Search Results

Search found 48308 results on 1933 pages for 'embedded system'.

Page 481/1933 | < Previous Page | 477 478 479 480 481 482 483 484 485 486 487 488  | Next Page >

  • Upgrade from .NET 2.0 to .NET 3.5 problems

    - by Bashir Magomedov
    I’m trying to upgrade our solution from VS2005 .NET 2.0 to VS2008 .NET 3.5. I converted the solution using VS2008 conversion wizard. All the projects (about 50) remained targeting to .NET Framework 2.0., moreover if I’m changing target framework manually for one of the projects, all referenced dll (i.e. System, System.Core, System.Data, etc. are still pointing to Framework 2.0. The only way to completely change targeting framework I found is to remove these references and refer them again using proper version of framework. Doing it manually is not best choice I think. 50 projects ~ 10 references each ~ 0.5 minutes for changing each reference is about 5 hours to complete. Am I missing something? Are there any other ways of converting full solution from .NET 2.0 to .NET 3.5? Thank you.

    Read the article

  • Measuring device drivers CPU/IO utilization caused by my program

    - by Lior Kogan
    Sometimes code can utilize device drivers up to the point where the system is unresponsive. Lately I've optimized a WIN32/VC++ code which made the system almost unresponsive. The CPU usage, however, was very low. The reason was 1000's of creations and destruction of GDI objects (pens, brushes, etc.). Once I refactored the code to create all objects only once - the system became responsive again. This leads me to the question: Is there a way to measure CPU/IO usage of device drivers (GPU/disk/etc) for a given program / function / line of code?

    Read the article

  • three out of five file streams wont open, i believe its a problem with my ifstreams.

    - by user320950
    #include<iostream> #include<fstream> #include<cstdlib> #include<iomanip> using namespace std; int main() { ifstream in_stream; // reads itemlist.txt ofstream out_stream1; // writes in items.txt ifstream in_stream2; // reads pricelist.txt ofstream out_stream3;// writes in plist.txt ifstream in_stream4;// read recipt.txt ofstream out_stream5;// write display.txt int wrong=0; in_stream.open("ITEMLIST.txt", ios::in); // list of avaliable items if( in_stream.fail() )// check to see if itemlist.txt is open { wrong++; cout << " the error occured here0, you have " << wrong++ << " errors" << endl; cout << "Error opening the file\n" << endl; exit(1); } else{ cout << " System ran correctly " << endl; out_stream1.open("ITEMLIST.txt", ios::out); // list of avaliable items if(out_stream1.fail() )// check to see if itemlist.txt is open { wrong++; cout << " the error occured here1, you have " << wrong++ << " errors" << endl; cout << "Error opening the file\n"; exit(1); } else{ cout << " System ran correctly " << endl; } in_stream2.open("PRICELIST.txt", ios::in); if( in_stream2.fail() ) { wrong++; cout << " the error occured here2, you have " << wrong++ << " errors" << endl; cout << "Error opening the file\n"; exit (1); } else{ cout << " System ran correctly " << endl; } out_stream3.open("PRICELIST.txt", ios::out); if(out_stream3.fail() ) { wrong++; cout << " the error occured here3, you have " << wrong++ << " errors" << endl; cout << "Error opening the file\n"; exit (1); } else{ cout << " System ran correctly " << endl; } in_stream4.open("display.txt", ios::in); if( in_stream4.fail() ) { wrong++; cout << " the error occured here4, you have " << wrong++ << " errors" << endl; cout << "Error opening the file\n"; exit (1); } else{ cout << " System ran correctly " << endl; } out_stream5.open("display.txt", ios::out); if( out_stream5.fail() ) { wrong++; cout << " the error occured here5, you have " << wrong++ << " errors" << endl; cout << "Error opening the file\n"; exit (1); } else{ cout << " System ran correctly " << endl; }

    Read the article

  • Why my application ask for a codec to pla the MVI(.MOV) video files while i can play them on WMP and QuickTime?

    - by Daniel Lip
    I have an application i did some time ago when im loading the video file its ok when trying to play/use the file im getting the messageBox message say that its need a codec to use gspot or search the internet. Wehn im playing this files on my hard disk with Windows Media Play or either QuickTime there is no problems. The Video files for example name are: MVI_2483 in the file name properties i see its type: Quick Time Movie (.MOV) In my application im using DirectShowLib-2005.dll this is the class im using in my case to extract the video file im using it in my application to extract only lightnings from the video file name. In Form1 i have a button click event that just starting the action: private void button8_Click(object sender, EventArgs e) { viewToolStripMenuItem.Enabled = false; fileToolStripMenuItem.Enabled = false; button2.Enabled = false; label14.Visible = false; label15.Visible = false; label21.Visible = false; label22.Visible = false; label24.Visible = false; label25.Visible = false; ExtractAutomatic = true; DirectoryInfo info = new DirectoryInfo(_videoFile); string dirName = info.Name; automaticModeDirectory = dirName + "_Automatic"; subDirectoryName = _outputDir + "\\" + automaticModeDirectory; if (secondPass == true) { Start(true); } Start(false); } This is the function start in Form1: private void Start(bool secondpass) { setpicture(-1); if (Directory.Exists(_outputDir) && secondpass == false) { } else { Directory.CreateDirectory(_outputDir); } if (ExtractAutomatic == true) { string subDirectory_Automatic_Name = _outputDir + "\\" + automaticModeDirectory; Directory.CreateDirectory(subDirectory_Automatic_Name); f = new WmvAdapter(_videoFile, Path.Combine(subDirectory_Automatic_Name)); } else { string subDirectory_Manual_Name; if (Directory.Exists(subDirectoryName)) { subDirectory_Manual_Name = subDirectoryName; f = new WmvAdapter(_videoFile, Path.Combine(subDirectory_Manual_Name)); } else { subDirectory_Manual_Name = _outputDir + "\\" + averagesListTextFileDirectory + "_Manual"; Directory.CreateDirectory(subDirectory_Manual_Name); f = new WmvAdapter(_videoFile, Path.Combine(subDirectory_Manual_Name)); } } button1.Enabled = false; f.Secondpass = secondpass; f.FramesToSave = _fts; f.FrameCountAvailable += new WmvAdapter.FrameCountEventHandler(f_FrameCountAvailable); f.StatusChanged += new WmvAdapter.EventHandler(f_StatusChanged); f.ProgressChanged += new WmvAdapter.ProgressEventHandler(f_ProgressChanged); this.Text = "Processing Please Wait..."; label5.ForeColor = Color.Green; label5.Text = "Processing Please Wait"; button8.Enabled = false; button5.Enabled = false; label5.Visible = true; pictureBox1.Image = Lightnings_Extractor.Properties.Resources.Weather_Michmoret; Hrs = 0; //number of hours Min = 0; //number of Minutes Sec = 0; //number of Sec timeElapsed = 0; label10.Text = "00:00:00"; label11.Visible = false; label12.Visible = false; label9.Visible = false; label8.Visible = false; this.button1.Enabled = false; myTrackPanelss1.trackBar1.Enabled = false; this.checkBox2.Enabled = false; this.checkBox1.Enabled = false; numericUpDown1.Enabled = false; timer1.Start(); label2.Text = ""; label1.Visible = true; label2.Visible = true; label3.Visible = true; label4.Visible = true; f.Start(); } And this is the class wich is not my oqn class i just just defined it in some places wich making the problem: using System; using System.Diagnostics; using System.Drawing; using System.Drawing.Imaging; using System.IO; using System.Runtime.InteropServices; using DirectShowLib; using System.Collections.Generic; using Extracting_Frames; using System.Windows.Forms; namespace Polkan.DataSource { internal class WmvAdapter : ISampleGrabberCB, IDisposable { #region Fields_Properties_and_Events bool dis = false; int count = 0; const string fileName = @"d:\histogramValues.dat"; private IFilterGraph2 _filterGraph; private IMediaControl _mediaCtrl; private IMediaEvent _mediaEvent; private int _width; private int _height; private readonly string _outFolder; private int _frameId; //better use a custom EventHandler that passes the results of the action to the subscriber. public delegate void EventHandler(object sender, EventArgs e); public event EventHandler StatusChanged; public delegate void FrameCountEventHandler(object sender, FrameCountEventArgs e); public event FrameCountEventHandler FrameCountAvailable; public delegate void ProgressEventHandler(object sender, ProgressEventArgs e); public event ProgressEventHandler ProgressChanged; private IMediaSeeking _mSeek; private long _duration = 0; private long _avgFrameTime = 0; //just save the averages to a List (not to fs) public List<double> AveragesList { get; set; } public List<long> histogramValuesList; public bool Secondpass { get; set; } public List<int> FramesToSave { get; set; } #endregion #region Constructors and Destructors public WmvAdapter(string file, string outFolder) { _outFolder = outFolder; try { SetupGraph(file); } catch { Dispose(); MessageBox.Show("A codec is required to load this video file. Please use http://www.headbands.com/gspot/ or search the web for the correct codec"); } } ~WmvAdapter() { CloseInterfaces(); } #endregion public void Dispose() { CloseInterfaces(); } public void Start() { EstimateFrameCount(); int hr = _mediaCtrl.Run(); WaitUntilDone(); DsError.ThrowExceptionForHR(hr); } public void WaitUntilDone() { int hr; const int eAbort = unchecked((int)0x80004004); do { System.Windows.Forms.Application.DoEvents(); EventCode evCode; if (dis == true) { return; } hr = _mediaEvent.WaitForCompletion(100, out evCode); }while (hr == eAbort); DsError.ThrowExceptionForHR(hr); OnStatusChanged(); } //Edit: added events protected virtual void OnStatusChanged() { if (StatusChanged != null) StatusChanged(this, new EventArgs()); } protected virtual void OnFrameCountAvailable(long frameCount) { if (FrameCountAvailable != null) FrameCountAvailable(this, new FrameCountEventArgs() { FrameCount = frameCount }); } protected virtual void OnProgressChanged(int frameID) { if (ProgressChanged != null) ProgressChanged(this, new ProgressEventArgs() { FrameID = frameID }); } /// <summary> build the capture graph for grabber. </summary> private void SetupGraph(string file) { ISampleGrabber sampGrabber = null; IBaseFilter capFilter = null; IBaseFilter nullrenderer = null; _filterGraph = (IFilterGraph2)new FilterGraph(); _mediaCtrl = (IMediaControl)_filterGraph; _mediaEvent = (IMediaEvent)_filterGraph; _mSeek = (IMediaSeeking)_filterGraph; var mediaFilt = (IMediaFilter)_filterGraph; try { // Add the video source int hr = _filterGraph.AddSourceFilter(file, "Ds.NET FileFilter", out capFilter); DsError.ThrowExceptionForHR(hr); // Get the SampleGrabber interface sampGrabber = new SampleGrabber() as ISampleGrabber; var baseGrabFlt = sampGrabber as IBaseFilter; ConfigureSampleGrabber(sampGrabber); // Add the frame grabber to the graph hr = _filterGraph.AddFilter(baseGrabFlt, "Ds.NET Grabber"); DsError.ThrowExceptionForHR(hr); // --------------------------------- // Connect the file filter to the sample grabber // Hopefully this will be the video pin, we could check by reading it's mediatype IPin iPinOut = DsFindPin.ByDirection(capFilter, PinDirection.Output, 0); // Get the input pin from the sample grabber IPin iPinIn = DsFindPin.ByDirection(baseGrabFlt, PinDirection.Input, 0); hr = _filterGraph.Connect(iPinOut, iPinIn); DsError.ThrowExceptionForHR(hr); // Add the null renderer to the graph nullrenderer = new NullRenderer() as IBaseFilter; hr = _filterGraph.AddFilter(nullrenderer, "Null renderer"); DsError.ThrowExceptionForHR(hr); // --------------------------------- // Connect the sample grabber to the null renderer iPinOut = DsFindPin.ByDirection(baseGrabFlt, PinDirection.Output, 0); iPinIn = DsFindPin.ByDirection(nullrenderer, PinDirection.Input, 0); hr = _filterGraph.Connect(iPinOut, iPinIn); DsError.ThrowExceptionForHR(hr); // Turn off the clock. This causes the frames to be sent // thru the graph as fast as possible hr = mediaFilt.SetSyncSource(null); DsError.ThrowExceptionForHR(hr); // Read and cache the image sizes SaveSizeInfo(sampGrabber); //Edit: get the duration hr = _mSeek.GetDuration(out _duration); DsError.ThrowExceptionForHR(hr); } finally { if (capFilter != null) { Marshal.ReleaseComObject(capFilter); } if (sampGrabber != null) { Marshal.ReleaseComObject(sampGrabber); } if (nullrenderer != null) { Marshal.ReleaseComObject(nullrenderer); } GC.Collect(); } } private void EstimateFrameCount() { try { //1sec / averageFrameTime double fr = 10000000.0 / _avgFrameTime; double frameCount = fr * (_duration / 10000000.0); OnFrameCountAvailable((long)frameCount); } catch { } } public double framesCounts() { double fr = 10000000.0 / _avgFrameTime; double frameCount = fr * (_duration / 10000000.0); return frameCount; } private void SaveSizeInfo(ISampleGrabber sampGrabber) { // Get the media type from the SampleGrabber var media = new AMMediaType(); int hr = sampGrabber.GetConnectedMediaType(media); DsError.ThrowExceptionForHR(hr); if ((media.formatType != FormatType.VideoInfo) || (media.formatPtr == IntPtr.Zero)) { throw new NotSupportedException("Unknown Grabber Media Format"); } // Grab the size info var videoInfoHeader = (VideoInfoHeader)Marshal.PtrToStructure(media.formatPtr, typeof(VideoInfoHeader)); _width = videoInfoHeader.BmiHeader.Width; _height = videoInfoHeader.BmiHeader.Height; //Edit: get framerate _avgFrameTime = videoInfoHeader.AvgTimePerFrame; DsUtils.FreeAMMediaType(media); GC.Collect(); } private void ConfigureSampleGrabber(ISampleGrabber sampGrabber) { var media = new AMMediaType { majorType = MediaType.Video, subType = MediaSubType.RGB24, formatType = FormatType.VideoInfo }; int hr = sampGrabber.SetMediaType(media); DsError.ThrowExceptionForHR(hr); DsUtils.FreeAMMediaType(media); GC.Collect(); hr = sampGrabber.SetCallback(this, 1); DsError.ThrowExceptionForHR(hr); } private void CloseInterfaces() { try { if (_mediaCtrl != null) { _mediaCtrl.Stop(); _mediaCtrl = null; dis = true; } } catch (Exception ex) { Debug.WriteLine(ex); } if (_filterGraph != null) { Marshal.ReleaseComObject(_filterGraph); _filterGraph = null; } GC.Collect(); } int ISampleGrabberCB.SampleCB(double sampleTime, IMediaSample pSample) { Marshal.ReleaseComObject(pSample); return 0; } int ISampleGrabberCB.BufferCB(double sampleTime, IntPtr pBuffer, int bufferLen) { if (Form1.ExtractAutomatic == true) { using (var bitmap = new Bitmap(_width, _height, _width * 3, PixelFormat.Format24bppRgb, pBuffer)) { if (!this.Secondpass) { long[] HistogramValues = Form1.GetHistogram(bitmap); long t = Form1.GetTopLumAmount(HistogramValues, 1000); Form1.averagesTest.Add(t); } else { //this is the changed part if (_frameId > 0) { if (Form1.averagesTest[_frameId] / 1000.0 - Form1.averagesTest[_frameId - 1] / 1000.0 > 150.0) { count = 6; } if (count > 0) { bitmap.RotateFlip(RotateFlipType.Rotate180FlipX); bitmap.Save(Path.Combine(_outFolder, _frameId.ToString("D6") + ".bmp")); count --; } } } _frameId++; //let only report each 100 frames for performance if (_frameId % 100 == 0) OnProgressChanged(_frameId); } } else { using (var bitmap = new Bitmap(_width, _height, _width * 3, PixelFormat.Format24bppRgb, pBuffer)) { if (!this.Secondpass) { //get avg double average = GetAveragePixelValue(bitmap); if (AveragesList == null) AveragesList = new List<double>(); //save avg AveragesList.Add(average); //***************************\\ // for (int i = 0; i < (int)framesCounts(); i++) // { // get histogram values long[] HistogramValues = Form1.GetHistogram(bitmap); if (histogramValuesList == null) histogramValuesList = new List<long>(256); histogramValuesList.AddRange(HistogramValues); //***************************\\ //} } else { if (FramesToSave != null && FramesToSave.Contains(_frameId)) { bitmap.RotateFlip(RotateFlipType.Rotate180FlipX); bitmap.Save(Path.Combine(_outFolder, _frameId.ToString("D6") + ".bmp")); // get histogram values long[] HistogramValues = Form1.GetHistogram(bitmap); if (histogramValuesList == null) histogramValuesList = new List<long>(256); histogramValuesList.AddRange(HistogramValues); using (BinaryWriter binWriter = new BinaryWriter(File.Open(fileName, FileMode.Create))) { for (int i = 0; i < histogramValuesList.Count; i++) { binWriter.Write(histogramValuesList[(int)i]); } binWriter.Close(); } } } _frameId++; //let only report each 100 frames for performance if (_frameId % 100 == 0) OnProgressChanged(_frameId); } } return 0; } /* int ISampleGrabberCB.SampleCB(double sampleTime, IMediaSample pSample) { Marshal.ReleaseComObject(pSample); return 0; } int ISampleGrabberCB.BufferCB(double sampleTime, IntPtr pBuffer, int bufferLen) { using (var bitmap = new Bitmap(_width, _height, _width * 3, PixelFormat.Format24bppRgb, pBuffer)) { if (!this.Secondpass) { //get avg double average = GetAveragePixelValue(bitmap); if (AveragesList == null) AveragesList = new List<double>(); //save avg AveragesList.Add(average); //***************************\\ // for (int i = 0; i < (int)framesCounts(); i++) // { // get histogram values long[] HistogramValues = Form1.GetHistogram(bitmap); if (histogramValuesList == null) histogramValuesList = new List<long>(256); histogramValuesList.AddRange(HistogramValues); long t = Form1.GetTopLumAmount(HistogramValues, 1000); //***************************\\ Form1.averagesTest.Add(t); // to add this list to a text file or binary file and read the averages from the file when its is Secondpass !!!!! //} } else { if (FramesToSave != null && FramesToSave.Contains(_frameId)) { bitmap.RotateFlip(RotateFlipType.Rotate180FlipX); bitmap.Save(Path.Combine(_outFolder, _frameId.ToString("D6") + ".bmp")); // get histogram values long[] HistogramValues = Form1.GetHistogram(bitmap); if (histogramValuesList == null) histogramValuesList = new List<long>(256); histogramValuesList.AddRange(HistogramValues); using (BinaryWriter binWriter = new BinaryWriter(File.Open(fileName, FileMode.Create))) { for (int i = 0; i < histogramValuesList.Count; i++) { binWriter.Write(histogramValuesList[(int)i]); } binWriter.Close(); } } for (int x = 1; x < Form1.averagesTest.Count; x++) { double fff = Form1.averagesTest[x] / 1000.0 - Form1.averagesTest[x - 1] / 1000.0; if (Form1.averagesTest[x] / 1000.0 - Form1.averagesTest[x - 1] / 1000.0 > 180.0) { bitmap.RotateFlip(RotateFlipType.Rotate180FlipX); bitmap.Save(Path.Combine(_outFolder, _frameId.ToString("D6") + ".bmp")); _frameId++; } } } _frameId++; //let only report each 100 frames for performance if (_frameId % 100 == 0) OnProgressChanged(_frameId); } return 0; }*/ private unsafe double GetAveragePixelValue(Bitmap bmp) { BitmapData bmData = null; try { bmData = bmp.LockBits(new Rectangle(0, 0, bmp.Width, bmp.Height), ImageLockMode.ReadOnly, PixelFormat.Format24bppRgb); int stride = bmData.Stride; IntPtr scan0 = bmData.Scan0; int w = bmData.Width; int h = bmData.Height; double sum = 0; long pixels = bmp.Width * bmp.Height; byte* p = (byte*)scan0.ToPointer(); for (int y = 0; y < h; y++) { p = (byte*)scan0.ToPointer(); p += y * stride; for (int x = 0; x < w; x++) { double i = ((double)p[0] + p[1] + p[2]) / 3.0; sum += i; p += 3; } //no offset incrementation needed when getting //the pointer at the start of each row } bmp.UnlockBits(bmData); double result = sum / (double)pixels; return result; } catch { try { bmp.UnlockBits(bmData); } catch { } } return -1; } } public class FrameCountEventArgs { public long FrameCount { get; set; } } public class ProgressEventArgs { public int FrameID { get; set; } } } I remember i had this codec problem/s before and i installed the codec/'s that were needed but in this case both quick time and windows media player can play the video files so why the application cant detect and find the codec/'s on my computer ? Gspot say that the codec is AVC1 but again wmp and quicktime play the video files no problems. The video files are from my digital camera !

    Read the article

  • Chrome won't start - Windows 7 x64 is complaining about compatibility

    - by WooYek
    Suddenly Chrome browser does not start, my Windows 7 x64 is complaining: The version of this file is not compatible with the version of Windows you’re running. Check your computer’s system information to see whether you need an x86 (32-bit) or x64 (64-bit) version of the program, and then contact the software publisher. Reinstalling did not help. The things that changed and I have noticed are system updates and Java update. Any ideas, what to do to resolve the issue or troubleshoot it?

    Read the article

  • Build Systems for PHP Web Apps

    - by macinjosh
    I want to start automating more of my web development process so I'm looking for a build system. I write mostly PHP apps on Mac OS X and deploy Linux servers over FTP. A lot of my clients have basic hosting providers so shell access to their servers is typically not available, however remote MySQL access is usually present. Here is what I want to do with a build system: When Building: Lint JavaScript Files Validate CSS Files Validate HTML Files Minify and concatenate JS and CSS files Verify PHP Syntax Set Debug/Production flags When Deploying Checkout latest version from SVN Run build process Upload files to server via FTP Run SQL scripts on remote DB I realize this is a lot of work to automate but I think it would be worth it. So what is the best way to start down this path? Is there a system that can handle builds and deploys, or should I search for separate solutions? What systems would you recommend?

    Read the article

  • Access Violation

    - by Justin
    I've been learning how to NOP functions in C++ or even C but there are very few tutorials online about it. I've been googling for the past few hours now and I'm just stuck. Here is my code. #include <iostream> #include <windows.h> #include <tlhelp32.h> using namespace std; //#define NOP 0x90 byte NOP[] = {0x90}; void enableDebugPrivileges() { HANDLE hcurrent=GetCurrentProcess(); HANDLE hToken; BOOL bret=OpenProcessToken(hcurrent,40,&hToken); LUID luid; bret=LookupPrivilegeValue(NULL,"SeDebugPrivilege",&luid); TOKEN_PRIVILEGES NewState,PreviousState; DWORD ReturnLength; NewState.PrivilegeCount =1; NewState.Privileges[0].Luid =luid; NewState.Privileges[0].Attributes=2; AdjustTokenPrivileges(hToken,FALSE,&NewState,28,&PreviousState,&ReturnLength); } DWORD GetProcId(char* ProcName) { PROCESSENTRY32 pe32; HANDLE hSnapshot = NULL; pe32.dwSize = sizeof( PROCESSENTRY32 ); hSnapshot = CreateToolhelp32Snapshot( TH32CS_SNAPPROCESS, 0 ); if( Process32First( hSnapshot, &pe32 ) ) { do{ if( strcmp( pe32.szExeFile, ProcName ) == 0 ) break; }while( Process32Next( hSnapshot, &pe32 ) ); } if( hSnapshot != INVALID_HANDLE_VALUE ) CloseHandle( hSnapshot ); return pe32.th32ProcessID; } void WriteMem(DWORD Address, void* Value, size_t Size) { DWORD Protect = NULL; VirtualProtect((LPVOID)Address, 3, PAGE_READWRITE, &Protect); memcpy((void*)Address, Value, 3); VirtualProtect((LPVOID)Address, 3, Protect, &Protect); } void nop_(PVOID address, int bytes){ DWORD d, ds; VirtualProtect(address, bytes, PAGE_EXECUTE_READWRITE, &d); memset(address, 144, bytes); VirtualProtect(address,bytes,d,&ds); } void MemCopy(HANDLE pHandle, void* Dest, const void* Src, int Len) { DWORD OldProtect; DWORD OldProtect2; VirtualProtect(Dest, Len, PAGE_EXECUTE_READWRITE, &OldProtect); memcpy(Dest, Src, Len); VirtualProtect(Dest, Len, OldProtect, &OldProtect2); FlushInstructionCache(pHandle, Dest, Len); } int main() { enableDebugPrivileges(); DWORD pid; HANDLE phandle; // Obtain the process ID pid = GetProcId("gr.exe"); if(GetLastError()) { cout << "Error_PID_: " << GetLastError() << endl; system("pause"); return -1; } // Obtain the process handle phandle = OpenProcess(PROCESS_ALL_ACCESS,0,pid); if(GetLastError()) { cout << "Error_HANDLE_: " << GetLastError() << endl; system("pause"); return -1; } // Debug info, 0 = bad cout <<"pid : " << pid << endl; cout <<"HANDLE: " << phandle << endl << endl; system("pause"); // Change value to short iValue = -1; int choice = 0; BYTE * bGodMode = (BYTE *) (0x409A7E); // Lives Address bool hack = true; while(hack) { system("cls"); cout << "What hack?\n0. Exit\n1. Lives\n\n!> "; cin >> choice; switch(choice) { case 0: { hack=false; break; } case 1: // Modify Time cout << "God Mode On\n!> "; // cin >> iValue; // nop_((PVOID)(0x409A7E), 3); // MemCopy(phandle, (PVOID)0x409A7E, &NOP, 1); WriteMem((DWORD)(0x00409A7E), (void*)NOP, sizeof NOP); if(GetLastError()) { cout << "Error: " << GetLastError() << endl; system("pause"); } break; default: cout << "ERROR!\n"; break; } Sleep(100); } system("pause"); return 0; } This is suppose to NOP the DEC function that is 3 bytes long preventing me from losing lives. However each time I try it, it crashes the hack and says I had a access violation. I tried to look up the reasons and most of them dealt with with the size of the location I'm writing to and what I'm copying from. Otherwise, I have absolutely no idea. Any help would be nice. The game is GunRoar and the base address "0x409A7E" is where the DEC function is.

    Read the article

  • Trying to create text boxes dynammically and remove them

    - by fari
    I am using VB.NET vb 2008 . I am trying to create text boxes dynammically and remove them here is the code i have written so far Private Sub setTextBox() Dim num As Integer Dim pos As Integer num = Len(word) temp = String.Copy(word) Dim intcount As Integer remove() GuessBox.Visible = True letters.Visible = True pos = 0 'To create the dynamic text box and add the controls For intcount = 0 To num - 1 Txtdynamic = New TextBox Txtdynamic.Width = 20 Txtdynamic.Visible = True Txtdynamic.MaxLength = 1 Txtdynamic.Location = New Point(pos + 5, 0) pos = pos + 30 'set the font size Txtdynamic.Font = New System.Drawing.Font("Verdana", 8.25!, System.Drawing.FontStyle.Regular, System.Drawing.GraphicsUnit.Point, CType(0, Byte)) Txtdynamic.Name = "txtdynamic_" & intcount & "_mycntrl" Txtdynamic.Enabled = False Txtdynamic.Text = "" Panel1.Controls.Add(Txtdynamic) Next Panel1.Visible = True Controls.Add(Panel1) Controls.Add(GuessBox) Controls.Add(letters) letter = "" letters.Text = "" hang_lable.Text = "" tries = 0 End Sub`enter code here` Function remove() For Each ctrl In Panel1.Controls Panel1.Controls.Remove(ctrl) Next End Function I am able to create the textboxes but only a few of them are removed. by using For Each ctrl In Panel1.Controls it doesn't retrieve all the controls and some ae duplicated as well.

    Read the article

  • Why its not working?

    - by Andrew Hoffmann
    BinaryReader br = new BinaryReader(Console.OpenStandardInput()); BinaryWriter bw = new BinaryWriter(Console.OpenStandardOutput()); int n = br.ReadInt32(); bw.Write(n); always getting this error: Unhandled Exception: System.IO.EndOfStreamException: Failed to read past end of stream. at System.IO.BinaryReader.FillBuffer (Int32 numBytes) [0x00000] in <filename unknown>:0 at System.IO.BinaryReader.ReadInt32 () [0x00000] in <filename unknown>:0 at Program.Main () [0x00025] in /home/skydos/ACM/Csharp/Csharp/Main.cs:24 Is there any way to make reading data in C# faster from Console?

    Read the article

  • How can I verify the integrity of a WAN connection?

    - by Nic Waller
    We have two scanners in our branch office which upload images to the head office via FTP. In the last week, both scanners have started delivering a lot of corrupted images. I suspect that the problem may be with the WAN link, and that TCP might not be detecting/correcting all errors. Is there any software for Windows that allows me to test the integrity of the connection by sending packets with an embedded CRC?

    Read the article

  • Tomcat not showing Spring Context initialization errors when running from Eclipse WTP

    - by SourceRebels
    Hi all, Im working with Eclipse Galileo (WTP), Spring 2.5.6-SEC01 and Apache Tomcat 5.5.28. When I run my application from Eclipse, I'm able to see Tomcat standard output and error from the console view. When there is a Spring initialization error (ex: malformed spring XML) I'm not able to see the error message or the stacktrace at the Console view. Anyone found before a problem like this? how you solve it? Thanks in advance, I'm getting mad :-) Edited: I'm seeing all Tomcat startup messages and my System.out.println and System.err.println messages in Eclipse Console. I also try to pass this two system properties to my Tomcat Server: -Djava.util.logging.manager="org.apache.juli.ClassLoaderLogManager" -Djava.util.logging.config.file="C:\apache-tomcat-5.5.28\conf\logging.properties"

    Read the article

  • ASP.NET: Turning on errors

    - by JamesBrownIsDead
    This is what I see when I visit my web site. How do I instead get the Yellow Screen of Death so I know what the error is? I have GoDaddy shared hosting and I think the problem is that I don't have the correct MVC binaries in the /bin folder. My web.config shows this: <add assembly="System.Web.Mvc, Version=2.0.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> <add assembly="System.Web.Abstractions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> <add assembly="System.Web.Routing, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> But I'm not positive I copied the right .DLL files into /bin. I've got like 8 of each file--which version is which?!

    Read the article

  • Why do some games randomly turn my screen a random solid color?

    - by Emlena.PhD
    When playing some games my computer will randomly have an error that I cannot fix without turning it off and back on again. The screen changes to one solid color, which varies (off the top of my head I can remember seeing solid green, magenta, etc..) and the sound blares a single tone. The sound sometimes briefly restores and I can still hear the game sounds and even hear and still be heard by people in my Mumble channel, but the screen doesn't right itself so I'm still blind. What's more is this happens in some games but not in others. While the game is actually running, not while I'm still in the menu. However, it does happen if I'm afk or idle but the game world is still rendering. Games where the error occurs: League of Legends World of Warcraft Trine The Sims 2 Dungeon Defenders Safe games: games where it has never occurred: Tribes: Ascend Star Wars: the Old Republic Battlefield 3 So relatively older games cause the problem while newer games do not? I cannot predict when it will happen, it just seems random. However, if it happens and I try playing the same game further after restart it does appear to occur more frequently after the first time. But if I switch to a safe game it doesn't continue happening. Both of my RAM sticks appear fine, flipped position or either one on their own and games still run, computer still boots. I would think over-heating, but then why not all games? ALso, sometimes it happens immediately after I start playing, within seconds of the 3D world booting up. I'm looking to upgrade very soon so I want to figure out what component or software is fubar and replace/repair it. Any suggestions or recommendations of tools would be helpful. Below is some system information. Dxdiag does not detect any problems. Operating System: Windows 7 Home Premium 64-bit (6.1, Build 7601) Service Pack 1 (7601.win7sp1_gdr.120305-1505) System Manufacturer: Gigabyte Technology Co., Ltd. System Model: EP45-UD3R BIOS: Award Modular BIOS v6.00PG Processor: Intel(R) Core(TM)2 Duo CPU E8500 @ 3.16GHz (2 CPUs), ~3.2GHz Memory: 4096MB RAM DirectX Version: DirectX 11 DxDiag Version: 6.01.7601.17514 64bit Unicode Graphics card name: NVIDIA GeForce GTX 285 Driver Version: 8.17.12.9610 (error has occurred w/several driver versions) Sound: I do not have a sound card, been using motherboard's built in sound)

    Read the article

  • Using the stadard Java logging, is it possible to restart logs after a certain period?

    - by Fry
    I have some java code that will be running as an importer for data for a much larger project. The initial logging code was done with the java.util.logging classes, so I'd like to keep it if possible, but it seems to be a little inadequate now given he amount of data passing through the importer. Often times in the system, the importer will get data that the main system doesn't have information for or doesn't match the system's data so it is ignored but a message is written to the log about what information was dropped and why it wasn't imported. The problem is that this tends to grow in size very quickly, so we'd like to be able to start a fresh log daily or weekly. Does anybody have an idea if this can be done in the logging classes or would I have to switch to log4j or custom? Thanks for any help!

    Read the article

  • How to delete a file with a space at end of the name and hidden attributes?

    - by Dr. Zim
    We have a hidden file with a space at the end of the file name. Usually, I take ownership of the file, then use a command line rename with the 8.3 (dir/x) file name. However, rename doesn't acknowledge hidden or system files. Any ideas on how to remove it? The original creator cannot access the file. The system is a Windows 2003 server with NTFS and SMB file sharing (normal windows file sharing).

    Read the article

  • BlackBerry - Exception with null message when sending sms using Connector

    - by vikram deshpande
    I used code given but I am getting "IOCancelledException" and "IOException". And IOCancelledException.getMessage() / IOException.getMessage() giving null string, it does not give error message. Please help me understaing reason. class SMSThread extends Thread { Thread myThread; MessageConnection msgConn; String message; String mobilenumber; public SMSThread(String textMsg, String mobileNumber) { message = textMsg; mobilenumber = mobileNumber; } public void run() { try { msgConn = (MessageConnection) Connector.open("sms://+" + mobilenumber); TextMessage text = (TextMessage) msgConn .newMessage(MessageConnection.TEXT_MESSAGE); text.setPayloadText(message); msgConn.send(text); msgConn.close(); } catch (IOCancelledException ioce) { System.out .println("IOCancelledException: " + ioce.getMessage()); } catch (IOException ioe) { System.out.println("IOException: " + ioe.getMessage()); } catch (Exception e) { System.out.println("Exception: " + e); } } }

    Read the article

  • Technet and trying to install Windows Server 2008 R2

    - by Simon E
    I'm a bit new to Technet and just trying to work my way round things. Firstly I want to install Windows Server 2008 R2 as I believe this is the latest edition - however when I look to download it from Technet, it will only allow me to download the Windows Automated Installation Kit. Does this have Windows Server 2008 R2 embedded in WAIK or is there some other extra step to do? Or am I just doing this all wrong :)

    Read the article

  • Routing and Remote Access Service won't start after full disk

    - by NKCSS
    The HDD of the server was out of disk space, and after a reboot, RRAS won't start anymore on my 2008 R2 server. Error Details: Log Name: System Source: RemoteAccess Date: 2/5/2012 9:39:52 PM Event ID: 20153 Task Category: None Level: Error Keywords: Classic User: N/A Computer: Windows14111.<snip> Description: The currently configured accounting provider failed to load and initialize successfully. The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error. Event Xml: <Event xmlns="http://schemas.microsoft.com/win/2004/08/events/event"> <System> <Provider Name="RemoteAccess" /> <EventID Qualifiers="0">20153</EventID> <Level>2</Level> <Task>0</Task> <Keywords>0x80000000000000</Keywords> <TimeCreated SystemTime="2012-02-05T20:39:52.000Z" /> <EventRecordID>12148869</EventRecordID> <Channel>System</Channel> <Computer>Windows14111.<snip></Computer> <Security /> </System> <EventData> <Data>The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error.</Data> <Binary>2C030000</Binary> </EventData> </Event> I think it has something to do with a corrupt config file, but I am unsure of what to do. I Removed the RRAS role, rebooted, and re-added, but it keeps failing with the same error. Thanks in advance. [UPDATE] If i set the accounting provider from 'Windows' to '' the service starts but VPN won't work. Any ideas how this can be repaired?

    Read the article

  • Windows 7 boot problem

    - by nijikunai
    My system doesn't boot at all, upon starting it takes me to the Windows Error Recovery screen saying "Windows failed to start, a recent software or hardware change might be the cause" and gives two options Launch System Repair (Recommended) Start Windows normally But neither options work, upon clicking either of them, some progress bars get displayed and the screen just freezes on "Starting Windows". I tried booting from the Windows 7 disk but it too freezes on the "Starting Windows" screen. I even tried booting from ubuntu, slax linux, but they don't work too.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Can't Use Path in ASP MVC Action

    - by user1477388
    I am trying to use Path() but it has a blue line under it and says, "local variable (path) cannot be referred to until it is declared." How can I use Path()? Imports System.Globalization Imports System.IO Public Class MessageController Inherits System.Web.Mvc.Controller <EmployeeAuthorize()> <HttpPost()> Function SendReply(ByVal id As Integer, ByVal message As String, ByVal files As IEnumerable(Of HttpPostedFileBase)) As JsonResult ' upload files For Each i In files If (i.ContentLength > 0) Then Dim fileName = path.GetFileName(i.FileName) Dim path = path.Combine(Server.MapPath("~/App_Data/uploads"), fileName) i.SaveAs(path) End If Next End Function End Class

    Read the article

< Previous Page | 477 478 479 480 481 482 483 484 485 486 487 488  | Next Page >