.680652] cfg80211: Updating information on frequency 2422 MHz for a 20 MHz width channel with regulatory rule: [20295.680655] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [20295.680658] cfg80211: Updating information on frequency 2427 MHz for a 20 MHz width channel with regulatory rule: [20295.680662] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [20295.680665] cfg80211: Updating information on frequency 2432 MHz for a 20 MHz width channel with regulatory rule: [20295.680669] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [20295.680672] cfg80211: Updating information on frequency 2437 MHz for a 20 MHz width channel with regulatory rule: [20295.680676] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [20295.680679] cfg80211: Updating information on frequency 2442 MHz for a 20 MHz width channel with regulatory rule: [20295.680683] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [20295.680687] cfg80211: Updating information on frequency 2447 MHz for a 20 MHz width channel with regulatory rule: [20295.680690] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [20295.680693] cfg80211: Updating information on frequency 2452 MHz for a 20 MHz width channel with regulatory rule: [20295.680697] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [20295.680700] cfg80211: Updating information on frequency 2457 MHz for a 20 MHz width channel with regulatory rule: [20295.680704] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [20295.680708] cfg80211: Updating information on frequency 2462 MHz for a 20 MHz width channel with regulatory rule: [20295.680711] cfg80211: 2402000 KHz - 2472000 KHz @ KHz), (300 mBi, 2000 mBm) [20295.680715] cfg80211: Updating information on frequency 2467 MHz for a 20 MHz width channel with regulatory rule: [20295.680718] cfg80211: 2457000 KHz - 2482000 KHz @ KHz), (300 mBi, 2000 mBm) [20295.680722] cfg80211: Updating information on frequency 2472 MHz for a 20 MHz width channel with regulatory rule: [20295.680725] cfg80211: 2457000 KHz - 2482000 KHz @ KHz), (300 mBi, 2000 mBm) [20295.680728] cfg80211: Updating information on frequency 2484 MHz for a 20 MHz width channel with regulatory rule: [20295.680732] cfg80211: 2474000 KHz - 2494000 KHz @ KHz), (300 mBi, 2000 mBm) [20295.680736] cfg80211: World regulatory domain updated: [20295.680738] cfg80211: (start_freq - end_freq @ bandwidth), (max_antenna_gain, max_eirp) [20295.680742] cfg80211: (2402000 KHz - 2472000 KHz @ 40000 KHz), (300 mBi, 2000 mBm) [20295.680745] cfg80211: (2457000 KHz - 2482000 KHz @ 20000 KHz), (300 mBi, 2000 mBm) [20295.680749] cfg80211: (2474000 KHz - 2494000 KHz @ 20000 KHz), (300 mBi, 2000 mBm) [20295.680752] cfg80211: (5170000 KHz - 5250000 KHz @ 40000 KHz), (300 mBi, 2000 mBm) [20295.680756] cfg80211: (5735000 KHz - 5835000 KHz @ 40000 KHz), (300 mBi, 2000 mBm) [20306.009341] wlan0: authenticate with 00:24:c8:4b:46:e0 (try 1) [20306.011225] wlan0: authenticated [20306.118095] wlan0: associate with 00:24:c8:4b:46:e0 (try 1) [20306.120963] wlan0: RX AssocResp from 00:24:c8:4b:46:e0 (capab=0x411 status=0 aid=2) [20306.120967] wlan0: associated [20307.364427] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=87.91.101.130 DST=192.168.1.6 LEN=64 TOS=0x00 PREC=0x00 TTL=49 ID=36839 DF PROTO=TCP SPT=62492 DPT=6881 WINDOW=65535 RES=0x00 SYN URGP=0 [20310.914290] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=192.168.1.254 DST=192.168.1.6 LEN=56 TOS=0x00 PREC=0x00 TTL=255 ID=43180 PROTO=ICMP TYPE=3 CODE=0 [SRC=192.168.1.6 DST=91.189.88.33 LEN=52 TOS=0x00 PREC=0x00 TTL=63 ID=56900 DF PROTO=TCP INCOMPLETE [8 bytes] ] [20310.936634] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=192.168.1.254 DST=192.168.1.6 LEN=56 TOS=0x00 PREC=0x00 TTL=255 ID=43181 PROTO=ICMP TYPE=3 CODE=0 [SRC=192.168.1.6 DST=91.189.88.40 LEN=52 TOS=0x00 PREC=0x00 TTL=63 ID=12081 DF PROTO=TCP INCOMPLETE [8 bytes] ] [20310.939017] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=192.168.1.254 DST=192.168.1.6 LEN=56 TOS=0x00 PREC=0x00 TTL=255 ID=43182 PROTO=ICMP TYPE=3 CODE=0 [SRC=192.168.1.6 DST=91.189.88.33 LEN=52 TOS=0x00 PREC=0x00 TTL=63 ID=25196 DF PROTO=TCP INCOMPLETE [8 bytes] ] [20325.941050] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=217.118.78.99 DST=192.168.1.6 LEN=48 TOS=0x00 PREC=0x00 TTL=113 ID=4407 PROTO=UDP SPT=2970 DPT=6881 LEN=28 [20328.801724] [UFW BLOCK] IN=wlan0 OUT= MAC=00:c0:ca:44:62:d1:00:24:c8:4b:46:e0:08:00 SRC=192.168.1.254 DST=192.168.1.6 LEN=56 TOS=0x00 PREC=0x00 TTL=255 ID=43196 PROTO=ICMP TYPE=3 CODE=0 [SRC=192.168.1.6 DST=91.189.88.33 LEN=52 TOS=0x00 PREC=0x00 TTL=63 ID=56901 DF PROTO=TCP INCOMPLETE [8 bytes] ] ... inxi -N Network: Card-1 Realtek RTL8101E/RTL8102E PCI Express Fast Ethernet controller driver r8169 Card-2 Realtek RTL-8139/8139C/8139C+ driver 8139too /usr/lib/linuxmint/mintWifi/mintWifi.py ------------------------- * I. scanning WIFI PCI devices... ------------------------- * II. querying ndiswrapper... ------------------------- * III. querying iwconfig... lo no wireless extensions. eth0 no wireless extensions. eth1 no wireless extensions. wlan0 IEEE 802.11bg ESSID:"Home" Mode:Managed Frequency:2.437 GHz Access Point: 00:24:C8:4B:46:E0 Bit Rate=54 Mb/s Tx-Power=20 dBm Retry long limit:7 RTS thr:off Fragment thr:off Power Management:off Link Quality=68/70 Signal level=-42 dBm Rx invalid nwid:0 Rx invalid crypt:0 Rx invalid frag:0 Tx excessive retries:0 Invalid misc:1132 Missed beacon:0 ------------------------- * IV. querying ifconfig... eth0 Link encap:Ethernet HWaddr 00:1f:d0:c9:b8:8e UP BROADCAST MULTICAST MTU:1500 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:0 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:0 (0.0 B) TX bytes:0 (0.0 B) Interrupt:43 Base address:0x4000 eth1 Link encap:Ethernet HWaddr 00:0e:2e:77:88:16 UP BROADCAST MULTICAST MTU:1500 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:0 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:0 (0.0 B) TX bytes:0 (0.0 B) Interrupt:19 Base address:0xd000 lo Link encap:Local Loopback inet addr:127.0.0.1 Mask:255.0.0.0 inet6 addr: ::1/128 Scope:Host UP LOOPBACK RUNNING MTU:16436 Metric:1 RX packets:10696 errors:0 dropped:0 overruns:0 frame:0 TX packets:10696 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:0 RX bytes:3823011 (3.8 MB) TX bytes:3823011 (3.8 MB) wlan0 Link encap:Ethernet HWaddr 00:c0:ca:44:62:d1 inet addr:192.168.1.6 Bcast:255.255.255.255 Mask:255.255.255.0 inet6 addr: fe80::2c0:caff:fe44:62d1/64 Scope:Link UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:90424 errors:0 dropped:0 overruns:0 frame:0 TX packets:65201 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:98024465 (98.0 MB) TX bytes:10345450 (10.3 MB) ------------------------- * V. querying DHCP... lspci 00:00.0 Host bridge: Intel Corporation 82G33/G31/P35/P31 Express DRAM Controller (rev 10) 00:01.0 PCI bridge: Intel Corporation 82G33/G31/P35/P31 Express PCI Express Root Port (rev 10) 00:1b.0 Audio device: Intel Corporation N10/ICH 7 Family High Definition Audio Controller (rev 01) 00:1c.0 PCI bridge: Intel Corporation N10/ICH 7 Family PCI Express Port 1 (rev 01) 00:1c.1 PCI bridge: Intel Corporation N10/ICH 7 Family PCI Express Port 2 (rev 01) 00:1d.0 USB Controller: Intel Corporation N10/ICH 7 Family USB UHCI Controller #1 (rev 01) 00:1d.1 USB Controller: Intel Corporation N10/ICH 7 Family USB UHCI Controller #2 (rev 01) 00:1d.2 USB Controller: Intel Corporation N10/ICH 7 Family USB UHCI Controller #3 (rev 01) 00:1d.3 USB Controller: Intel Corporation N10/ICH 7 Family USB UHCI Controller #4 (rev 01) 00:1d.7 USB Controller: Intel Corporation N10/ICH 7 Family USB2 EHCI Controller (rev 01) 00:1e.0 PCI bridge: Intel Corporation 82801 PCI Bridge (rev e1) 00:1f.0 ISA bridge: Intel Corporation 82801GB/GR (ICH7 Family) LPC Interface Bridge (rev 01) 00:1f.2 IDE interface: Intel Corporation N10/ICH7 Family SATA IDE Controller (rev 01) 00:1f.3 SMBus: Intel Corporation N10/ICH 7 Family SMBus Controller (rev 01) 01:00.0 VGA compatible controller: nVidia Corporation G96 [GeForce 9400 GT] (rev a1) 03:00.0 Ethernet controller: Realtek Semiconductor Co., Ltd. RTL8101E/RTL8102E PCI Express Fast Ethernet controller (rev 02) 04:01.0 Ethernet controller: Realtek Semiconductor Co., Ltd. RTL-8139/8139C/8139C+ (rev 10) lsmod Module Size Used by ipt_REJECT 12512 1 ipt_LOG 12784 5 xt_limit 12541 7 xt_tcpudp 12531 8 ipt_addrtype 12535 4 xt_state 12514 7 ip6table_filter 12711 1 ip6_tables 22545 1 ip6table_filter nf_nat_irc 12542 0 nf_conntrack_irc 13138 1 nf_nat_irc nf_nat_ftp 12548 0 nf_nat 24827 2 nf_nat_irc,nf_nat_ftp nf_conntrack_ipv4 19024 9 nf_nat nf_defrag_ipv4 12649 1 nf_conntrack_ipv4 nf_conntrack_ftp 13106 1 nf_nat_ftp nf_conntrack 69744 7 xt_state,nf_nat_irc,nf_conntrack_irc,nf_nat_ftp,nf_nat,nf_conntrack_ipv4,nf_conntrack_ftp iptable_filter 12706 1 ip_tables 18125 1 iptable_filter x_tables 21907 10 ipt_REJECT,ipt_LOG,xt_limit,xt_tcpudp,ipt_addrtype,xt_state,ip6table_filter,ip6_tables,iptable_filter,ip_tables nls_utf8 12493 10 udf 83795 1 crc_itu_t 12627 1 udf usb_storage 43946 1 uas 17676 0 snd_seq_dummy 12686 0 cryptd 19801 0 aes_i586 16956 1 aes_generic 38023 1 aes_i586 binfmt_misc 13213 1 dm_crypt 22463 0 vesafb 13449 1 nvidia 9766978 44 arc4 12473 2 rtl8187 56206 0 mac80211 257001 1 rtl8187 cfg80211 156212 2 rtl8187,mac80211 ppdev 12849 0 snd_hda_codec_realtek 255882 1 parport_pc 32111 1 psmouse 73312 0 eeprom_93cx6 12653 1 rtl8187 snd_hda_intel 24113 5 snd_hda_codec 90901 2 snd_hda_codec_realtek,snd_hda_intel snd_hwdep 13274 1 snd_hda_codec snd_pcm 80042 3 snd_hda_intel,snd_hda_codec snd_seq_midi 13132 0 snd_rawmidi 25269 1 snd_seq_midi snd_seq_midi_event 14475 1 snd_seq_midi snd_seq 51291 3 snd_seq_dummy,snd_seq_midi,snd_seq_midi_event snd_timer 28659 2 snd_pcm,snd_seq snd_seq_device 14110 4 snd_seq_dummy,snd_seq_midi,snd_rawmidi,snd_seq joydev 17322 0 snd 55295 18 snd_hda_codec_realtek,snd_hda_intel,snd_hda_codec,snd_hwdep,snd_pcm,snd_rawmidi,snd_seq,snd_timer,snd_seq_device serio_raw 12990 0 soundcore 12600 1 snd snd_page_alloc 14073 2 snd_hda_intel,snd_pcm lp 13349 0 parport 36746 3 ppdev,parport_pc,lp usbhid 41704 0 hid 77084 1 usbhid dm_raid45 88410 0 xor 21860 1 dm_raid45 btrfs 527388 0 zlib_deflate 26594 1 btrfs libcrc32c 12543 1 btrfs 8139too 23208 0 8139cp 22497 0 r8169 42534 0 floppy 60032 0

    Read the article

  • Im unable to open pdf files using kword ?! what to do?

    - by Curious Apprentice
    I have read in many places that kword can open pdf and save it in doc format ! but on ubuntu 11.10 I can not open pdf using kword as it does not showing pdf as supported files ?!!! I want a pdf to doc converter on Ubuntu 11.10. I can open pdf using libreofffice but it displaying garbled characters with over 1000+ pages for a pdf with only 15 pages. What can I do so that Kword became able to open pdf and save it to doc or odt format ??

    Read the article

< Previous Page | 43 44 45 46 47 48 49 50 51 52 53 54  | Next Page >