Search Results

Search found 48308 results on 1933 pages for 'embedded system'.

Page 483/1933 | < Previous Page | 479 480 481 482 483 484 485 486 487 488 489 490  | Next Page >

  • Agile Approach for WCM

    - by cameron.f.logan
    Can anyone provide me with advice, opinions, or experience with using an agile methodology to delivery an enterprise-scale Web Content Management system (e.g., Interwoven TeamSite, Tridion)? My current opinion is that to implement a CM system there is a certain--relatively high--amount of upfront work that needs to happen to make sure the system is going to be scalable and efficient for future projects for the multi-year lifespan an WCM is expected to have. This suggests a hybrid approach at best, if not a more waterfall-like approach. I'm really interested to learn what approaches others have taken. Thanks.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Sending the files (At least 11 files) from folder through web service to android app.

    - by Shashank_Itmaster
    Hello All, I stuck in middle of this situation,Please help me out. My question is that I want to send files (Total 11 PDF Files) to android app using web service. I tried it with below code.Main Class from which web service is created public class MultipleFilesImpl implements MultipleFiles { public FileData[] sendPDFs() { FileData fileData = null; // List<FileData> filesDetails = new ArrayList<FileData>(); File fileFolder = new File( "C:/eclipse/workspace/AIPWebService/src/pdfs/"); // File fileTwo = new File( // "C:/eclipse/workspace/AIPWebService/src/simple.pdf"); File sendFiles[] = fileFolder.listFiles(); // sendFiles[0] = fileOne; // sendFiles[1] = fileTwo; DataHandler handler = null; char[] readLine = null; byte[] data = null; int offset = 0; int numRead = 0; InputStream stream = null; FileOutputStream outputStream = null; FileData[] filesData = null; try { System.out.println("Web Service Called Successfully"); for (int i = 0; i < sendFiles.length; i++) { handler = new DataHandler(new FileDataSource(sendFiles[i])); fileData = new FileData(); data = new byte[(int) sendFiles[i].length()]; stream = handler.getInputStream(); while (offset < data.length && (numRead = stream.read(data, offset, data.length - offset)) >= 0) { offset += numRead; } readLine = Base64Coder.encode(data); offset = 0; numRead = 0; System.out.println("'Reading File............................"); System.out.println("\n"); System.out.println(readLine); System.out.println("Data Reading Successful"); fileData.setFileName(sendFiles[i].getName()); fileData.setFileData(String.valueOf(readLine)); readLine = null; System.out.println("Data from bean " + fileData.getFileData()); outputStream = new FileOutputStream("D:/" + sendFiles[i].getName()); outputStream.write(Base64Coder.decode(fileData.getFileData())); outputStream.flush(); outputStream.close(); stream.close(); // FileData fileDetails = new FileData(); // fileDetails = fileData; // filesDetails.add(fileData); filesData = new FileData[(int) sendFiles[i].length()]; } // return fileData; } catch (FileNotFoundException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (Exception e) { e.printStackTrace(); } return filesData; } } Also The Interface MultipleFiles:- public interface MultipleFiles extends Remote { public FileData[] sendPDFs() throws FileNotFoundException, IOException, Exception; } Here I am sending an array of bean "File Data",having properties viz. FileData & FileName. FileData- contains file data in encoded. FileName- encoded file name. The Bean:- (FileData) public class FileData { private String fileName; private String fileData; public String getFileName() { return fileName; } public void setFileName(String fileName) { this.fileName = fileName; } public String getFileData() { return fileData; } public void setFileData(String string) { this.fileData = string; } } The android DDMS gives out of memory exception when tried below code & when i tried to send two files then only first file is created. public class PDFActivity extends Activity { private final String METHOD_NAME = "sendPDFs"; private final String NAMESPACE = "http://webservice.uks.com/"; private final String SOAP_ACTION = NAMESPACE + METHOD_NAME; private final String URL = "http://192.168.1.123:8080/AIPWebService/services/MultipleFilesImpl"; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); TextView textViewOne = (TextView) findViewById(R.id.textViewOne); try { SoapObject soapObject = new SoapObject(NAMESPACE, METHOD_NAME); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope( SoapEnvelope.VER11); envelope.setOutputSoapObject(soapObject); textViewOne.setText("Web Service Started"); AndroidHttpTransport httpTransport = new AndroidHttpTransport(URL); httpTransport.call(SOAP_ACTION, envelope); // SoapObject result = (SoapObject) envelope.getResponse(); Object result = envelope.getResponse(); Log.i("Result", result.toString()); // String fileName = result.getProperty("fileName").toString(); // String fileData = result.getProperty("fileData").toString(); // Log.i("File Name", fileName); // Log.i("File Data", fileData); // File pdfFile = new File(fileName); // FileOutputStream outputStream = // openFileOutput(pdfFile.toString(), // MODE_PRIVATE); // outputStream.write(Base64Coder.decode(fileData)); Log.i("File", "File Created"); // textViewTwo.setText(result); // Object result = envelope.getResponse(); // FileOutputStream outputStream = openFileOutput(name, mode) } catch (Exception e) { e.printStackTrace(); } } } Please help with some explanation or changes in my code. Thanks in Advance.

    Read the article

  • ASP.net error message when using REST starter kit

    - by jonhobbs
    Hi all, I've written some code using the REST starter kit and it works fine on my development machine. However, when I upload it to our server the page gives me the following error message... CS1684: Warning as Error: Reference to type 'System.Runtime.Serialization.Json.DataContractJsonSerializer' claims it is defined in 'c:\WINNT\assembly\GAC_MSIL\System.ServiceModel.Web\3.5.0.0__31bf3856ad364e35\System.ServiceModel.Web.dll', but it could not be found I've removed code line by line and it appears that the following line of code is triggering the error... HttpContent newOrganizationContent = HttpContentExtensions.CreateXmlSerializable(newOrganizationXml); Really haven't got a clue how to fix it. I assumed it might be because it needs a newer version of the framework to run, but looking in IIS it says it's running version 2.0.50727 which I think is the lates version because it says that even when we're using framework 3.5 Very confused, any ideas? Jon

    Read the article

  • Lookahead regex produces unexpected group

    - by Ivan Yatskevich
    I'm trying to extract a page name and query string from a URL which should not contain .html Here is an example code in Java: public class TestRegex { public static void main(String[] args) { Pattern pattern = Pattern.compile("/test/(((?!\\.html).)+)\\?(.+)"); Matcher matcher = pattern.matcher("/test/page?param=value"); System.out.println(matcher.matches()); System.out.println(matcher.group(1)); System.out.println(matcher.group(2)); } } By running this code one can get the following output: true page e What's wrong with my regex so the second group contains the letter e instead of param=value?

    Read the article

  • BlackBerry - Exception with null message when sending sms using Connector

    - by vikram deshpande
    I used code given but I am getting "IOCancelledException" and "IOException". And IOCancelledException.getMessage() / IOException.getMessage() giving null string, it does not give error message. Please help me understaing reason. class SMSThread extends Thread { Thread myThread; MessageConnection msgConn; String message; String mobilenumber; public SMSThread(String textMsg, String mobileNumber) { message = textMsg; mobilenumber = mobileNumber; } public void run() { try { msgConn = (MessageConnection) Connector.open("sms://+" + mobilenumber); TextMessage text = (TextMessage) msgConn .newMessage(MessageConnection.TEXT_MESSAGE); text.setPayloadText(message); msgConn.send(text); msgConn.close(); } catch (IOCancelledException ioce) { System.out .println("IOCancelledException: " + ioce.getMessage()); } catch (IOException ioe) { System.out.println("IOException: " + ioe.getMessage()); } catch (Exception e) { System.out.println("Exception: " + e); } } }

    Read the article

  • Bypassing "Found New Hardware Wizard" / Setting Windows to Install Drivers Automatically

    - by Synetech inc.
    Hi, My motherboard finally died after the better part of a decade, so I bought a used system. I put my old hard-drive and sound-card in the new system, and connected my old keyboard and mouse (the rest of the components—CPU, RAM, mobo, video card—are from the new system). I knew beforehand that it would be a challenge to get Windows to boot and install drivers for the new hardware (particularly since the foundational components are new), but I am completely unable to even attempt to get through the work of installing drivers for things like the video card because the keyboard and mouse won't work (they do work, in the BIOS screen, in DOS mode, in Windows 7, in XP's boot menu, etc., just not in Windows XP itself). Whenever I try to boot XP (in normal or safe mode), I get a bunch of balloons popping up for all the new hardware detected, and a New Hardware Found Wizard for Processor (obviously it has to install drivers for the lowest-level components on up). Unfortunately I cannot click Next since the keyboard and mouse won't work yet because the motherboard drivers (for the PS/2 or USB ports) are not yet installed. I even tried a serial mouse, but to no avail—again, it does work in DOS, 7, etc., but not XP because it doesn't have the serial port driver installed. I tried mounting the SOFTWARE and SYSTEM hives under Windows 7 in order to manually set the "unsigned drivers warning" to ignore (using both of the driver-signing policy settings that I found references to). That didn't work; I still get the wizard. They are not even fancy, proprietary, third-party, or unsigned drivers. They are drivers that come with Windows—as the drivers for CPU, RAM, IDE controller, etc. tend to be. And the keyboard and mouse drivers are the generic ones at that (but like I said, those are irrelevant since the drivers for the ports that they are connected to are not yet installed). Obviously at some point in time over the past several years, a setting got changed to make Windows always prompt me when it detects new hardware. (It was also configured to show the Shutdown Event Tracker on abnormal shutdowns, so I had to turn that off so that I could even see the desktop.) Oh, and I tried deleting all of the PNF files so that they get regenerated, but that too did not help. Does anyone know how I can reset Windows to at least try to automatically install drivers for new hardware before prompting me if it fails? Conversely, does anyone know how exactly one turns off automatic driver installation (and prompt with the wizard)? Thanks a lot.

    Read the article

  • castle monorails httpHandlers

    - by bogdanbrudiu
    I have a question and I hope you can help me solve it... I have a castle monorails application. In web.config file in httphandlers I have *.aspx maped to monorails (my hosting does not suport other extensions...) <add verb="*" path="*.aspx" type="Castle.MonoRail.Framework.MonoRailHttpHandlerFactory,Castle.MonoRail.Framework"/> The problem is that I have some Webforms pages that I want to work with aspx... So I am adding something like this to the web.config file... <add verb="*" path="connector.aspx*" type="System.Web.UI.PageHandlerFactory"/> <add verb="*" path="ChatPage.aspx*" type="System.Web.UI.PageHandlerFactory"/> <add verb="*" path="Logon.aspx*" type="System.Web.UI.PageHandlerFactory"/> Still it does not work.. What am I doing wrong?

    Read the article

  • Open source configuration framework for ASP.NET - does one exist?

    - by Jon
    We currently have an old product written in classic asp and are about to re-write parts in ASP.NET. One big problem is that much of the cutomer-specifics within the system are hard coded. We want to split this out for specific customers by storing data in the database. Is there a quick an easy open source framework which allows me to set up some quick tables and simple UIs to allow me to change configuration items? We have 6-7 modules, and it would be nice to have the ability to have system admins gain access to a configuration area where they can set-up settings in a tabbed UI format, settings could also be set-up to allow dropdown, fields, numbers etc. The items could then be accessed via classes in C#/vb for use within the operational parts of the system. If not, I'm suprised and it might even be a good basis for a new open source project.

    Read the article

  • How to Programmatically Identify a PI Font (a Dingbat) under OS X

    - by Glenn Howes
    There is a class of fonts called Pi fonts whose glyphs, under OS X, get mapped to the private Unicode space 0xF021-0xF0FF such that if you subtract 0xF000 from each unicode character to retrieve the 8-bit version of the character and be able to draw that character as if it were a standard Roman character. My question is how do I recognize these fonts? It's obvious the system can do so because there is a category on the Special Characters palette called "Pi Fonts" which apparently has the various such fonts installed on my system. In my case they are BookshelSymbolSeven, MSReferenceSpeciality, MT-Extras, Marlett, MonotypeSorts, Webdings, and various Wingdings. If I use the old fashioned QuickDraw routines to ask for the TextEncoding of these fonts, I get a value of 0x20000 which I do not see in the system header file TextCommon.h. Am I supposed to treat any font with a TextEncoding of 0x20000 as a Pi Font? And I'd rather not use any QuickDraw font handling routines for obvious reasons.

    Read the article

  • How to grant su access to wheel without asking for password on FreeBSD?

    - by cstamas
    I would like to grant users of the wheel group (other sysadmins) su access without being asked for password. I know how to do it with pam in linux, but the question now is for FreeBSD. I am not familiar with the syntax for FreeBSD's PAM subsystem. What shall I enter in /etc/pam.d/su instead of the default: auth sufficient pam_rootok.so no_warn auth sufficient pam_self.so no_warn auth requisite pam_group.so no_warn group=wheel root_only fail_safe ruser auth include system # account account include system # session session required pam_permit.so

    Read the article

  • File Upload in GWT in a Special Case

    - by Maksud
    I am doing a software for a document system. In this system when a user completes a document and want to save it, the document will be uploaded directly to server without the user action. This system uses COM/ActiveX to facilitate user using native editors. Ok, my problem is: suppose I have a file say d:/notepad.txt. Using classical method a user can browse the file and upload it. I can do that with apache commonio and GWT FormPanel and FileUpload. But if I know the filename (d:/notepad.txt), is there any way to upload the file directly to server without the user having to browse the file. I am currently doing this by the ActiveX componenet calling some HttpUpload methods with POST. But that does not maintain session. Thanks

    Read the article

  • How to define using statements in web.config?

    - by Hasan Gürsoy
    I'm using MySql in my asp.net project. But I don't want to type every "using MySql.Data.MySqlClient;" statement in every aspx.cs file. How can I define this lines in web.config file? I've defined some namespaces like below but this only works for aspx pages: <?xml version="1.0"?> <configuration> <system.web> <compilation debug="false" targetFramework="4.0"/> <pages> <namespaces> <add namespace="System.Web.Configuration"/> <add namespace="MySql.Data"/> <add namespace="MySql.Data.MySqlClient"/> </namespaces> </pages> </system.web> </configuration>

    Read the article

  • How to implement an EventHandler to update controls

    - by Bill
    May I ask for help with the following? I am attempting to connect and control three pieces of household electronic equipment by computer through a GlobalCache GC-100 and iTach. As you will see in the following code, I created a class-instance of GlobalCacheAdapter that communicates with each piece of equipment. Although the code seems to work well in controlling the equipment, I am having trouble updating controls with the feedback from the equipment. The procedure "ReaderThreadProc" captures the feedback; however I don't know how to update the associated TextBox with the feedback. I believe that I need to create an EventHandler to notify the TextBox of the available update; however I am uncertain as to how an EventHandler like this would be implemented. Any help wold be greatly appreciated. using System; using System.IO; using System.Net; using System.Net.Sockets; using System.Threading; using System.Windows.Forms; namespace WindowsFormsApplication1 { public partial class Form1 : Form { // Create three new instances of GlobalCacheAdaptor and connect. // GC-100 (Elan) 192.168.1.70 4998 // GC-100 (TuneSuite) 192.168.1.70 5000 // GC iTach (Lighting) 192.168.1.71 4999 private GlobalCacheAdaptor elanGlobalCacheAdaptor; private GlobalCacheAdaptor tuneSuiteGlobalCacheAdaptor; private GlobalCacheAdaptor lutronGlobalCacheAdaptor; public Form1() { InitializeComponent(); elanGlobalCacheAdaptor = new GlobalCacheAdaptor(); elanGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.70"), 4998); tuneSuiteGlobalCacheAdaptor = new GlobalCacheAdaptor(); tuneSuiteGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.70"), 5000); lutronGlobalCacheAdaptor = new GlobalCacheAdaptor(); lutronGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.71"), 4999); elanTextBox.Text = elanGlobalCacheAdaptor._line; tuneSuiteTextBox.Text = tuneSuiteGlobalCacheAdaptor._line; lutronTextBox.Text = lutronGlobalCacheAdaptor._line; } private void btnZoneOnOff_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,4,1,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,800" + Environment.NewLine); } private void btnSourceInput1_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,1,1,20,179,20,179,20,179,20,179,20,179,20,179,20,179,20,278,20,179,20,179,20,179,20,780" + Environment.NewLine); } private void btnSystemOff_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,1,1,20,184,20,184,20,184,20,184,20,184,20,286,20,286,20,286,20,184,20,184,20,184,20,820" + Environment.NewLine); } private void btnLightOff_Click(object sender, EventArgs e) { lutronGlobalCacheAdaptor.SendMessage("sdl,14,0,0,S2\x0d"); } private void btnLightOn_Click(object sender, EventArgs e) { lutronGlobalCacheAdaptor.SendMessage("sdl,14,100,0,S2\x0d"); } private void btnChannel31_Click(object sender, EventArgs e) { tuneSuiteGlobalCacheAdaptor.SendMessage("\xB8\x4D\xB5\x33\x31\x00\x30\x21\xB8\x0D"); } private void btnChannel30_Click(object sender, EventArgs e) { tuneSuiteGlobalCacheAdaptor.SendMessage("\xB8\x4D\xB5\x33\x30\x00\x30\x21\xB8\x0D"); } } } public class GlobalCacheAdaptor { public Socket _multicastListener; public string _preferredDeviceID; public IPAddress _deviceAddress; public Socket _deviceSocket; public StreamWriter _deviceWriter; public bool _isConnected; public int _port; public IPAddress _address; public string _line; public GlobalCacheAdaptor() { } public static readonly GlobalCacheAdaptor Instance = new GlobalCacheAdaptor(); public bool IsListening { get { return _multicastListener != null; } } public GlobalCacheAdaptor ConnectToDevice(IPAddress address, int port) { if (_deviceSocket != null) _deviceSocket.Close(); try { _port = port; _address = address; _deviceSocket = new Socket(AddressFamily.InterNetwork, SocketType.Stream, ProtocolType.Tcp); _deviceSocket.Connect(new IPEndPoint(address, port)); ; _deviceAddress = address; var stream = new NetworkStream(_deviceSocket); var reader = new StreamReader(stream); var writer = new StreamWriter(stream) { NewLine = "\r", AutoFlush = true }; _deviceWriter = writer; writer.WriteLine("getdevices"); var readerThread = new Thread(ReaderThreadProc) { IsBackground = true }; readerThread.Start(reader); _isConnected = true; return Instance; } catch { DisconnectFromDevice(); MessageBox.Show("ConnectToDevice Error."); throw; } } public void SendMessage(string message) { try { var stream = new NetworkStream(_deviceSocket); var reader = new StreamReader(stream); var writer = new StreamWriter(stream) { NewLine = "\r", AutoFlush = true }; _deviceWriter = writer; writer.WriteLine(message); var readerThread = new Thread(ReaderThreadProc) { IsBackground = true }; readerThread.Start(reader); } catch { MessageBox.Show("SendMessage() Error."); } } public void DisconnectFromDevice() { if (_deviceSocket != null) { try { _deviceSocket.Close(); _isConnected = false; } catch { MessageBox.Show("DisconnectFromDevice Error."); } _deviceSocket = null; } _deviceWriter = null; _deviceAddress = null; } private void ReaderThreadProc(object state) { var reader = (StreamReader)state; try { while (true) { var line = reader.ReadLine(); if (line == null) break; _line = _line + line + Environment.NewLine; } // Need to create EventHandler to notify the TextBoxes to update with _line } catch { MessageBox.Show("ReaderThreadProc Error."); } } }

    Read the article

  • USB thermometer that works in Linux

    - by ttvd
    Hello! I am constructing a small robot based on an embedded board running linux. I am looking for a USB thermometer device, which will work with 2.6 kernel. So far I found a bunch of devices, but it's not clear whether they have linux drivers or not (no description). Thanks in advance.

    Read the article

  • What causes my borderless C++/CLI app to crash when overriding WndProc?

    - by Ste
    I use a form with border NONE. I need to override WndProc for resize and move form. However, using this code, my app crashes! static const int WM_NCHITTEST = 0x0084; static const int HTCLIENT = 1; static const int HTCAPTION = 2; protected: virtual void Form1::WndProc(System::Windows::Forms::Message %m) override { switch (m.Msg) { case WM_NCHITTEST: if (m.Result == IntPtr(HTCLIENT)) { m.Result = IntPtr(HTCAPTION); } break; } Form1::WndProc(m); } virtual System::Windows::Forms::CreateParams^ get() override { System::Windows::Forms::CreateParams^ cp = __super::CreateParams; cp->Style |= 0x40000; return cp; } How can I fix my code not to crash but still allow my form to be moved and resized?

    Read the article

  • receive emails in a .NET service (C#)

    - by Jean Azzopardi
    Hi, this is my first posting on stackoverflow, so don't flame me too much ;) I'm building a service that's monitoring devices and should be able to receive emails from users, parse them and take action accordingly. It should also be able to send emails about the status of the devices, etc. I'll be using Windows.Live email, and as I said, a .NET service that should be able to send/recieve emails. I am wondering what kind of system would I need to cater for receiving the emails, as I already know how to send them via the System.net.Mail API. Thanks. EDIT : Thanks for your comments everybody, I'm looking forward to implementing this system and asking more questions on this rather excellent site.

    Read the article

  • Can Windows Essentials Remove the alescruf.c Virus from a Windows PC?

    - by jmort253
    A colleague just visited a site which had been hacked by the alescruf.c trojan virus, which infects HTML via embedded JavaScript. Windows PC's are infected by visiting the site. If my colleague has Windows Essentials, which detected and removed the trojan, is there anything else that he needs to do to make sure the virus is no longer active? Windows Essentials detected the trojan within seconds of visiting the site, and he's running a full system scan to see if it still detects anything.

    Read the article

  • Server-Ip address is not getting displayed in snmp-trap messages

    - by Gaurav
    my problem is about Ip Address which I am receiving on the windows system snmp-trap messages,is some thing like that UDP: [192.168.1.150]:1029->[0.0.0.0]:0 while same trap message on linux system has been displayed as UDP: [192.168.1.150]:1030->[192.168.1.23] Now,if you observed carefully these two ,its clearly shown that server ip is not coming in windows traps-Ip([0.0.0.0]:0).what would be the possible reason?please anyone can help me about understanding this & can provide the solution for this problem.

    Read the article

  • .net, using PowerShell class to invoke a "[namespace.class]::method" style command

    - by Marco
    Hello, I created a powershell object via .net to invoke commands. When I invoke normal commands like 'Get-Process' I had no problems: ps.AddCommand("Get-Process").AddParameter(...).Invoke() but I'm not able to invoke a .net method with the syntax "[namespace.class]::method", just to make an example to invoke [System.IO.File]::Exists("c:\boo.txt"). I tried with ps.AddCommand("[System.IO.File]::Exists(\"c:\boo.txt\")").Invoke() ps.AddCommand("[System.IO.File]::Exists").AddArgument("c:\boo.txt\").Invoke() and some others. It always throws an exception which says that the command specified is not recognized. There is a way to invoke that type of command? Thanks

    Read the article

  • How do I connect to SqlLite db file from c#?

    - by Nick
    Hey all... I am trying to connect to a sqllite db from with a c# application. I have never worked with SQLLite before. var connectionString = @"data source='C:\TestData\StressData.s3db'"; connection = new SQLiteConnection(connectionString); connection.Open(); When i attempt to open the connection I get the following exception: System.NotSupportedException: The given path's format is not supported. at System.Security.Util.StringExpressionSet.CanonicalizePath(String path, Boolean needFullPath) at System.Security.Util.StringExpressionSet.CreateListFromExpressions(String[] str, Boolean needFullPath) What am I doing wrong? Thanks.. Nick

    Read the article

  • C# problem with ADO

    - by ahmed
    When i use the following code, i get this error : "OleDbexception Syntax error in INSERT INTO statement. plz help me! { // add the new username System.Data.OleDb.OleDbCommandBuilder cb; cb = new System.Data.OleDb.OleDbCommandBuilder(da); DataRow dRow = cPD_DatabaseDataSet.Tables["users_table"].NewRow(); dRow[0] = this.textBox_add_user.Text ; dRow[1] = this.textBox_password.Text ; cPD_DatabaseDataSet.Tables["users_table"].Rows.Add(dRow); //add new record cb.GetUpdateCommand(); cb.GetInsertCommand(); //save new recode into the Access file da.Update(cPD_DatabaseDataSet, "users_table"); //clear textboxes this.textBox_add_user.Text = ""; this.textBox_password.Text = ""; this.textBox_re_password.Text = ""; } catch (System.Data.OleDb.OleDbException exp) { //close the connection this.con.Close(); MessageBox.Show(exp.ToString()); }`

    Read the article

  • Extracting init script from bult-in intrfs into Linux bzImage

    - by Maciej Piechotka
    I have following problem - I damaged my system (Gentoo - by rebuilding using gcc 4.5) beyond repair. I unmounted /home, copied /etc + other important files and I've started reinstalling system. However I forgot to copy init script. It is still present in kernel image that I have. How to extract it? Please note that initrd is not a separate file but is in the kernel image.

    Read the article

  • IE on Windows 7 not saving files to disk [closed]

    - by Gemini
    I am running Win 7 Build 7100. Since I restored this system I am facing peculiar issues - all effectively rendering this system unusable. The biggest peeve is: Any file downloaded from IE is never saved to disk. IE shows the entire download progress bar and at the end of download, no file is saved anywhere on the disk!

    Read the article

  • custom attribute changes in .NET 4

    - by Sarah Vessels
    I recently upgraded a C# project from .NET 3.5 to .NET 4. I have a method that extracts all MSTest test methods from a given list of MethodBase instances. Its body looks like this: return null == methods || methods.Count() == 0 ? null : from method in methods let testAttribute = Attribute.GetCustomAttribute(method, typeof(TestMethodAttribute)) where null != testAttribute select method; This worked in .NET 3.5, but since upgrading my projects to .NET 4, this code always returns an empty list, even when given a list of methods containing a method that is marked with [TestMethod]. Did something change with custom attributes in .NET 4? Debugging, I found that the results of GetCustomAttributesData() on the test method gives a list of two CustomAttributeData which are described in Visual Studio 2010's 'Locals' window as: Microsoft.VisualStudio.TestTools.UnitTesting.DeploymentItemAttribute("myDLL.dll") Microsoft.VisualStudio.TestTools.UnitTesting.TestMethodAttribute() -- this is what I'm looking for When I call GetType() on that second CustomAttributeData instance, however, I get {Name = "CustomAttributeData" FullName = "System.Reflection.CustomAttributeData"} System.Type {System.RuntimeType}. How can I get TestMethodAttribute out of the CustomAttributeData, so that I can extract test methods from a list of MethodBases?

    Read the article

< Previous Page | 479 480 481 482 483 484 485 486 487 488 489 490  | Next Page >