Search Results

Search found 4501 results on 181 pages for 'vostro 1000'.

Page 49/181 | < Previous Page | 45 46 47 48 49 50 51 52 53 54 55 56  | Next Page >

  • IPTV: how to minimize the upload bandwidth

    - by gjmc
    hello guys, my questions would be in the field of IPTV Kindly consider the below: 200 channels, mp4 @ 1000kbps 1000 users. The main goal is to minimize the upload bandwidth required for this project. Also consider that the streaming server will be in different country then the clients. Thank you guys!

    Read the article

  • 20GB+ worth of emails in my /home what is a better solution for that?

    - by Skinkie
    My email storage requirements are outgrowing anything reasonable with respect to local mail storage. As we speak 99% of my home partition is filled with personal mail in Thunderbirds mail dirs. Needless to say, this is just painful, badly searchable and as history has proven me that backups work, but Thunderbird is capable of loosing a lot of mail very easily. Currently I have an remote IMAPS server (Dovecot) running for my daily mail, accessible from anywhere, which from my own practice works efficiently up to about 1000 emails. Then some archive directories should be used to move mail around. I have been looking into DBMail, but I wonder if I make my case worse or better which such solution. None of the supported database employ string deduplication or string compression out of the box, so is this going to help me with 20GB+ mail? What about falling back to a plain old IMAP server? A filesystem like ZFS would support stuff like GZIP transparently, which could help. Could someone share their thoughts? The 20GB mostly consists of mailinglists, and normal mail. Not things like attachments. To add some clarifications; As we speak, my mail is not server side indexed at all - only my new mail arrives at a remote IMAP server. It is all local storage from former POP3 accounts, local mirrored Gmail and IMAP accounts. In my perspective it is not Thunderbird that sucks, its fileformat that sucks. Regarding the 1000 mails. On the road I am using Alpine and MobileMail, quite happy with both of them, but some management is required to actually manage the mail. Sieve helps a lot with that, but browing through 10.000 e-mails is not fun, especially not on a mobile client. I am quite happy with Dovecot, never had any issues with it. I just wonder if this is the way to go. Or if there are any other better solutions. What my question is: what is the best practice solution that allows 20GB+ mails and is -on demand remotely accessible, easy to backup and archive worthy. It doesn't need to be available 24x7. The final approach I took was installing a local IMAP server (Dovecot), configured it for being my archive, using the following guide: http://en.gentoo-wiki.com/wiki/Dovecot/InstallThunderbird

    Read the article

  • Not to forward certain email Outlook

    - by kitokid
    I have set up a rule to forward incoming emails from Outlook to my Gmail account. The problem is that certain mails in which I'm a CC (about 1000/day monitoring system running status) are also forwarded to my Gmail and fill up my account very quickly. I have set up rules in Outlook to move those emails to a certain folder (called Monitored_Emails), but I don't know how to filter those emails so they don't forward to Gmail. How can I set this rule to forward all emails except those in a certain folder name?

    Read the article

  • emacs for sys admins

    - by mbac32768
    Are you a sys admin that uses emacs? What tools/plugins do you find essential? In my organization the programmers tend to use emacs whereas the sys admins gravitate towards vim. Since we have 4:1 programmers:sys admins, the global emacs config has a lot more goodness but it doesn't fit nicely into my workflow since I'm used to starting/stopping vim on remote hosts 1000 times a day Does emacs have a place in your sys admin workflow?

    Read the article

  • What kind of hosting is used for *tube sites?

    - by playcat
    Hello, When a site grows from a just-a-fun project to a site with bigger load of visitor, and you want to enable them to upload videos, you might find yourself in a need of a better hosting, including dedicated server and a no-limit web traffic (or some reasonable limit). So, if people can upload their videos, and if page has around 1000-10000 visitors per day, what kind of hosting is there to choose from? What is needed in that case? Thx

    Read the article

  • Does Control Zone touchpad in HP notebooks have standard LMB/RMB clicks at the bottom of touchpad?

    - by user1825608
    I wanted to buy: http://www.x-kom.pl/p/203762-ultrabook-15-6-hp-envy-15-x360-u000ew-i5-4210u-4gb-1000-win81.html# but now I see it does not have normal touchpad but this one which does not work as it should in Spectre 13. The deal is that every video says about those new features (which will be outdated when Windows 9 will come by) not about if it still has standard LMB/RMB click. Question: Does or does not Control Zone touchpade have mechanical left and right mouse button area at the bottom of it as every other touchpad?

    Read the article

  • No external network on ubuntu 9.10, though dns works..

    - by user29368
    Hi, I have a weird problem I cant solve. I have several computers, two with xubuntu 9.10 One of them, acting as a media server, has stopped to work when it comes to external network.. I can do for example: ping google.com Which gives me an ip adress back, like: name@Media:/etc$ ping google.com PING google.com (66.102.9.147) 56(84) bytes of data. That tells me it reaches the dns?, but I get no response at all... If I ping a local computer all works fine. I can also reach the computer via ssh without any problems. I have always used network manager, but now I uninstalled it and made the settings manually like this: /etc/network/interfaces auto lo iface lo inet loopback auto eth0 iface eth0 inet static address 192.168.1.52 netmask 255.255.255.0 network 192.168.1.0 broadcast 192.168.1.255 gateway 192.168.1.1 Still no luck. I have no specific settings for this one in my router, and all the other computers, including my win laptop works fine. This is very annoying since I cant even do an update or anything.. ifconfig looks like this: eth0 Link encap:Ethernet HWaddr 00:24:1d:9f:10:89 inet addr:192.168.1.52 Bcast:192.168.1.255 Mask:255.255.255.0 inet6 addr: fe80::224:1dff:fe9f:1089/64 Scope:Link UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:15410 errors:0 dropped:0 overruns:0 frame:0 TX packets:2693 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:1167398 (1.1 MB) TX bytes:694973 (694.9 KB) Interrupt:27 Base address:0xe000 lo Link encap:Local Loopback inet addr:127.0.0.1 Mask:255.0.0.0 inet6 addr: ::1/128 Scope:Host UP LOOPBACK RUNNING MTU:16436 Metric:1 RX packets:2150 errors:0 dropped:0 overruns:0 frame:0 TX packets:2150 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:0 RX bytes:143456 (143.4 KB) TX bytes:143456 (143.4 KB) route -n like this Kernel IP routing table Destination Gateway Genmask Flags Metric Ref Use Iface 192.168.1.0 0.0.0.0 255.255.255.0 U 0 0 0 eth0 169.254.0.0 0.0.0.0 255.255.0.0 U 1000 0 0 eth0 0.0.0.0 192.168.1.1 0.0.0.0 UG 100 0 0 eth0 I do not know where the adress starting with 169.254 comes from.. Could that be a part of the problem? Hoping for some assistance since Im totally stuck here.. /george

    Read the article

  • Site down, SSH and FTP work fine

    - by Euskadi
    I cannot access my site through my web browser, using either the domain name or IP address (which also pings fine). My site was working last night when I went to bed, so I can't think what might have done it. I have tried restarting apache to no avail. update: I've noticed that http://[IP Address]/phpymyadmin works but [domain name]/phpmyadmin does not, and the same happens for webmin (https://[IP]:1000). Could this be a problem with BIND?

    Read the article

  • Mount network drive

    - by user971155
    I'm using linux(ubuntu), there's a linux(fedora) server, that I can log in with ssh, is there any possibility //server/dir /mnt/my_mount_dir cifs username=loginpassword=11111,uid=1000,iocharset=utf8,codepage=unicode,unicode 0 0 As far as I'm concerned, this construction uses SMB as primary tool. Is there any possibility to use NFS or any another approach, because in case of SMB it tends to have permission, symlink collisions. PS It would be great if you also provide some links. Thanks.

    Read the article

  • How to change default user (ubuntu) via CloudInit on AWS

    - by Gui Ambros
    I'm using CloudInit to automate the startup of my instances on AWS. I followed the (scarce) documentation available at http://bazaar.launchpad.net/~cloud-init-dev/cloud-init/trunk/annotate/head%3A/doc/examples/cloud-config.txt and examples on /usr/share/doc/cloud-init, but still haven't figured out how to change the default username (ubuntu, id:1000). I know I can create a script to manually delete the default ubuntu and add my user, but seems counter intuitive given that CloudInit exist exactly to automate the initial setup. Any ideas?

    Read the article

  • Advice on my jQuery Ajax Function

    - by NessDan
    So on my site, a user can post a comment on 2 things: a user's profile and an app. The code works fine in PHP but we decided to add Ajax to make it more stylish. The comment just fades into the page and works fine. I decided I wanted to make a function so that I wouldn't have to manage 2 (or more) blocks of codes in different files. Right now, the code is as follows for the two pages (not in a separate .js file, they're written inside the head tags for the pages.): // App page $("input#comment_submit").click(function() { var comment = $("#comment_box").val(); $.ajax({ type: "POST", url: "app.php?id=<?php echo $id; ?>", data: {comment: comment}, success: function() { $("input#comment_submit").attr("disabled", "disabled").val("Comment Submitted!"); $("textarea#comment_box").attr("disabled", "disabled") $("#comments").prepend("<div class=\"comment new\"></div>"); $(".new").prepend("<a href=\"profile.php?username=<?php echo $_SESSION['username']; ?>\" class=\"commentname\"><?php echo $_SESSION['username']; ?></a><p class=\"commentdate\"><?php echo date("M. d, Y", time()) ?> - <?php echo date("g:i A", time()); ?></p><p class=\"commentpost\">" + comment + "</p>").hide().fadeIn(1000); } }); return false; }); And next up, // Profile page $("input#comment_submit").click(function() { var comment = $("#comment_box").val(); $.ajax({ type: "POST", url: "profile.php?username=<?php echo $user; ?>", data: {comment: comment}, success: function() { $("input#comment_submit").attr("disabled", "disabled").val("Comment Submitted!"); $("textarea#comment_box").attr("disabled", "disabled") $("#comments").prepend("<div class=\"comment new\"></div>"); $(".new").prepend("<a href=\"profile.php?username=<?php echo $_SESSION['username']; ?>\" class=\"commentname\"><?php echo $_SESSION['username']; ?></a><p class=\"commentdate\"><?php echo date("M. d, Y", time()) ?> - <?php echo date("g:i A", time()); ?></p><p class=\"commentpost\">" + comment + "</p>").hide().fadeIn(1000); } }); return false; }); Now, on each page the box names will always be the same (comment_box and comment_submit) so what do you guys think of this function (Note, the postComment is in the head tag on the page.): // On the page, (profile.php) $(function() { $("input#comment_submit").click(function() { postComment("profile", "<?php echo $user ?>", "<?php echo $_SESSION['username']; ?>", "<?php echo date("M. d, Y", time()) ?>", "<?php echo date("g:i A", time()); ?>"); }); }); Which leads to this function (which is stored in a separate file called functions.js): function postComment(page, argvalue, username, date, time) { if (page == "app") { var arg = "id"; } if (page == "profile") { var arg = "username"; } var comment = $("#comment_box").val(); $.ajax({ type: "POST", url: page + ".php?" + arg + "=" + argvalue, data: {comment: comment}, success: function() { $("textarea#comment_box").attr("disabled", "disabled") $("input#comment_submit").attr("disabled", "disabled").val("Comment Submitted!"); $("#comments").prepend("<div class=\"comment new\"></div>"); $(".new").prepend("<a href=\"" + page + ".php?" + arg + "=" + username + "\" class=\"commentname\">" + username + "</a><p class=\"commentdate\">" + date + " - " + time + "</p><p class=\"commentpost\">" + nl2br(comment) + "</p>").hide().fadeIn(1000); } }); return false; } That's what I came up with! So, some problems: When I hit the button the page refreshes. What fixed this was taking the return false from the function and putting it into the button click. Any way to keep it in the function and have the same effect? But my real question is this: Can any coders out there that are familiar to jQuery tell me techniques, coding practices, or ways to write my code more efficiently/elegantly? I've done a lot of work in PHP but I know that echoing the date may not be the most efficient way to get the date and time. So any tips that can really help me streamline this function and also make me better with writing jQuery are very welcome!

    Read the article

  • JavaScript tree / treegrid libraries

    - by desau
    I'm looking for a good JavaScript tree / treegrid package. Now -- before you answer: It needs to be able to perform well with lots of nodes. Perhaps 1,000 sibling nodes. It needs to be able to draw to a usable state within 2 or 3 seconds with 1,000 nodes. It doesn't necessarily need to draw all 1,000 nodes at once -- if it supports some sort of "smart rendering" or fake scrolling. Beyond that, column resizing, drag and drop, inline editing would all be nice, although I could probably add that functionality myself. I've already tried dojo's tree and yahoo's YUI treeview. Both are too slow.

    Read the article

  • delphi idhttp post related question

    - by paul
    hello All im new to delphi. and also almost new to programming world. i was made some simple post software which using idhttp module. but when execute it , it not correctly working. this simple program is check for my account status. if account login successfully it return some source code which include 'top.location =' in source, and if login failed it return not included 'top.location =' inside account.txt is follow first and third account was alived account but only first account can check, after first account other account can't check i have no idea what wrong with it ph896011 pk1089 fsadfasdf dddddss ph896011 pk1089 following is source of delphi if any one help me much apprecated! unit Unit1; interface uses Windows, Messages, SysUtils, Variants, Classes, Graphics, Controls, Forms, Dialogs, StdCtrls, IdBaseComponent, IdComponent, IdTCPConnection, IdTCPClient, IdHTTP, IdCookieManager, ExtCtrls; type TForm1 = class(TForm) Button1: TButton; IdHTTP1: TIdHTTP; Memo1: TMemo; IdCookieManager1: TIdCookieManager; lstAcct: TListBox; result: TLabel; Edit1: TEdit; Timer1: TTimer; procedure Button1Click(Sender: TObject); //procedure FormCreate(Sender: TObject); //procedure FormClose(Sender: TObject; var Action: TCloseAction); private { Private declarations } public AccList: TStringList; IdCookie: TIdCookieManager; CookieList: TList; StartCnt: Integer; InputCnt: Integer; WordList: TStringList; WordNoList: TStringList; WordCntList: TStringList; StartTime: TDateTime; end; var Form1: TForm1; implementation {$R *.dfm} procedure TForm1.Button1Click(Sender: TObject); var i: Integer; //temp: String; lsttemp: TStringList; sl : tstringlist; //userId,userPass: string; begin InputCnt:= 0; WordList := TStringList.Create; CookieList := TList.create; IdCookie := TIdCookieManager.Create(self); if FileExists(ExtractFilePath(Application.ExeName) + 'account.txt') then WordList.LoadFromFile(ExtractFilePath(Application.ExeName) + 'account.txt'); WordNoList:= TStringList.Create; WordCntList := TStringList.Create; lsttemp := TStringList.create; sl :=Tstringlist.Create; try try for i := 0 to WordList.Count -1 do begin ExtractStrings([' '], [' '], pchar(WordList[i]), lsttemp); WordNoList.add(lsttemp[0]); //ShowMessage(lsttemp[0]); WordCntList.add(lsttemp[1]); //ShowMessage(lsttemp[1]); sl.Add('ID='+ lsttemp[0]); sl.add('PWD=' + lsttemp[1]); sl.add('SECCHK=0'); IdHTTP1.HandleRedirects := True; IdHTTP1.Request.ContentType := 'application/x-www-form-urlencoded'; memo1.Text:=idhttp1.Post('http://user.buddybuddy.co.kr/Login/Login.asp',sl); if pos('top.location =',Memo1.Text)> 0 then begin application.ProcessMessages; ShowMessage('Alive Acc!'); //result.Caption := 'alive acc' ; sleep(1000); Edit1.Text := 'alive acc'; lsttemp.Clear; Memo1.Text := ''; //memo1.Text := IdHTTP1.Get('https://user.buddybuddy.co.kr/Login/Logout.asp'); Sleep(1000); end; if pos('top.location =', memo1.Text) <> 1 then begin application.ProcessMessages; ShowMessage('bad'); Edit1.Text := 'bad'; //edit1.Text := 'bad'; lsttemp.Clear; memo1.Text := ''; sleep(1000) ; end; Edit1.Text := ''; end; finally lsttemp.free; end; StartCnt := lstAcct.items.Count; StartTime := Now; finally sl.Free; end; end; end.

    Read the article

  • Random Page Cost and Planning

    - by Dave Jarvis
    A query (see below) that extracts climate data from weather stations within a given radius of a city using the dates for which those weather stations actually have data. The query uses the table's only index, rather effectively: CREATE UNIQUE INDEX measurement_001_stc_idx ON climate.measurement_001 USING btree (station_id, taken, category_id); Reducing the server's configuration value for random_page_cost from 2.0 to 1.1 had a massive performance improvement for the given range (nearly an order of magnitude) because it suggested to PostgreSQL that it should use the index. While the results now return in 5 seconds (down from ~85 seconds), problematic lines remain. Bumping the query's end date by a single year causes a full table scan: sc.taken_start >= '1900-01-01'::date AND sc.taken_end <= '1997-12-31'::date AND How do I persuade PostgreSQL to use the indexes regardless of years between the two dates? (A full table scan against 43 million rows is probably not the best plan.) Find the EXPLAIN ANALYSE results below the query. Thank you! Query SELECT extract(YEAR FROM m.taken) AS year, avg(m.amount) AS amount FROM climate.city c, climate.station s, climate.station_category sc, climate.measurement m WHERE c.id = 5182 AND earth_distance( ll_to_earth(c.latitude_decimal,c.longitude_decimal), ll_to_earth(s.latitude_decimal,s.longitude_decimal)) / 1000 <= 30 AND s.elevation BETWEEN 0 AND 3000 AND s.applicable = TRUE AND sc.station_id = s.id AND sc.category_id = 1 AND sc.taken_start >= '1900-01-01'::date AND sc.taken_end <= '1996-12-31'::date AND m.station_id = s.id AND m.taken BETWEEN sc.taken_start AND sc.taken_end AND m.category_id = sc.category_id GROUP BY extract(YEAR FROM m.taken) ORDER BY extract(YEAR FROM m.taken) 1900 to 1996: Index "Sort (cost=1348597.71..1348598.21 rows=200 width=12) (actual time=2268.929..2268.935 rows=92 loops=1)" " Sort Key: (date_part('year'::text, (m.taken)::timestamp without time zone))" " Sort Method: quicksort Memory: 32kB" " -> HashAggregate (cost=1348586.56..1348590.06 rows=200 width=12) (actual time=2268.829..2268.886 rows=92 loops=1)" " -> Nested Loop (cost=0.00..1344864.01 rows=744510 width=12) (actual time=0.807..2084.206 rows=134893 loops=1)" " Join Filter: ((m.taken >= sc.taken_start) AND (m.taken <= sc.taken_end) AND (sc.station_id = m.station_id))" " -> Nested Loop (cost=0.00..12755.07 rows=1220 width=18) (actual time=0.502..521.937 rows=23 loops=1)" " Join Filter: ((sec_to_gc(cube_distance((ll_to_earth((c.latitude_decimal)::double precision, (c.longitude_decimal)::double precision))::cube, (ll_to_earth((s.latitude_decimal)::double precision, (s.longitude_decimal)::double precision))::cube)) / 1000::double precision) <= 30::double precision)" " -> Index Scan using city_pkey1 on city c (cost=0.00..2.47 rows=1 width=16) (actual time=0.014..0.015 rows=1 loops=1)" " Index Cond: (id = 5182)" " -> Nested Loop (cost=0.00..9907.73 rows=3659 width=34) (actual time=0.014..28.937 rows=3458 loops=1)" " -> Seq Scan on station_category sc (cost=0.00..970.20 rows=3659 width=14) (actual time=0.008..10.947 rows=3458 loops=1)" " Filter: ((taken_start >= '1900-01-01'::date) AND (taken_end <= '1996-12-31'::date) AND (category_id = 1))" " -> Index Scan using station_pkey1 on station s (cost=0.00..2.43 rows=1 width=20) (actual time=0.004..0.004 rows=1 loops=3458)" " Index Cond: (s.id = sc.station_id)" " Filter: (s.applicable AND (s.elevation >= 0) AND (s.elevation <= 3000))" " -> Append (cost=0.00..1072.27 rows=947 width=18) (actual time=6.996..63.199 rows=5865 loops=23)" " -> Seq Scan on measurement m (cost=0.00..25.00 rows=6 width=22) (actual time=0.000..0.000 rows=0 loops=23)" " Filter: (m.category_id = 1)" " -> Bitmap Heap Scan on measurement_001 m (cost=20.79..1047.27 rows=941 width=18) (actual time=6.995..62.390 rows=5865 loops=23)" " Recheck Cond: ((m.station_id = sc.station_id) AND (m.taken >= sc.taken_start) AND (m.taken <= sc.taken_end) AND (m.category_id = 1))" " -> Bitmap Index Scan on measurement_001_stc_idx (cost=0.00..20.55 rows=941 width=0) (actual time=5.775..5.775 rows=5865 loops=23)" " Index Cond: ((m.station_id = sc.station_id) AND (m.taken >= sc.taken_start) AND (m.taken <= sc.taken_end) AND (m.category_id = 1))" "Total runtime: 2269.264 ms" 1900 to 1997: Full Table Scan "Sort (cost=1370192.26..1370192.76 rows=200 width=12) (actual time=86165.797..86165.809 rows=94 loops=1)" " Sort Key: (date_part('year'::text, (m.taken)::timestamp without time zone))" " Sort Method: quicksort Memory: 32kB" " -> HashAggregate (cost=1370181.12..1370184.62 rows=200 width=12) (actual time=86165.654..86165.736 rows=94 loops=1)" " -> Hash Join (cost=4293.60..1366355.81 rows=765061 width=12) (actual time=534.786..85920.007 rows=139721 loops=1)" " Hash Cond: (m.station_id = sc.station_id)" " Join Filter: ((m.taken >= sc.taken_start) AND (m.taken <= sc.taken_end))" " -> Append (cost=0.00..867005.80 rows=43670150 width=18) (actual time=0.009..79202.329 rows=43670079 loops=1)" " -> Seq Scan on measurement m (cost=0.00..25.00 rows=6 width=22) (actual time=0.001..0.001 rows=0 loops=1)" " Filter: (category_id = 1)" " -> Seq Scan on measurement_001 m (cost=0.00..866980.80 rows=43670144 width=18) (actual time=0.008..73312.008 rows=43670079 loops=1)" " Filter: (category_id = 1)" " -> Hash (cost=4277.93..4277.93 rows=1253 width=18) (actual time=534.704..534.704 rows=25 loops=1)" " -> Nested Loop (cost=847.87..4277.93 rows=1253 width=18) (actual time=415.837..534.682 rows=25 loops=1)" " Join Filter: ((sec_to_gc(cube_distance((ll_to_earth((c.latitude_decimal)::double precision, (c.longitude_decimal)::double precision))::cube, (ll_to_earth((s.latitude_decimal)::double precision, (s.longitude_decimal)::double precision))::cube)) / 1000::double precision) <= 30::double precision)" " -> Index Scan using city_pkey1 on city c (cost=0.00..2.47 rows=1 width=16) (actual time=0.012..0.014 rows=1 loops=1)" " Index Cond: (id = 5182)" " -> Hash Join (cost=847.87..1352.07 rows=3760 width=34) (actual time=6.427..35.107 rows=3552 loops=1)" " Hash Cond: (s.id = sc.station_id)" " -> Seq Scan on station s (cost=0.00..367.25 rows=7948 width=20) (actual time=0.004..23.529 rows=7949 loops=1)" " Filter: (applicable AND (elevation >= 0) AND (elevation <= 3000))" " -> Hash (cost=800.87..800.87 rows=3760 width=14) (actual time=6.416..6.416 rows=3552 loops=1)" " -> Bitmap Heap Scan on station_category sc (cost=430.29..800.87 rows=3760 width=14) (actual time=2.316..5.353 rows=3552 loops=1)" " Recheck Cond: (category_id = 1)" " Filter: ((taken_start >= '1900-01-01'::date) AND (taken_end <= '1997-12-31'::date))" " -> Bitmap Index Scan on station_category_station_category_idx (cost=0.00..429.35 rows=6376 width=0) (actual time=2.268..2.268 rows=6339 loops=1)" " Index Cond: (category_id = 1)" "Total runtime: 86165.936 ms"

    Read the article

  • How to use CLEAR USB internet connection in Ubuntu (host) and WindowsXP (guest) using VirtualBox

    - by bithacker
    I'm trying to use CLEAR Motorola WiMax USB in Ubuntu as there is no support for linux as yet. I've installed windowsxp as guest in ubuntu and the version I'm using is 3.2.2. USB is connecting fine in WindowsXP but I can't use internet in Ubuntu. Can you please tell me how to do it. Here is the configuration that could help you guys. Thanks in advance. I'm using Two Network Adapters. Network Adapter 1: PCnet-FAST III (NAT) Adapter 2: PCnet-FAST III (Host-only adapter, 'vboxnet0') ipconfig [on Guest windowsXP] Windows IP Configuration Ethernet adapter Local Area Connection: PCnet-FAST III (NAT) Connection-specific DNS Suffix . : IP Address. . . . . . . . . . . . : 10.0.2.15 Subnet Mask . . . . . . . . . . . : 255.255.255.0 Default Gateway . . . . . . . . . : 10.0.2.2 Ethernet adapter Local Area Connection 3: PCnet-FAST III (Host-only adapter, 'vboxnet0') Connection-specific DNS Suffix . : IP Address. . . . . . . . . . . . : 192.168.56.101 Subnet Mask . . . . . . . . . . . : 255.255.255.0 Default Gateway . . . . . . . . . : Ethernet adapter Local Area Connection 2: Connection-specific DNS Suffix . : CLEAR Motorola USB IP Address. . . . . . . . . . . . : 10.168.242.33 Subnet Mask . . . . . . . . . . . : 255.255.192.0 Default Gateway . . . . . . . . . : 10.168.192.2 IFCONFIG [on Host Ubuntu] (Ethernet) eth0 Link encap:Ethernet HWaddr 00:14:22:b9:9d:76 UP BROADCAST MULTICAST MTU:1500 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:0 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:0 (0.0 B) TX bytes:0 (0.0 B) Interrupt:16 eth1 (Wireless) Link encap:Ethernet HWaddr 00:13:ce:f0:9b:0d inet6 addr: fe80::213:ceff:fef0:9b0d/64 Scope:Link UP BROADCAST MULTICAST MTU:1500 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:1 errors:0 dropped:5 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:0 (0.0 B) TX bytes:84 (84.0 B) Interrupt:17 Base address:0xe000 Memory:dfcff000-dfcfffff lo Link encap:Local Loopback inet addr:127.0.0.1 Mask:255.0.0.0 inet6 addr: ::1/128 Scope:Host UP LOOPBACK RUNNING MTU:16436 Metric:1 RX packets:2292 errors:0 dropped:0 overruns:0 frame:0 TX packets:2292 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:0 RX bytes:171952 (171.9 KB) TX bytes:171952 (171.9 KB) vboxnet0 Link encap:Ethernet HWaddr 0a:00:27:00:00:00 inet addr:192.168.56.1 Bcast:192.168.56.255 Mask:255.255.255.0 inet6 addr: fe80::800:27ff:fe00:0/64 Scope:Link UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:137 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:0 (0.0 B) TX bytes:21174 (21.1 KB)

    Read the article

  • Why is insertion into my tree faster on sorted input than random input?

    - by Juliet
    Now I've always heard binary search trees are faster to build from randomly selected data than ordered data, simply because ordered data requires explicit rebalancing to keep the tree height at a minimum. Recently I implemented an immutable treap, a special kind of binary search tree which uses randomization to keep itself relatively balanced. In contrast to what I expected, I found I can consistently build a treap about 2x faster and generally better balanced from ordered data than unordered data -- and I have no idea why. Here's my treap implementation: http://pastebin.com/VAfSJRwZ And here's a test program: using System; using System.Collections.Generic; using System.Linq; using System.Diagnostics; namespace ConsoleApplication1 { class Program { static Random rnd = new Random(); const int ITERATION_COUNT = 20; static void Main(string[] args) { List<double> rndTimes = new List<double>(); List<double> orderedTimes = new List<double>(); rndTimes.Add(TimeIt(50, RandomInsert)); rndTimes.Add(TimeIt(100, RandomInsert)); rndTimes.Add(TimeIt(200, RandomInsert)); rndTimes.Add(TimeIt(400, RandomInsert)); rndTimes.Add(TimeIt(800, RandomInsert)); rndTimes.Add(TimeIt(1000, RandomInsert)); rndTimes.Add(TimeIt(2000, RandomInsert)); rndTimes.Add(TimeIt(4000, RandomInsert)); rndTimes.Add(TimeIt(8000, RandomInsert)); rndTimes.Add(TimeIt(16000, RandomInsert)); rndTimes.Add(TimeIt(32000, RandomInsert)); rndTimes.Add(TimeIt(64000, RandomInsert)); rndTimes.Add(TimeIt(128000, RandomInsert)); string rndTimesAsString = string.Join("\n", rndTimes.Select(x => x.ToString()).ToArray()); orderedTimes.Add(TimeIt(50, OrderedInsert)); orderedTimes.Add(TimeIt(100, OrderedInsert)); orderedTimes.Add(TimeIt(200, OrderedInsert)); orderedTimes.Add(TimeIt(400, OrderedInsert)); orderedTimes.Add(TimeIt(800, OrderedInsert)); orderedTimes.Add(TimeIt(1000, OrderedInsert)); orderedTimes.Add(TimeIt(2000, OrderedInsert)); orderedTimes.Add(TimeIt(4000, OrderedInsert)); orderedTimes.Add(TimeIt(8000, OrderedInsert)); orderedTimes.Add(TimeIt(16000, OrderedInsert)); orderedTimes.Add(TimeIt(32000, OrderedInsert)); orderedTimes.Add(TimeIt(64000, OrderedInsert)); orderedTimes.Add(TimeIt(128000, OrderedInsert)); string orderedTimesAsString = string.Join("\n", orderedTimes.Select(x => x.ToString()).ToArray()); Console.WriteLine("Done"); } static double TimeIt(int insertCount, Action<int> f) { Console.WriteLine("TimeIt({0}, {1})", insertCount, f.Method.Name); List<double> times = new List<double>(); for (int i = 0; i < ITERATION_COUNT; i++) { Stopwatch sw = Stopwatch.StartNew(); f(insertCount); sw.Stop(); times.Add(sw.Elapsed.TotalMilliseconds); } return times.Average(); } static void RandomInsert(int insertCount) { Treap<double> tree = new Treap<double>((x, y) => x.CompareTo(y)); for (int i = 0; i < insertCount; i++) { tree = tree.Insert(rnd.NextDouble()); } } static void OrderedInsert(int insertCount) { Treap<double> tree = new Treap<double>((x, y) => x.CompareTo(y)); for(int i = 0; i < insertCount; i++) { tree = tree.Insert(i + rnd.NextDouble()); } } } } And here's a chart comparing random and ordered insertion times in milliseconds: Insertions Random Ordered RandomTime / OrderedTime 50 1.031665 0.261585 3.94 100 0.544345 1.377155 0.4 200 1.268320 0.734570 1.73 400 2.765555 1.639150 1.69 800 6.089700 3.558350 1.71 1000 7.855150 4.704190 1.67 2000 17.852000 12.554065 1.42 4000 40.157340 22.474445 1.79 8000 88.375430 48.364265 1.83 16000 197.524000 109.082200 1.81 32000 459.277050 238.154405 1.93 64000 1055.508875 512.020310 2.06 128000 2481.694230 1107.980425 2.24 I don't see anything in the code which makes ordered input asymptotically faster than unordered input, so I'm at a loss to explain the difference. Why is it so much faster to build a treap from ordered input than random input?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Lua metatable Objects cannot be purge from memory?

    - by Prometheus3k
    Hi there, I'm using a proprietary platform that reported memory usage in realtime on screen. I decided to use a Class.lua I found on http://lua-users.org/wiki/SimpleLuaClasses However, I noticed memory issues when purging object created by this using a simple Account class. Specifically, I would start with say 146k of memory used, create 1000 objects of a class that just holds an integer instance variable and store each object into a table. The memory used is now 300k I would then exit, iterating through the table and setting each element in the table to nil. But would never get back the 146k, usually after this I am left using 210k or something similar. If I run the load sequence again during the same session, it does not exceed 300k so it is not a memory leak. I have tried creating 1000 integers in a table and setting these to nil, which does give me back 146k. In addition I've tried a simpler class file (Account2.lua) that doesn't rely on a class.lua. This still incurs memory fragmentation but not as much as the one that uses Class.lua Can anybody explain what is going on here? How can I purge these objects and get back the memory? here is the code --------Class.lua------ -- class.lua -- Compatible with Lua 5.1 (not 5.0). --http://lua-users.org/wiki/SimpleLuaClasses function class(base,ctor) local c = {} -- a new class instance if not ctor and type(base) == 'function' then ctor = base base = nil elseif type(base) == 'table' then -- our new class is a shallow copy of the base class! for i,v in pairs(base) do c[i] = v end c._base = base end -- the class will be the metatable for all its objects, -- and they will look up their methods in it. c.__index = c -- expose a ctor which can be called by () local mt = {} mt.__call = function(class_tbl,...) local obj = {} setmetatable(obj,c) if ctor then ctor(obj,...) else -- make sure that any stuff from the base class is initialized! if base and base.init then base.init(obj,...) end end return obj end c.init = ctor c.instanceOf = function(self,klass) local m = getmetatable(self) while m do if m == klass then return true end m = m._base end return false end setmetatable(c,mt) return c end --------Account.lua------ --Import Class template require 'class' local classname = "Account" --Declare class Constructor Account = class(function(acc,balance) --Instance variables declared here. if(balance ~= nil)then acc.balance = balance else --default value acc.balance = 2097 end acc.classname = classname end) --------Account2.lua------ local account2 = {} account2.classname = "unnamed" account2.balance = 2097 -----------Constructor 1 do local metatable = { __index = account2; } function Account2() return setmetatable({}, metatable); end end --------Main.lua------ require 'Account' require 'Account2' MAX_OBJ = 5000; test_value = 1000; Obj_Table = {}; MODE_ACC0 = 0 --integers MODE_ACC1 = 1 --Account MODE_ACC2 = 2 --Account2 TEST_MODE = MODE_ACC0; Lua_mem = ""; print("##1) collectgarbage('count'): " .. collectgarbage('count')); function Load() for i=1, MAX_OBJ do if(TEST_MODE == MODE_ACC0 )then table.insert(Obj_Table, test_value); elseif(TEST_MODE == MODE_ACC1 )then table.insert(Obj_Table, Account(test_value)); --Account.lua elseif(TEST_MODE == MODE_ACC2 )then table.insert(Obj_Table, Account2()); --Account2.lua Obj_Table[i].balance = test_value; end end print("##2) collectgarbage('count'): " .. collectgarbage('count')); end function Purge() --metatable purge if(TEST_MODE ~= MODE_ACC0)then --purge stage 0: print("set each elements metatable to nil") for i=1, MAX_OBJ do setmetatable(Obj_Table[i], nil); end end --purge stage 1: print("set table element to nil") for i=1, MAX_OBJ do Obj_Table[i] = nil; end --purge stage 2: print("start table.remove..."); for i=1, MAX_OBJ do table.remove(Obj_Table, i); end print("...end table.remove"); --purge stage 3: print("create new object_table {}"); Obj_Table= {}; --purge stage 4: print("collectgarbage('collect')"); collectgarbage('collect'); print("##3) collectgarbage('count'): " .. collectgarbage('count')); end --Loop callback function OnUpdate() collectgarbage('collect'); Lua_mem = collectgarbage('count'); end ------------------- --NOTE: --On start of game runs Load(), another runs Purge() --Update I've updated the code with suggestions from comments below, and will post my findings later today.

    Read the article

  • Fetch image from folder via datatable does not work after placing image in subdirectory

    - by Arnold Bishkoff
    I am having trouble wrapping my head around the following I have code that fetches an image via smarty in a line img src="getsnap.php?picid={$data[$smarty.section.sec.index].picno|default:$nextpic}&typ=pic&width={$config.disp_snap_width}&height={$config.disp_snap_height}" class="smallpic" alt="" / this works if i pull the image from /temp/userimages/userid/imageNo.ext but because an OS can segfault if you store too many folders or images in a directory i have code that assigns the user image to a subdirectory based upon division of a subdir per 1000 userids. so in thise case i have user id 94 whos images get stored in /siteroot/temp/userimages/000000/94/pic_1.jpg (through 10) or tn_1 (through 10).jpg here is the code for getsnap.php <?php ob_start(); if ( !defined( 'SMARTY_DIR' ) ) { include_once( 'init.php' ); } include('core/snaps_functions.php'); if (isset($_REQUEST['username']) && $_REQUEST['username'] != '') { $userid = $osDB-getOne('select id from ! where username = ?',array(USER_TABLE, $_REQUEST['username']) ); } else { // include ( 'sessioninc.php' ); if( !isset($_GET['id']) || (isset($_GET['id'])&& (int)$_GET['id'] <= 0 ) ) { $userid = $_SESSION['UserId']; } else { $userid = $_GET['id']; } } if (!isset($_GET['picid']) ) { if ((isset($_REQUEST['type']) && $_REQUEST['type'] != 'gallery') || !isset($_REQUEST['type']) ) { $defpic = $osDB-getOne('select picno from ! where userid = ? and ( album_id is null or album_id = ?) and default_pic = ? and active = ? ',array(USER_SNAP_TABLE, $userid,'0','Y','Y' ) ); if ($defpic != '') { $picid = $defpic; } else { $picid = $osDB-getOne('select picno from ! where userid = ? and ( album_id is null or album_id = ?) and active=? order by rand()',array(USER_SNAP_TABLE, $userid,'0','Y' ) ); } unset( $defpic); } } else { $picid = $_GET['picid']; } $typ = isset( $_GET['typ'])?$_GET['typ']:'pic' ; $cond = ''; if ( ($config['snaps_require_approval'] == 'Y' || $config['snaps_require_approval'] == '1') && $userid != $_SESSION['UserId'] ) { $cond = " and active = 'Y' "; } $sql = 'select * from ! where userid = ? and picno = ? '.$cond; //Get the pic $row =& $osDB-getRow ( $sql, array( USER_SNAP_TABLE, $userid, $picid ) ); //Okay pic was found in the DB, Lets actually do something // $id = $userid; $dir = str_pad(($id - ($id % 1000))/100000,6,'0',STR_PAD_LEFT); $zimg = USER_IMAGES_DIR.$dir; $img = getPicture($zimg, $userid, $picid, $typ, $row); //$img = getPicture($userid, $picid, $typ, $row); //$img = getPicture($dir, $userid, $picid, $typ, $row); $ext = ($typ = 'tn')?$row['tnext']:$row['picext']; // Now pic is built as // something pic_x.ext ie pic_2.jpg if ( $img != '' && ( ( hasRight('seepictureprofile') && ( $config['snaps_require_approval'] == 'Y' && $row['active'] == 'Y' ) ||$config['snaps_require_approval'] == 'N' ) || $userid == $_SESSION['UserId'] ) ) { $img2 = $img; //$img2 = $dir.'/'.$img; } else { $gender = $osDB-getOne( 'select gender from ! where id = ?', array( USER_TABLE, $userid ) ) ; if ($gender == 'M') { $nopic = SKIN_IMAGES_DIR.'male.jpg'; } elseif ($gender == 'F') { $nopic = SKIN_IMAGES_DIR.'female.jpg'; } elseif ($gender == 'D') { $nopic = SKIN_IMAGES_DIR.'director.jpg'; } $img2 = imagecreatefromjpeg($nopic); $ext = 'jpg'; } ob_end_clean(); header("Pragma: public"); header("Content-Type: image/".$ext); header("Content-Transfer-Encoding: binary"); header("Cache-Control: must-revalidate"); $ExpStr = "Expires: " . gmdate("D, d M Y H:i:s", time() - 30) . " GMT"; header($ExpStr); $id = $userid; $dir = str_pad(($id - ($id % 1000))/100000,6,'0',STR_PAD_LEFT); $zimg = USER_IMAGES_DIR.$dir; //header("Content-Disposition: attachment; filename=profile_".$userid."_".$typ.".".$ext); //header("Content-Disposition: attachment; filename=$dir.'/'.profile_".$userid."".$typ.".".$ext); //header("Content-Disposition: attachment; filename=profile"$dir".'/'.".$userid."_".$typ.".".$ext); header("Content-Disposition: attachment; filename=profile_".$userid."_".$typ.".".$ext); /* if ($_SESSION['browser'] != 'MSIE') { header("Content-Disposition: inline" ); } */ if ($ext == 'jpg') { imagejpeg($img2); } elseif ($ext == 'gif') { imagegif($img2); } elseif ($ext == 'png') { imagepng($img2); } elseif ($ext == 'bmp') { imagewbmp($img2); } imagedestroy($img2); ?

    Read the article

  • How to move the mouse

    - by GroundZero
    I'm making a little bot in C#. At the moment it works pretty well, it can load text from a file and type it for you. But for now, I need to manualy click the textfield to put the focus on it, remaximize my form and then click the Type-button. After the typing, I need to manualy slide the scorebar and press submit. I'd like to know how I can move my mouse with C# and if possible, if possible I'd like to load the mouse positions from a xml-file. I need to move to the textfield, click in it to focus on it, start the type script, move to the slider, hold the mouse down on it while dragging, releasing it on the correct position & clicking on the submitbutton This is what I have for now: To load in the variables, I'm using this script: private void Initialize() { XmlTextReader reader = new XmlTextReader(Application.StartupPath + @"..\..\..\CursorPositions.xml"); while (reader.Read()) { switch (reader.NodeType) { case XmlNodeType.Element: // The node is an element. element = reader.Value; break; case XmlNodeType.Text: //Display the text in each element. switch (element) { case "Textbox-X": textX = int.Parse(reader.Value); break; case "Textbox-Y": textY = int.Parse(reader.Value); break; case "SliderBegin-X": sliderX = int.Parse(reader.Value); break; case "SliderBegin-Y": sliderY = int.Parse(reader.Value); break; case "SubmitButton-X": submitX = int.Parse(reader.Value); break; case "SubmitButton-Y": submitY = int.Parse(reader.Value); break; } break; } } This is the xml-file: <?xml version="1.0" encoding="utf-8" ?> <CursorPositions> <Textbox-X>430</Textbox-X> <Textbox-Y>270</Textbox-Y> <SliderBegin-X>430</SliderBegin-X> <SliderBegin-Y>470</SliderBegin-Y> <SubmitButton-X>860</SubmitButton-X> <SubmitButton-Y>365</SubmitButton-Y> </CursorPositions> To move the mouse I'm using this piece of code: public partial class FrmMain : Form { [System.Runtime.InteropServices.DllImport("user32.dll")] public static extern void mouse_event(int dwFlags, int dx, int dy, int cButtons, int dwExtraInfo); public const int MOUSEEVENTF_LEFTDOWN = 0x0002; public const int MOUSEEVENTF_LEFTUP = 0x0004; public const int MOUSEEVENTF_RIGHTDOWN = 0x0008; public const int MOUSEEVENTF_RIGHTUP = 0x0010; ... private void btnStart_Click(object sender, EventArgs e) { // start button (de)activates loop if (!running) { btnStart.Text = "Stop"; btnStart.Cursor = Cursors.No; running = true; } else { btnStart.Text = "Start"; btnStart.Cursor = Cursors.AppStarting; running = false; } while (running) { // move to textbox & type Cursor.Position = new Point(textX, textY); mouse_event(MOUSEEVENTF_LEFTDOWN, textX, textY, 0, 0); mouse_event(MOUSEEVENTF_LEFTUP, textX, textY, 0, 0); Type(); // wait 90 seconds till slider available Thread.Sleep(90 * 1000); // move to slider & slide according to score Cursor.Position = new Point(sliderX, sliderY); mouse_event(MOUSEEVENTF_LEFTDOWN, sliderX, sliderY, 0, 0); Cursor.Position = new Point(sliderX + 345 / 10 * score, sliderY); mouse_event(MOUSEEVENTF_LEFTUP, sliderX + 345 / 10 * score, sliderY, 0, 0); // submit Cursor.Position = new Point(submitX, submitY); mouse_event(MOUSEEVENTF_LEFTDOWN, submitX, submitY, 0, 0); mouse_event(MOUSEEVENTF_LEFTUP, submitX, submitY, 0, 0); // wait 10 sec to be sure it's submitted Thread.Sleep(10 * 1000); // refresh page SendKeys.SendWait("{F5}"); // get new text NewText(); // wait 10 sec to refresh and load song Thread.Sleep(10 * 1000); } } } PS: I get the coordinates via my form. I've got 2 labels that show my X & Y coordinates. To capture them outside the form, I press and hold my Left Mouse Button and 'drag' it outside the form to the correct place. This way I get the coordinates of my mouse outside the form

    Read the article

  • RFC Repository of programming RFC's with ability to direct-link sections or even lines?

    - by Lasse V. Karlsen
    Forgive me if this is the wrong place to ask this, I feel like the question is slightly off-topic even though it is also about programming. I am inputting todo-tasks for my WebDAV-project into my issue tracker, as I read through the relevant RFC's, and it would be nice to be able to add a link in my issue text directly to the relevant text, instead of just a link to the RFC file with a section number in the issue text, and then I have to use the find function to find it. For instance, a link like this: http://ieft.org/rfc2518.txt#1000 <-- line 1000 http://ieft.org/rfc2518.txt#9.8.3 <-- section 9.8.3 Neither of these two works, since they just post the full text files, so my question is this: Does anyone know of hosted versions of the RFC documents that contains such links?

    Read the article

< Previous Page | 45 46 47 48 49 50 51 52 53 54 55 56  | Next Page >