Search Results

Search found 29811 results on 1193 pages for 'table of contents'.

Page 490/1193 | < Previous Page | 486 487 488 489 490 491 492 493 494 495 496 497  | Next Page >

  • print directory using command prompt

    - by Nrew
    Found this one: http://www.watchingthenet.com/how-to-print-a-directory-tree-from-windows-explorer.html But I don't know how do I do it and save the directory listing somewhere. What I want to do is something like that, but I need an output file. Or at least something that I can see. What I need to do is to print the contents of a directory.

    Read the article

  • cygwin permissions for executing .bat files

    - by TomD
    Hey guys, I have a .bat file, which contains the following contents ... jar cfm myjar.jar manifest.txt *.class ... Which executes well under windows command prompt, but when executed under cygwin, I get the following C:\cygwin\home\user\path\to\folderjar cfm myjar.jar manifest.txt *.class Access is denied. I tried starting cygwin as administrator, but it does not help Would appreciate any suggestions Thanks

    Read the article

  • How to verify /boot partition on encrypted LVM setup

    - by ml43
    Isn't unencrypted /boot partition a weakness for encrypted LVM setup? Attacker may install a malware to /boot partition so that it may sniff encryption password next time system boots. It may also be done by a malware installed to Windows on dual-boot system without any physical access. Am I missing some protection scheme or at least I may verify that /boot contents didn't change since last system shutdown?

    Read the article

  • Windows 7 showing subfiles when saving files from internet?

    - by mezamorphic
    Within the last week, whenever I go to save a file from the internet when I save to "Documents" it doesn't show just what is in My Documents at the higher level, it shows all the contents of every sub-folder. I haven't changed any settings- how can I get this back to normal (so that files of sub-folders are not shown when saving)? I tried with both Chrome and IE so it's not the browser doing it. The problem seems to only happen with My Documents, no other folders like Downloads etc.

    Read the article

  • How to wipe free disk space in Linux?

    - by Alex B
    When a file is deleted, its contents may still be left in the filesystem, unless explicitly overwritten with something else. "wipe" can securely erase files, but does not seem to allow erasing free disk space not used by any files. What should I use to achieve this?

    Read the article

  • Win 7 64-bit - looking for command line interface for setting Index properties for many files

    - by Sherryl
    I'm looking for a way to set a group of File Types to "Index Properties and File Contents" (Control Panel, Indexing Options, Advanced Options, File Types). Basically I'd like to write a batch file that switches that setting for a large group of file types and be able to share it with my entire team. Clicking in the UI is time consuming for everyone. This is a great solution for bringing up the GUI, but I'd like to create a batch file What is the command line for Indexing Options?

    Read the article

  • Lenovo Windows 8 EFI restore from image

    - by anderhil
    First time here. I have bought e530 with windows 8 and the first hour of work with it i have a problem. I have ssd with windows 7 which i want to use with my new e530. I have made a sysprep of win 7 and installed ssd to the e530. The HDD which was inside e530 i want to use as second hdd instead of my DVD Drive. I connected this HDD through usb-to-sata adapter to copy some files from ssd to the hdd. Unfortunately it didn't see the file system on the HDD (but first time i have booted to it and first boot into Windows 8) I've made some mistakes and i corrupt the filesystem on the hdd. I tried bunch of tricks to recover the GPT, but it didn't work. I have managed to recover the Lenovo_Recovery partition to my ssd using recovery tools. And now I'm stuck, with this new things to me - EFI, GPT, etc i don't how this stuff works, and i have been trying to understand this for hours - but nothing seems to work. I want to restore the Windows 8 to the hdd, so it is there alive. What i have done so far: Formated the HDD I took the PBRALL file from the Lenovo_Recovery " convert gpt create partition Primary size=1000 ID=DE94BBA4-06D1-4D40-A16A-BFD50179D6AC gpt attributes=0x8000000000000001 assign letter=W format quick LABEL=WINRE_DRV create partition efi size=260 assign letter=s format quick fs=fat32 LABEL=SYSTEM_DRV create par msr size=128 create partition primary noerr assign letter=t format quick LABEL=Windows8_OS shrink desired=12197 create partition Primary ID=DE94BBA4-06D1-4D40-A16A-BFD50179D6AC gpt attributes=0x8000000000000001 assign letter=q format quick LABEL=Lenovo_Recovery " it recreated the partitions copied contents of SDRIVE.zip to SYSTEM_DRV partition copied contents of WDRIVE.zip to WINRE_DRV partition Copied restored Lenovo_Recovery back to Lenovo_Recovery partition So now I have 3 system partitions: SYSTE_DRV BOOT boot.sdi EFI BOOT bootx64.efi LenovoBT.efi Lenovo ... Microsoft ... WINRE_DRV\Recovery\WindowsRE\winre.wim Lenovo_Recovery (whic contains install.wim and bunch of other things) So i put back the HDD inside the laptop and tried to boot - but nothing works. It just doesn't boot to anything - no errors - nothing at all. When I choose this HDD manually for boot - just black screen blinks and that's all - it returns back to the devices boot menu. SYSTEM_DRV is EFI partition, so I don't understand why it doesn't boot, it has files needed inside. Can anybody tell me what should be done to make it boot to recovery console or smth like that? How to restore the Windows 8 from the Lenovo_Recovery install.wim image? As I understand I have all the files where they should be, but why it doesn't work? How to troubleshoot such things? Also, if somebody has good link where EFI booting process is explained in details that would be great. Cause i still don't understand how it knows what partition to boot?

    Read the article

  • I added __git_ps1 to my PS1 in .bash_profile, now I'm getting (master) for all folders that aren't git repos.

    - by Matthew
    I'm on a Mac (10.6.5). Here's an example of what's going wrong: [m@m ~ (master)]$ cd ~/Documents [m@m ~/Documents (master)]$ cd ~/Applications [m@m ~/Applications (master)]$ cd ~/Library [m@m ~/Library (master)]$ cd ~/Sites/somesite [m@m ~/Sites/somerepo (FEATURE_SOMEFEATURE)]$ Here's the relevant contents of my .bash_profile: source ~/.git-completion.bash PS1='[\u@\h \w$(__git_ps1 " (%s)")]\$ ' I'm using the standard git-completion script - I just copied it to my home directory.

    Read the article

  • Im using Thuderbird IMAP accesing my Gmail account, what folder needs to subscribe and what safe to unsubscribe?

    - by Me Wowlol
    Im using Thuderbird IMAP accesing my Gmail account, what folder needs to subscribe and what safe to unsubscribe? I ask this because I noticed that the messages inside say example: Important Folder, Starred Folder, etc, have the same contents meaning they are also have copies in either Sent Items and/or Inbox. How to resolve this? If I unsubscribe to all the folder but except Inbox and Sent Items only, will I be missing something on my messages? Thanks you

    Read the article

  • Windows 7 task bar hover preview

    - by y0mbo
    In Windows 7, when you hover over an application in your task bar, a preview is generated showing the contents of the application window. Another option just displays the names of the windows. Somehow, I've turned off the preview and it only displays the window names. How do I change it back?

    Read the article

  • How do I traverse the filesystem looking for a regex match?

    - by editor
    I know this is teeball for veteran sysadmins, but I'm looking to search a directory tree for file contents that match a regex (here, the word "Keyword"). I've gotten that far, but now I'm having trouble ignoring files in a hidden (.svn) file tree. Here's what I'm working with: find . -exec grep "Keyword" '{}' \; -print Reading sites via search I know that I need to negate the name flag, but I can't it working in the right order.

    Read the article

  • Mac: Resize windows partition w/o destroying data?

    - by jbehren
    Is there a method/utility to actively resize the partitions on a dual-boot macbook air, without destroying the contents? I made the Windows Partition too small initially, and all the places I've looked have stated that resizing now using bootcamp will destroy all data on the Win7 Partition. I would prefer free, but I'm open to a reasonably priced utility that can grow the Win7 partition into the available space (I can use bootcamp to shrink the OSX partition without any problems).

    Read the article

  • Is there any way to change the VirtualBox "snapshot" folder for an existing virtual machine?

    - by Richard J Foster
    I have a virtual machine which is currently using a folder on the C: drive to store its snapshots. I have copied the contents of the "Snapshots" folder to an alternate drive, but whenever I go into the General / Advanced settings section for that virtual machine and change the snapshot folder to the new location it resets back to the original location. What do I need to do to get VirtualBox to recognize the new location for the snapshot files?

    Read the article

  • Back button of Adobe PDF Reader after clicking a hyperlink whose target is on the same document

    - by artknish
    PDF documents have hyperlinks to the contents on the same document (analogous to "#section" hrefs for an HTML document). Where's the back button to go back to the page I was on (where I clicked the hyperlink). Let's say I'm on the index of a PDF tutorial, page 4, and I click on Chapter 2's hyperlink in the index that takes me to page 38. Now, if I want to go back to page 4 again, which button or shortcut should I use?

    Read the article

  • How can I avoid Excel reformatting the scientific notation numbers I enter?

    - by Diomidis Spinellis
    When I enter a number like 8230e12 into a Microsoft Excel 2000 cell, Excel changes the number I entered into 8230000000000000. (This is what I get when I press F2 to edit the cell's contents, not what Excel displays in the cell). How can I force Excel to keep the data in the format I typed it and still be able to format it and use it as a number? Displaying the cell in scientific notation is not enough, because the exponent is not the same one as the one I typed.

    Read the article

  • Use Google Chrome to download a software, but the software is in Chinese?

    - by VictorPrograss
    I am recently using Google Chrome to download software installation files from an English authorized website. But, when I installed them on my computer, they appeared to be in Chinese (I am using a Chinese version of Windows 7). However, it was weird that the built-in web browser in one of those softwares searches up English help contents. Could you please tell me what's going on over here?? Thank you very much!!

    Read the article

  • Back button of Adobe PDF Reader after clicking a hyperlink whose target is on the same document

    - by artknish
    PDF documents have hyperlinks to the contents on the same document (analogous to "#section" hrefs for an HTML document). Where's the back button to go back to the page I was on (where I clicked the hyperlink). Let's say I'm on the index of a PDF tutorial, page 4, and I click on Chapter 2's hyperlink in the index that takes me to page 38. Now, if I want to go back to page 4 again, which button or shortcut should I use?

    Read the article

  • EXC_BAD_INSTRUCTION (SIGILL) at random during use of app. Bug in AppKit?

    - by Ger Teunis
    I'm currently testing a new version of an app of mine on OSX 10.5 An user reported some weird crashes during use of the application, sadly not reproducible by me. At first sight it seems to happen randomly, once he had the crash while opening an NSOpenPanel and once during focusing an NSTextField and once during NSView switch in a parent view. If you have any idea which area I should look at it would be greatly appreciated! I'm completely lost here. App is compiled in XCode 3.2.1 with SDK 10.5 and targetted at 10.5 He send me these crashes: Crash 1 Process: NZBVortex [43622] Path: /Users/cero/Downloads/NZBVortex.app/Contents/MacOS/NZBVortex Identifier: com.NZBVortex.NZBVortex Version: 0.5.5 (0.5.5) Code Type: X86-64 (Native) Parent Process: launchd [97] Interval Since Last Report: 1951 sec Crashes Since Last Report: 1 Per-App Interval Since Last Report: 1858 sec Per-App Crashes Since Last Report: 1 Date/Time: 2010-03-23 23:43:49.671 +0100 OS Version: Mac OS X 10.5.8 (9L31a) Report Version: 6 Anonymous UUID: 98AB0386-590B-4E0D-B7AC-3F7AA4E7238E Exception Type: EXC_BAD_INSTRUCTION (SIGILL) Exception Codes: 0x0000000000000001, 0x0000000000000000 Crashed Thread: 0 Application Specific Information: objc[43622]: alt handlers in objc runtime are buggy! - Hide quoted text - Thread 0 Crashed: 0 libobjc.A.dylib 0x00007fff82baef6e _objc_fatal + 238 1 libobjc.A.dylib 0x00007fff82bb2ea4 objc_addExceptionHandler + 302 2 com.apple.CoreFoundation 0x00007fff842b1090 _CFDoExceptionOperation + 528 3 com.apple.AppKit 0x00007fff81f75e26 _NSAppKitLock + 81 4 com.apple.AppKit 0x00007fff81f80f8f -[NSView nextKeyView] + 56 5 com.apple.AppKit 0x00007fff81f81018 -[NSView _primitiveSetNextKeyView:] + 72 6 com.apple.AppKit 0x00007fff820732b1 -[NSView _recursiveSetDefaultKeyViewLoop] + 242 7 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 8 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 9 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 10 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 11 com.apple.AppKit 0x00007fff82072fc3 -[NSView _setDefaultKeyViewLoop] + 279 12 com.apple.AppKit 0x00007fff82072e70 -[NSWindow recalculateKeyViewLoop] + 36 13 com.apple.AppKit 0x00007fff821dd149 -[NSSavePanel(NSSavePanelRuntime) _loadPreviousModeAndLayout] + 39 14 com.apple.AppKit 0x00007fff821dcf9e -[NSSavePanel(NSSavePanelRuntime) runModalForDirectory:file:types:] + 71 15 com.NZBVortex.NZBVortex 0x000000010000b7ee -[MainWindowViewController openNZBFileButtonClick:] + 62 16 com.apple.AppKit 0x00007fff821c96bf -[NSToolbarButton sendAction:to:] + 77 17 com.apple.AppKit 0x00007fff821c8bb7 -[NSToolbarItemViewer mouseDown:] + 5362 18 com.apple.AppKit 0x00007fff82082783 -[NSWindow sendEvent:] + 5068 19 com.apple.AppKit 0x00007fff8204fd46 -[NSApplication sendEvent:] + 5089 20 com.apple.AppKit 0x00007fff81faa562 -[NSApplication run] + 497 21 com.apple.AppKit 0x00007fff81f772f0 NSApplicationMain + 373 22 com.NZBVortex.NZBVortex 0x0000000100012a69 main + 9 23 com.NZBVortex.NZBVortex 0x0000000100001a84 start + 52 Crash 2 Process: NZBVortex [43600] Path: /Users/cero/Downloads/NZBVortex.app/Contents/MacOS/NZBVortex Identifier: com.NZBVortex.NZBVortex Version: 0.5.5 (0.5.5) Code Type: X86-64 (Native) Parent Process: launchd [97] Interval Since Last Report: 727 sec Crashes Since Last Report: 1 Per-App Interval Since Last Report: 616 sec Per-App Crashes Since Last Report: 1 Date/Time: 2010-03-23 23:11:20.000 +0100 OS Version: Mac OS X 10.5.8 (9L31a) Report Version: 6 Anonymous UUID: 98AB0386-590B-4E0D-B7AC-3F7AA4E7238E Exception Type: EXC_BAD_INSTRUCTION (SIGILL) Exception Codes: 0x0000000000000001, 0x0000000000000000 Crashed Thread: 0 Application Specific Information: objc[43600]: alt handlers in objc runtime are buggy! Thread 0 Crashed: 0 libobjc.A.dylib 0x00007fff82baef6e _objc_fatal + 238 1 libobjc.A.dylib 0x00007fff82bb2ea4 objc_addExceptionHandler + 302 2 com.apple.CoreFoundation 0x00007fff842b1090 _CFDoExceptionOperation + 528 3 com.apple.AppKit 0x00007fff81f75e26 _NSAppKitLock + 81 4 com.apple.AppKit 0x00007fff81f80f8f -[NSView nextKeyView] + 56 5 com.apple.AppKit 0x00007fff81f81018 -[NSView _primitiveSetNextKeyView:] + 72 6 com.apple.AppKit 0x00007fff820732b1 -[NSView _recursiveSetDefaultKeyViewLoop] + 242 7 com.apple.AppKit 0x00007fff82156700 -[NSTabView _recursiveSetDefaultKeyViewLoop] + 119 8 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 9 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 10 com.apple.AppKit 0x00007fff82072fc3 -[NSView _setDefaultKeyViewLoop] + 279 11 com.apple.AppKit 0x00007fff82072e70 -[NSWindow recalculateKeyViewLoop] + 36 12 com.NZBVortex.NZBVortex 0x000000010000b527 -[MainWindowViewController showView:sender:] + 1639 13 com.NZBVortex.NZBVortex 0x000000010000ae6b -[MainWindowViewController preferencesSaveAlertDidEnd:returnCode:contextInfo:] + 91 14 com.apple.AppKit 0x00007fff82224291 -[NSAlert didEndAlert:returnCode:contextInfo:] + 107 15 com.apple.AppKit 0x00007fff82224197 -[NSAlert buttonPressed:] + 279 16 com.apple.AppKit 0x00007fff82085d46 -[NSApplication sendAction:to:from:] + 97 17 com.apple.AppKit 0x00007fff82085c7f -[NSControl sendAction:to:] + 97 18 com.apple.AppKit 0x00007fff820851b0 -[NSCell trackMouse:inRect:ofView:untilMouseUp:] + 1841 19 com.apple.AppKit 0x00007fff820849d6 -[NSButtonCell trackMouse:inRect:ofView:untilMouseUp:] + 611 20 com.apple.AppKit 0x00007fff8208422f -[NSControl mouseDown:] + 735 21 com.apple.AppKit 0x00007fff82082783 -[NSWindow sendEvent:] + 5068 22 com.apple.AppKit 0x00007fff8204fd46 -[NSApplication sendEvent:] + 5089 23 com.apple.AppKit 0x00007fff81faa562 -[NSApplication run] + 497 24 com.apple.AppKit 0x00007fff81f772f0 NSApplicationMain + 373 25 com.NZBVortex.NZBVortex 0x0000000100012a69 main + 9 26 com.NZBVortex.NZBVortex 0x0000000100001a84 start + 52 Crash 3 Process: NZBVortex [43520] Path: /Users/cero/Downloads/NZBVortex.app/Contents/MacOS/NZBVortex Identifier: com.NZBVortex.NZBVortex Version: 0.5.5 (0.5.5) Code Type: X86-64 (Native) Parent Process: launchd [97] Interval Since Last Report: 23487 sec Crashes Since Last Report: 2 Per-App Interval Since Last Report: 2025 sec Per-App Crashes Since Last Report: 1 Date/Time: 2010-03-23 22:59:05.484 +0100 OS Version: Mac OS X 10.5.8 (9L31a) Report Version: 6 Anonymous UUID: 98AB0386-590B-4E0D-B7AC-3F7AA4E7238E Exception Type: EXC_BAD_INSTRUCTION (SIGILL) Exception Codes: 0x0000000000000001, 0x0000000000000000 Crashed Thread: 0 Application Specific Information: objc[43520]: alt handlers in objc runtime are buggy! Thread 0 Crashed: 0 libobjc.A.dylib 0x00007fff82baef6e _objc_fatal + 238 1 libobjc.A.dylib 0x00007fff82bb2ea4 objc_addExceptionHandler + 302 2 com.apple.CoreFoundation 0x00007fff842b1090 _CFDoExceptionOperation + 528 3 com.apple.AppKit 0x00007fff81f75e26 _NSAppKitLock + 81 4 com.apple.AppKit 0x00007fff81f80f8f -[NSView nextKeyView] + 56 5 com.apple.AppKit 0x00007fff81f81018 -[NSView _primitiveSetNextKeyView:] + 72 6 com.apple.AppKit 0x00007fff820732b1 -[NSView _recursiveSetDefaultKeyViewLoop] + 242 7 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 8 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 9 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 10 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 11 com.apple.AppKit 0x00007fff82072fc3 -[NSView _setDefaultKeyViewLoop] + 279 12 com.apple.AppKit 0x00007fff82072e70 -[NSWindow recalculateKeyViewLoop] + 36 13 com.apple.AppKit 0x00007fff821dd149 -[NSSavePanel(NSSavePanelRuntime) _loadPreviousModeAndLayout] + 39 14 com.apple.AppKit 0x00007fff821dcf9e -[NSSavePanel(NSSavePanelRuntime) runModalForDirectory:file:types:] + 71 15 com.NZBVortex.NZBVortex 0x000000010000b7ee -[MainWindowViewController openNZBFileButtonClick:] + 62 16 com.apple.AppKit 0x00007fff821c96bf -[NSToolbarButton sendAction:to:] + 77 17 com.apple.AppKit 0x00007fff821c8bb7 -[NSToolbarItemViewer mouseDown:] + 5362 18 com.apple.AppKit 0x00007fff82082783 -[NSWindow sendEvent:] + 5068 19 com.apple.AppKit 0x00007fff8204fd46 -[NSApplication sendEvent:] + 5089 20 com.apple.AppKit 0x00007fff81faa562 -[NSApplication run] + 497 21 com.apple.AppKit 0x00007fff81f772f0 NSApplicationMain + 373 22 com.NZBVortex.NZBVortex 0x0000000100012a69 main + 9 23 com.NZBVortex.NZBVortex 0x0000000100001a84 start + 52

    Read the article

  • ASM programming, how to use loop?

    - by chris
    Hello. Im first time here.I am a college student. I've created a simple program by using assembly language. And im wondering if i can use loop method to run it almost samething as what it does below the program i posted. and im also eager to find someome who i can talk through MSN messanger so i can ask you questions right away.(if possible) ok thank you .MODEL small .STACK 400h .data prompt db 10,13,'Please enter a 3 digit number, example 100:',10,13,'$' ;10,13 cause to go to next line first_digit db 0d second_digit db 0d third_digit db 0d Not_prime db 10,13,'This number is not prime!',10,13,'$' prime db 10,13,'This number is prime!',10,13,'$' question db 10,13,'Do you want to contine Y/N $' counter dw 0d number dw 0d half dw ? .code Start: mov ax, @data ;establish access to the data segment mov ds, ax mov number, 0d LetsRoll: mov dx, offset prompt ; print the string (please enter a 3 digit...) mov ah, 9h int 21h ;execute ;read FIRST DIGIT mov ah, 1d ;bios code for read a keystroke int 21h ;call bios, it is understood that the ascii code will be returned in al mov first_digit, al ;may as well save a copy sub al, 30h ;Convert code to an actual integer cbw ;CONVERT BYTE TO WORD. This takes whatever number is in al and ;extends it to ax, doubling its size from 8 bits to 16 bits ;The first digit now occupies all of ax as an integer mov cx, 100d ;This is so we can calculate 100*1st digit +10*2nd digit + 3rd digit mul cx ;start to accumulate the 3 digit number in the variable imul cx ;it is understood that the other operand is ax ;AND that the result will use both dx::ax ;but we understand that dx will contain only leading zeros add number, ax ;save ;variable <number> now contains 1st digit * 10 ;---------------------------------------------------------------------- ;read SECOND DIGIT, multiply by 10 and add in mov ah, 1d ;bios code for read a keystroke int 21h ;call bios, it is understood that the ascii code will be returned in al mov second_digit, al ;may as well save a copy sub al, 30h ;Convert code to an actual integer cbw ;CONVERT BYTE TO WORD. This takes whatever number is in al and ;extends it to ax, boubling its size from 8 bits to 16 bits ;The first digit now occupies all of ax as an integer mov cx, 10d ;continue to accumulate the 3 digit number in the variable mul cx ;it is understood that the other operand is ax, containing first digit ;AND that the result will use both dx::ax ;but we understand that dx will contain only leading zeros. Ignore them add number, ax ;save -- nearly finished ;variable <number> now contains 1st digit * 100 + second digit * 10 ;---------------------------------------------------------------------- ;read THIRD DIGIT, add it in (no multiplication this time) mov ah, 1d ;bios code for read a keystroke int 21h ;call bios, it is understood that the ascii code will be returned in al mov third_digit, al ;may as well save a copy sub al, 30h ;Convert code to an actual integer cbw ;CONVERT BYTE TO WORD. This takes whatever number is in al and ;extends it to ax, boubling its size from 8 bits to 16 bits ;The first digit now occupies all of ax as an integer add number, ax ;Both my variable number and ax are 16 bits, so equal size mov ax, number ;copy contents of number to ax mov cx, 2h div cx ;Divide by cx mov half, ax ;copy the contents of ax to half mov cx, 2h; mov ax, number; ;copy numbers to ax xor dx, dx ;flush dx jmp prime_check ;jump to prime check print_question: mov dx, offset question ;print string (do you want to continue Y/N?) mov ah, 9h int 21h ;execute mov ah, 1h int 21h ;execute cmp al, 4eh ;compare je Exit ;jump to exit cmp al, 6eh ;compare je Exit ;jump to exit cmp al, 59h ;compare je Start ;jump to start cmp al, 79h ;compare je Start ;jump to start prime_check: div cx; ;Divide by cx cmp dx, 0h ;reset the value of dx je print_not_prime ;jump to not prime xor dx, dx; ;flush dx mov ax, number ;copy the contents of number to ax cmp cx, half ;compare half with cx je print_prime ;jump to print prime section inc cx; ;increment cx by one jmp prime_check ;repeat the prime check print_prime: mov dx, offset prime ;print string (this number is prime!) mov ah, 9h int 21h ;execute jmp print_question ;jumps to question (do you want to continue Y/N?) this is for repeat print_not_prime: mov dx, offset Not_prime ;print string (this number is not prime!) mov ah, 9h int 21h ;execute jmp print_question ;jumps to question (do you want to continue Y/N?) this is for repeat Exit: mov ah, 4ch int 21h ;execute exit END Start

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Guide to reduce TFS database growth using the Test Attachment Cleaner

    - by terje
    Recently there has been several reports on TFS databases growing too fast and growing too big.  Notable this has been observed when one has started to use more features of the Testing system.  Also, the TFS 2010 handles test results differently from TFS 2008, and this leads to more data stored in the TFS databases. As a consequence of this there has been released some tools to remove unneeded data in the database, and also some fixes to correct for bugs which has been found and corrected during this process.  Further some preventive practices and maintenance rules should be adopted. A lot of people have blogged about this, among these are: Anu’s very important blog post here describes both the problem and solutions to handle it.  She describes both the Test Attachment Cleaner tool, and also some QFE/CU releases to fix some underlying bugs which prevented the tool from being fully effective. Brian Harry’s blog post here describes the problem too This forum thread describes the problem with some solution hints. Ravi Shanker’s blog post here describes best practices on solving this (TBP) Grant Holidays blogpost here describes strategies to use the Test Attachment Cleaner both to detect space problems and how to rectify them.   The problem can be divided into the following areas: Publishing of test results from builds Publishing of manual test results and their attachments in particular Publishing of deployment binaries for use during a test run Bugs in SQL server preventing total cleanup of data (All the published data above is published into the TFS database as attachments.) The test results will include all data being collected during the run.  Some of this data can grow rather large, like IntelliTrace logs and video recordings.   Also the pushing of binaries which happen for automated test runs, including tests run during a build using code coverage which will include all the files in the deployment folder, contributes a lot to the size of the attached data.   In order to handle this systematically, I have set up a 3-stage process: Find out if you have a database space issue Set up your TFS server to minimize potential database issues If you have the “problem”, clean up the database and otherwise keep it clean   Analyze the data Are your database( s) growing ?  Are unused test results growing out of proportion ? To find out about this you need to query your TFS database for some of the information, and use the Test Attachment Cleaner (TAC) to obtain some  more detailed information. If you don’t have too many databases you can use the SQL Server reports from within the Management Studio to analyze the database and table sizes. Or, you can use a set of queries . I find queries often faster to use because I can tweak them the way I want them.  But be aware that these queries are non-documented and non-supported and may change when the product team wants to change them. If you have multiple Project Collections, find out which might have problems: (Disclaimer: The queries below work on TFS 2010. They will not work on Dev-11, since the table structure have been changed.  I will try to update them for Dev-11 when it is released.) Open a SQL Management Studio session onto the SQL Server where you have your TFS Databases. Use the query below to find the Project Collection databases and their sizes, in descending size order.  use master select DB_NAME(database_id) AS DBName, (size/128) SizeInMB FROM sys.master_files where type=0 and substring(db_name(database_id),1,4)='Tfs_' and DB_NAME(database_id)<>'Tfs_Configuration' order by size desc Doing this on one of our SQL servers gives the following results: It is pretty easy to see on which collection to start the work   Find out which tables are possibly too large Keep a special watch out for the Tfs_Attachment table. Use the script at the bottom of Grant’s blog to find the table sizes in descending size order. In our case we got this result: From Grant’s blog we learnt that the tbl_Content is in the Version Control category, so the major only big issue we have here is the tbl_AttachmentContent.   Find out which team projects have possibly too large attachments In order to use the TAC to find and eventually delete attachment data we need to find out which team projects have these attachments. The team project is a required parameter to the TAC. Use the following query to find this, replace the collection database name with whatever applies in your case:   use Tfs_DefaultCollection select p.projectname, sum(a.compressedlength)/1024/1024 as sizeInMB from dbo.tbl_Attachment as a inner join tbl_testrun as tr on a.testrunid=tr.testrunid inner join tbl_project as p on p.projectid=tr.projectid group by p.projectname order by sum(a.compressedlength) desc In our case we got this result (had to remove some names), out of more than 100 team projects accumulated over quite some years: As can be seen here it is pretty obvious the “Byggtjeneste – Projects” are the main team project to take care of, with the ones on lines 2-4 as the next ones.  Check which attachment types takes up the most space It can be nice to know which attachment types takes up the space, so run the following query: use Tfs_DefaultCollection select a.attachmenttype, sum(a.compressedlength)/1024/1024 as sizeInMB from dbo.tbl_Attachment as a inner join tbl_testrun as tr on a.testrunid=tr.testrunid inner join tbl_project as p on p.projectid=tr.projectid group by a.attachmenttype order by sum(a.compressedlength) desc We then got this result: From this it is pretty obvious that the problem here is the binary files, as also mentioned in Anu’s blog. Check which file types, by their extension, takes up the most space Run the following query use Tfs_DefaultCollection select SUBSTRING(filename,len(filename)-CHARINDEX('.',REVERSE(filename))+2,999)as Extension, sum(compressedlength)/1024 as SizeInKB from tbl_Attachment group by SUBSTRING(filename,len(filename)-CHARINDEX('.',REVERSE(filename))+2,999) order by sum(compressedlength) desc This gives a result like this:   Now you should have collected enough information to tell you what to do – if you got to do something, and some of the information you need in order to set up your TAC settings file, both for a cleanup and for scheduled maintenance later.    Get your TFS server and environment properly set up Even if you have got the problem or if have yet not got the problem, you should ensure the TFS server is set up so that the risk of getting into this problem is minimized.  To ensure this you should install the following set of updates and components. The assumption is that your TFS Server is at SP1 level. Install the QFE for KB2608743 – which also contains detailed instructions on its use, download from here. The QFE changes the default settings to not upload deployed binaries, which are used in automated test runs. Binaries will still be uploaded if: Code coverage is enabled in the test settings. You change the UploadDeploymentItem to true in the testsettings file. Be aware that this might be reset back to false by another user which haven't installed this QFE. The hotfix should be installed to The build servers (the build agents) The machine hosting the Test Controller Local development computers (Visual Studio) Local test computers (MTM) It is not required to install it to the TFS Server, test agents or the build controller – it has no effect on these programs. If you use the SQL Server 2008 R2 you should also install the CU 10 (or later).  This CU fixes a potential problem of hanging “ghost” files.  This seems to happen only in certain trigger situations, but to ensure it doesn’t bite you, it is better to make sure this CU is installed. There is no such CU for SQL Server 2008 pre-R2 Work around:  If you suspect hanging ghost files, they can be – with some mental effort, deduced from the ghost counters using the following SQL query: use master SELECT DB_NAME(database_id) as 'database',OBJECT_NAME(object_id) as 'objectname', index_type_desc,ghost_record_count,version_ghost_record_count,record_count,avg_record_size_in_bytes FROM sys.dm_db_index_physical_stats (DB_ID(N'<DatabaseName>'), OBJECT_ID(N'<TableName>'), NULL, NULL , 'DETAILED') The problem is a stalled ghost cleanup process.  Restarting the SQL server after having stopped all components that depends on it, like the TFS Server and SPS services – that is all applications that connect to the SQL server. Then restart the SQL server, and finally start up all dependent processes again.  (I would guess a complete server reboot would do the trick too.) After this the ghost cleanup process will run properly again. The fix will come in the next CU cycle for SQL Server R2 SP1.  The R2 pre-SP1 and R2 SP1 have separate maintenance cycles, and are maintained individually. Each have its own set of CU’s. When it comes I will add the link here to that CU. The "hanging ghost file” issue came up after one have run the TAC, and deleted enourmes amount of data.  The SQL Server can get into this hanging state (without the QFE) in certain cases due to this. And of course, install and set up the Test Attachment Cleaner command line power tool.  This should be done following some guidelines from Ravi Shanker: “When you run TAC, ensure that you are deleting small chunks of data at regular intervals (say run TAC every night at 3AM to delete data that is between age 730 to 731 days) – this will ensure that small amounts of data are being deleted and SQL ghosted record cleanup can catch up with the number of deletes performed. “ This rule minimizes the risk of the ghosted hang problem to occur, and further makes it easier for the SQL server ghosting process to work smoothly. “Run DBCC SHRINKDB post the ghosted records are cleaned up to physically reclaim the space on the file system” This is the last step in a 3 step process of removing SQL server data. First they are logically deleted. Then they are cleaned out by the ghosting process, and finally removed using the shrinkdb command. Cleaning out the attachments The TAC is run from the command line using a set of parameters and controlled by a settingsfile.  The parameters point out a server uri including the team project collection and also point at a specific team project. So in order to run this for multiple team projects regularly one has to set up a script to run the TAC multiple times, once for each team project.  When you install the TAC there is a very useful readme file in the same directory. When the deployment binaries are published to the TFS server, ALL items are published up from the deployment folder. That often means much more files than you would assume are necessary. This is a brute force technique. It works, but you need to take care when cleaning up. Grant has shown how their settings file looks in his blog post, removing all attachments older than 180 days , as long as there are no active workitems connected to them. This setting can be useful to clean out all items, both in a clean-up once operation, and in a general There are two scenarios we need to consider: Cleaning up an existing overgrown database Maintaining a server to avoid an overgrown database using scheduled TAC   1. Cleaning up a database which has grown too big due to these attachments. This job is a “Once” job.  We do this once and then move on to make sure it won’t happen again, by taking the actions in 2) below.  In this scenario you should only consider the large files. Your goal should be to simply reduce the size, and don’t bother about  the smaller stuff. That can be left a scheduled TAC cleanup ( 2 below). Here you can use a very general settings file, and just remove the large attachments, or you can choose to remove any old items.  Grant’s settings file is an example of the last one.  A settings file to remove only large attachments could look like this: <!-- Scenario : Remove large files --> <DeletionCriteria> <TestRun /> <Attachment> <SizeInMB GreaterThan="10" /> </Attachment> </DeletionCriteria> Or like this: If you want only to remove dll’s and pdb’s about that size, add an Extensions-section.  Without that section, all extensions will be deleted. <!-- Scenario : Remove large files of type dll's and pdb's --> <DeletionCriteria> <TestRun /> <Attachment> <SizeInMB GreaterThan="10" /> <Extensions> <Include value="dll" /> <Include value="pdb" /> </Extensions> </Attachment> </DeletionCriteria> Before you start up your scheduled maintenance, you should clear out all older items. 2. Scheduled maintenance using the TAC If you run a schedule every night, and remove old items, and also remove them in small batches.  It is important to run this often, like every night, in order to keep the number of deleted items low. That way the SQL ghost process works better. One approach could be to delete all items older than some number of days, let’s say 180 days. This could be combined with restricting it to keep attachments with active or resolved bugs.  Doing this every night ensures that only small amounts of data is deleted. <!-- Scenario : Remove old items except if they have active or resolved bugs --> <DeletionCriteria> <TestRun> <AgeInDays OlderThan="180" /> </TestRun> <Attachment /> <LinkedBugs> <Exclude state="Active" /> <Exclude state="Resolved"/> </LinkedBugs> </DeletionCriteria> In my experience there are projects which are left with active or resolved workitems, akthough no further work is done.  It can be wise to have a cleanup process with no restrictions on linked bugs at all. Note that you then have to remove the whole LinkedBugs section. A approach which could work better here is to do a two step approach, use the schedule above to with no LinkedBugs as a sweeper cleaning task taking away all data older than you could care about.  Then have another scheduled TAC task to take out more specifically attachments that you are not likely to use. This task could be much more specific, and based on your analysis clean out what you know is troublesome data. <!-- Scenario : Remove specific files early --> <DeletionCriteria> <TestRun > <AgeInDays OlderThan="30" /> </TestRun> <Attachment> <SizeInMB GreaterThan="10" /> <Extensions> <Include value="iTrace"/> <Include value="dll"/> <Include value="pdb"/> <Include value="wmv"/> </Extensions> </Attachment> <LinkedBugs> <Exclude state="Active" /> <Exclude state="Resolved" /> </LinkedBugs> </DeletionCriteria> The readme document for the TAC says that it recognizes “internal” extensions, but it does recognize any extension. To run the tool do the following command: tcmpt attachmentcleanup /collection:your_tfs_collection_url /teamproject:your_team_project /settingsfile:path_to_settingsfile /outputfile:%temp%/teamproject.tcmpt.log /mode:delete   Shrinking the database You could run a shrink database command after the TAC has run in cases where there are a lot of data being deleted.  In this case you SHOULD do it, to free up all that space.  But, after the shrink operation you should do a rebuild indexes, since the shrink operation will leave the database in a very fragmented state, which will reduce performance. Note that you need to rebuild indexes, reorganizing is not enough. For smaller amounts of data you should NOT shrink the database, since the data will be reused by the SQL server when it need to add more records.  In fact, it is regarded as a bad practice to shrink the database regularly.  So on a daily maintenance schedule you should NOT shrink the database. To shrink the database you do a DBCC SHRINKDATABASE command, and then follow up with a DBCC INDEXDEFRAG afterwards.  I find the easiest way to do this is to create a SQL Maintenance plan including the Shrink Database Task and the Rebuild Index Task and just execute it when you need to do this.

    Read the article

  • JMS Step 6 - How to Set Up an AQ JMS (Advanced Queueing JMS) for SOA Purposes

    - by John-Brown.Evans
    JMS Step 6 - How to Set Up an AQ JMS (Advanced Queueing JMS) for SOA Purposes .jblist{list-style-type:disc;margin:0;padding:0;padding-left:0pt;margin-left:36pt} ol{margin:0;padding:0} .c17_6{vertical-align:top;width:468pt;border-style:solid;border-color:#000000;border-width:1pt;padding:5pt 5pt 5pt 5pt} .c5_6{vertical-align:top;border-style:solid;border-color:#000000;border-width:1pt;padding:0pt 5pt 0pt 5pt} .c6_6{vertical-align:top;width:156pt;border-style:solid;border-color:#000000;border-width:1pt;padding:5pt 5pt 5pt 5pt} .c15_6{background-color:#ffffff} .c10_6{color:#1155cc;text-decoration:underline} .c1_6{text-align:center;direction:ltr} .c0_6{line-height:1.0;direction:ltr} .c16_6{color:#666666;font-size:12pt} .c18_6{color:inherit;text-decoration:inherit} .c8_6{background-color:#f3f3f3} .c2_6{direction:ltr} .c14_6{font-size:8pt} .c11_6{font-size:10pt} .c7_6{font-weight:bold} .c12_6{height:0pt} .c3_6{height:11pt} .c13_6{border-collapse:collapse} .c4_6{font-family:"Courier New"} .c9_6{font-style:italic} .title{padding-top:24pt;line-height:1.15;text-align:left;color:#000000;font-size:36pt;font-family:"Arial";font-weight:bold;padding-bottom:6pt} .subtitle{padding-top:18pt;line-height:1.15;text-align:left;color:#666666;font-style:italic;font-size:24pt;font-family:"Georgia";padding-bottom:4pt} li{color:#000000;font-size:10pt;font-family:"Arial"} p{color:#000000;font-size:10pt;margin:0;font-family:"Arial"} h1{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:24pt;font-family:"Arial";font-weight:normal} h2{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:18pt;font-family:"Arial";font-weight:normal} h3{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:14pt;font-family:"Arial";font-weight:normal} h4{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:12pt;font-family:"Arial";font-weight:normal} h5{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:11pt;font-family:"Arial";font-weight:normal} h6{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:10pt;font-family:"Arial";font-weight:normal} This post continues the series of JMS articles which demonstrate how to use JMS queues in a SOA context. The previous posts were: JMS Step 1 - How to Create a Simple JMS Queue in Weblogic Server 11g JMS Step 2 - Using the QueueSend.java Sample Program to Send a Message to a JMS Queue JMS Step 3 - Using the QueueReceive.java Sample Program to Read a Message from a JMS Queue JMS Step 4 - How to Create an 11g BPEL Process Which Writes a Message Based on an XML Schema to a JMS Queue JMS Step 5 - How to Create an 11g BPEL Process Which Reads a Message Based on an XML Schema from a JMS Queue This example leads you through the creation of an Oracle database Advanced Queue and the related WebLogic server objects in order to use AQ JMS in connection with a SOA composite. If you have not already done so, I recommend you look at the previous posts in this series, as they include steps which this example builds upon. The following examples will demonstrate how to write and read from the queue from a SOA process. 1. Recap and Prerequisites In the previous examples, we created a JMS Queue, a Connection Factory and a Connection Pool in the WebLogic Server Console. Then we wrote and deployed BPEL composites, which enqueued and dequeued a simple XML payload. AQ JMS allows you to interoperate with database Advanced Queueing via JMS in WebLogic server and therefore take advantage of database features, while maintaining compliance with the JMS architecture. AQ JMS uses the WebLogic JMS Foreign Server framework. A full description of this functionality can be found in the following Oracle documentation Oracle® Fusion Middleware Configuring and Managing JMS for Oracle WebLogic Server 11g Release 1 (10.3.6) Part Number E13738-06 7. Interoperating with Oracle AQ JMS http://docs.oracle.com/cd/E23943_01/web.1111/e13738/aq_jms.htm#CJACBCEJ For easier reference, this sample will use the same names for the objects as in the above document, except for the name of the database user, as it is possible that this user already exists in your database. We will create the following objects Database Objects Name Type AQJMSUSER Database User MyQueueTable Advanced Queue (AQ) Table UserQueue Advanced Queue WebLogic Server Objects Object Name Type JNDI Name aqjmsuserDataSource Data Source jdbc/aqjmsuserDataSource AqJmsModule JMS System Module AqJmsForeignServer JMS Foreign Server AqJmsForeignServerConnectionFactory JMS Foreign Server Connection Factory AqJmsForeignServerConnectionFactory AqJmsForeignDestination AQ JMS Foreign Destination queue/USERQUEUE eis/aqjms/UserQueue Connection Pool eis/aqjms/UserQueue 2. Create a Database User and Advanced Queue The following steps can be executed in the database client of your choice, e.g. JDeveloper or SQL Developer. The examples below use SQL*Plus. Log in to the database as a DBA user, for example SYSTEM or SYS. Create the AQJMSUSER user and grant privileges to enable the user to create AQ objects. Create Database User and Grant AQ Privileges sqlplus system/password as SYSDBA GRANT connect, resource TO aqjmsuser IDENTIFIED BY aqjmsuser; GRANT aq_user_role TO aqjmsuser; GRANT execute ON sys.dbms_aqadm TO aqjmsuser; GRANT execute ON sys.dbms_aq TO aqjmsuser; GRANT execute ON sys.dbms_aqin TO aqjmsuser; GRANT execute ON sys.dbms_aqjms TO aqjmsuser; Create the Queue Table and Advanced Queue and Start the AQ The following commands are executed as the aqjmsuser database user. Create the Queue Table connect aqjmsuser/aqjmsuser; BEGIN dbms_aqadm.create_queue_table ( queue_table = 'myQueueTable', queue_payload_type = 'sys.aq$_jms_text_message', multiple_consumers = false ); END; / Create the AQ BEGIN dbms_aqadm.create_queue ( queue_name = 'userQueue', queue_table = 'myQueueTable' ); END; / Start the AQ BEGIN dbms_aqadm.start_queue ( queue_name = 'userQueue'); END; / The above commands can be executed in a single PL/SQL block, but are shown as separate blocks in this example for ease of reference. You can verify the queue by executing the SQL command SELECT object_name, object_type FROM user_objects; which should display the following objects: OBJECT_NAME OBJECT_TYPE ------------------------------ ------------------- SYS_C0056513 INDEX SYS_LOB0000170822C00041$$ LOB SYS_LOB0000170822C00040$$ LOB SYS_LOB0000170822C00037$$ LOB AQ$_MYQUEUETABLE_T INDEX AQ$_MYQUEUETABLE_I INDEX AQ$_MYQUEUETABLE_E QUEUE AQ$_MYQUEUETABLE_F VIEW AQ$MYQUEUETABLE VIEW MYQUEUETABLE TABLE USERQUEUE QUEUE Similarly, you can view the objects in JDeveloper via a Database Connection to the AQJMSUSER. 3. Configure WebLogic Server and Add JMS Objects All these steps are executed from the WebLogic Server Administration Console. Log in as the webLogic user. Configure a WebLogic Data Source The data source is required for the database connection to the AQ created above. Navigate to domain > Services > Data Sources and press New then Generic Data Source. Use the values:Name: aqjmsuserDataSource JNDI Name: jdbc/aqjmsuserDataSource Database type: Oracle Database Driver: *Oracle’ Driver (Thin XA) for Instance connections; Versions:9.0.1 and later Connection Properties: Enter the connection information to the database containing the AQ created above and enter aqjmsuser for the User Name and Password. Press Test Configuration to verify the connection details and press Next. Target the data source to the soa server. The data source will be displayed in the list. It is a good idea to test the data source at this stage. Click on aqjmsuserDataSource, select Monitoring > Testing > soa_server1 and press Test Data Source. The result is displayed at the top of the page. Configure a JMS System Module The JMS system module is required to host the JMS foreign server for AQ resources. Navigate to Services > Messaging > JMS Modules and select New. Use the values: Name: AqJmsModule (Leave Descriptor File Name and Location in Domain empty.) Target: soa_server1 Click Finish. The other resources will be created in separate steps. The module will be displayed in the list.   Configure a JMS Foreign Server A foreign server is required in order to reference a 3rd-party JMS provider, in this case the database AQ, within a local WebLogic server JNDI tree. Navigate to Services > Messaging > JMS Modules and select (click on) AqJmsModule to configure it. Under Summary of Resources, select New then Foreign Server. Name: AqJmsForeignServer Targets: The foreign server is targeted automatically to soa_server1, based on the JMS module’s target. Press Finish to create the foreign server. The foreign server resource will be listed in the Summary of Resources for the AqJmsModule, but needs additional configuration steps. Click on AqJmsForeignServer and select Configuration > General to complete the configuration: JNDI Initial Context Factory: oracle.jms.AQjmsInitialContextFactory JNDI Connection URL: <empty> JNDI Properties Credential:<empty> Confirm JNDI Properties Credential: <empty> JNDI Properties: datasource=jdbc/aqjmsuserDataSource This is an important property. It is the JNDI name of the data source created above, which points to the AQ schema in the database and must be entered as a name=value pair, as in this example, e.g. datasource=jdbc/aqjmsuserDataSource, including the “datasource=” property name. Default Targeting Enabled: Leave this value checked. Press Save to save the configuration. At this point it is a good idea to verify that the data source was written correctly to the config file. In a terminal window, navigate to $MIDDLEWARE_HOME/user_projects/domains/soa_domain/config/jms  and open the file aqjmsmodule-jms.xml . The foreign server configuration should contain the datasource name-value pair, as follows:   <foreign-server name="AqJmsForeignServer">         <default-targeting-enabled>true</default-targeting-enabled>         <initial-context-factory>oracle.jms.AQjmsInitialContextFactory</initial-context-factory>         <jndi-property>           <key> datasource </key>           <value> jdbc/aqjmsuserDataSource </value>         </jndi-property>   </foreign-server> </weblogic-jms> Configure a JMS Foreign Server Connection Factory When creating the foreign server connection factory, you enter local and remote JNDI names. The name of the connection factory itself and the local JNDI name are arbitrary, but the remote JNDI name must match a specific format, depending on the type of queue or topic to be accessed in the database. This is very important and if the incorrect value is used, the connection to the queue will not be established and the error messages you get will not immediately reflect the cause of the error. The formats required (Remote JNDI names for AQ JMS Connection Factories) are described in the section Configure AQ Destinations  of the Oracle® Fusion Middleware Configuring and Managing JMS for Oracle WebLogic Server document mentioned earlier. In this example, the remote JNDI name used is   XAQueueConnectionFactory  because it matches the AQ and data source created earlier, i.e. thin with AQ. Navigate to JMS Modules > AqJmsModule > AqJmsForeignServer > Connection Factories then New.Name: AqJmsForeignServerConnectionFactory Local JNDI Name: AqJmsForeignServerConnectionFactory Note: this local JNDI name is the JNDI name which your client application, e.g. a later BPEL process, will use to access this connection factory. Remote JNDI Name: XAQueueConnectionFactory Press OK to save the configuration. Configure an AQ JMS Foreign Server Destination A foreign server destination maps the JNDI name on the foreign JNDI provider to the respective local JNDI name, allowing the foreign JNDI name to be accessed via the local server. As with the foreign server connection factory, the local JNDI name is arbitrary (but must be unique), but the remote JNDI name must conform to a specific format defined in the section Configure AQ Destinations  of the Oracle® Fusion Middleware Configuring and Managing JMS for Oracle WebLogic Server document mentioned earlier. In our example, the remote JNDI name is Queues/USERQUEUE , because it references a queue (as opposed to a topic) with the name USERQUEUE. We will name the local JNDI name queue/USERQUEUE, which is a little confusing (note the missing “s” in “queue), but conforms better to the JNDI nomenclature in our SOA server and also allows us to differentiate between the local and remote names for demonstration purposes. Navigate to JMS Modules > AqJmsModule > AqJmsForeignServer > Destinations and select New.Name: AqJmsForeignDestination Local JNDI Name: queue/USERQUEUE Remote JNDI Name:Queues/USERQUEUE After saving the foreign destination configuration, this completes the JMS part of the configuration. We still need to configure the JMS adapter in order to be able to access the queue from a BPEL processt. 4. Create a JMS Adapter Connection Pool in Weblogic Server Create the Connection Pool Access to the AQ JMS queue from a BPEL or other SOA process in our example is done via a JMS adapter. To enable this, the JmsAdapter in WebLogic server needs to be configured to have a connection pool which points to the local connection factory JNDI name which was created earlier. Navigate to Deployments > Next and select (click on) the JmsAdapter. Select Configuration > Outbound Connection Pools and New. Check the radio button for oracle.tip.adapter.jms.IJmsConnectionFactory and press Next. JNDI Name: eis/aqjms/UserQueue Press Finish Expand oracle.tip.adapter.jms.IJmsConnectionFactory and click on eis/aqjms/UserQueue to configure it. The ConnectionFactoryLocation must point to the foreign server’s local connection factory name created earlier. In our example, this is AqJmsForeignServerConnectionFactory . As a reminder, this connection factory is located under JMS Modules > AqJmsModule > AqJmsForeignServer > Connection Factories and the value needed here is under Local JNDI Name. Enter AqJmsForeignServerConnectionFactory  into the Property Value field for ConnectionFactoryLocation. You must then press Return/Enter then Save for the value to be accepted. If your WebLogic server is running in Development mode, you should see the message that the changes have been activated and the deployment plan successfully updated. If not, then you will manually need to activate the changes in the WebLogic server console.Although the changes have been activated, the JmsAdapter needs to be redeployed in order for the changes to become effective. This should be confirmed by the message Remember to update your deployment to reflect the new plan when you are finished with your changes. Redeploy the JmsAdapter Navigate back to the Deployments screen, either by selecting it in the left-hand navigation tree or by selecting the “Summary of Deployments” link in the breadcrumbs list at the top of the screen. Then select the checkbox next to JmsAdapter and press the Update button. On the Update Application Assistant page, select “Redeploy this application using the following deployment files” and press Finish. After a few seconds you should get the message that the selected deployments were updated. The JMS adapter configuration is complete and it can now be used to access the AQ JMS queue. You can verify that the JNDI name was created correctly, by navigating to Environment > Servers > soa_server1 and View JNDI Tree. Then scroll down in the JNDI Tree Structure to eis and select aqjms. This concludes the sample. In the following post, I will show you how to create a BPEL process which sends a message to this advanced queue via JMS. Best regards John-Brown Evans Oracle Technology Proactive Support Delivery

    Read the article

< Previous Page | 486 487 488 489 490 491 492 493 494 495 496 497  | Next Page >