Search Results

Search found 24401 results on 977 pages for 'duplicate content'.

Page 498/977 | < Previous Page | 494 495 496 497 498 499 500 501 502 503 504 505  | Next Page >

• CMD: How do I delete all the contents of all directories (in the current directory) without deleting the directories themselves?

  - by merlin2011

  For example: I'm in the directory: F:\Data Inside this directory, I have four directories: F:\Datadir 22179 22915 23459 23460 These directories have various content, including directories and files. I'm trying to run something like: rmdir /s *\* where I delete all the contents of these numbered directories, while leaving the empty directories. Is there a one-liner that can do this, or do I have to loop through the sub-directories?

  Read the article

• Make mod_wsgi use python2.7.2 instead of python2.6?

  - by guron

  i am running Ubuntu 10.04.1 LTS and it came pre-packed with python2.6 but i need to replace it with python2.7.2. (The reason is simple, 2.7 has a lot of features backported from 3 ) i had installed python2.7.2 using ./configure make make altinstall the altinstall option installed it, without touching the system default version, to /usr/local/lib/python2.7 and placed the interpreter in /usr/local/bin/python2.7 Then to help mod_wsgi find python2.7 i added the following to /etc/apache2/sites-available/wsgisite WSGIPythonHome /usr/local i start apache and run a test wsgi app BUT i am greeted by python 2.6.5 and not Python2.7 Later i replaced the default python simlink to point to python 2.7 ln -f /usr/local/bin/python2.7 /usr/bin/python Now typing 'python' on the console opens python2.7 but somehow mod_wsgi still picks up python2.6 Next i tried, PATH=/usr/local/bin:$PATH export PATH then do a quick restart apache, but yet again its python2.6 !! Here is my $PATH /usr/local/bin:/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games contents of /etc/apache2/sites-available/wsgisite WSGIPythonHome /usr/local <VirtualHost *:80> ServerName wsgitest.local DocumentRoot /home/wwwhost/pydocs/wsgi <Directory /home/wwwhost/pydocs/wsgi> Order allow,deny Allow from all </Directory> WSGIScriptAlias / /home/wwwhost/pydocs/wsgi/app.wsgi </VirtualHost> app.wsgi import sys def application(environ, start_response): status = '200 OK' output = sys.version response_headers = [('Content-type', 'text/plain'), ('Content-Length', str(len(output)))] start_response(status, response_headers) return [output] Apache error.log 'import site' failed; use -v for traceback [Sun Jun 19 00:27:21 2011] [info] mod_wsgi (pid=23235): Initializing Python. [Sun Jun 19 00:27:21 2011] [notice] Apache/2.2.14 (Ubuntu) mod_wsgi/2.8 Python/2.6.5 configured -- resuming normal operations [Sun Jun 19 00:27:21 2011] [info] Server built: Nov 18 2010 21:20:56 [Sun Jun 19 00:27:21 2011] [info] mod_wsgi (pid=23238): Attach interpreter ''. [Sun Jun 19 00:27:21 2011] [info] mod_wsgi (pid=23239): Attach interpreter ''. [Sun Jun 19 00:27:31 2011] [info] mod_wsgi (pid=23238): Create interpreter 'wsgitest.local|'. [Sun Jun 19 00:27:31 2011] [info] [client 192.168.1.205] mod_wsgi (pid=23238, process='', application='wsgitest.local|'): Loading WSGI script '/home/wwwhost/pydocs/$ [Sun Jun 19 00:27:50 2011] [info] mod_wsgi (pid=23239): Create interpreter 'wsgitest.local|'. Has anybody ever managed to make mod_wsgi run on a non-system default version of python ?

  Read the article

• Burn 30GB zip file to DVD

  - by Joel Coehoorn

  I have a zip 30GB zip file containing an archive a digital materials available in the school library that I want to burn to dvd. Of course, 30Gb is far too large for a single dvd and the content is already zipped. I'm open to ideas, but leaning towards suggestions that will help me automatically spread the file over multiple dvds, including a simple program to stitch it back together again later.

  Read the article

• UNIX tool to dump a selection of HTML?

  - by jldugger

  I'm looking to monitor changes on websites and my current approach is being defeated by a rotating top banner. Is there a UNIX tool that takes a selection parameter (id attribute or XPath), reads HTML from stdin and prints to stdout the subtree based on the selection? For example, given an html document I want to filter out everything but the subtree of the element with id="content". Basically, I'm looking for the simplest HTML/XML equivalent to grep.

  Read the article

• Where is the OWA cache

  - by chris

  Where does Outlook Web Access cache attachments? Is there a folder similar to Content.Outlook for OWA?

  Read the article

• How do I use different audio devices for different apps in Windows 8?

  - by Eclipse

  Besides switching the default audio device, how can I send the audio from one app (say x-box music) to one audio device, and another (say the video app) to another audio device? Edit: Looking further, I found this: http://channel9.msdn.com/Events/BUILD/BUILD2011/APP-408T At 16:16, he demonstrates exactly what I'm wanting to do, but when I go to the devices charm, I get a message: "You don't have any devices that can receive content from Music".

  Read the article

• Open Source PDF editor to make files non-printable

  - by Nissan Fan

  I need an open source solution to simply make any PDF unprintable. I know there's questions about editors, but I need this particular feature only and editing the content isn't a concern.

  Read the article

• Recover not properly burned DVD from camcoder

  - by tomo

  Can anybody suggest me any good and preferably free software - working on Vista / 7 - for recovering content from DVD disks? A few DVD-R VOB files cannot be read from disk by Windows. Probably the camera failed to burn it correctly. What I want to achieve is to skip a few invalid frames in VOB files and recreate proper MPEG stream - without re-encoding whole stream and loosing the quality.

  Read the article

• How to setup IIS subdomain pointing to folder on remote machine?

  - by zsharp

  Im trying to serve static content through a subdomain. The physical folder is shared on a second machine in the same local domain. How do I safely setup permissions on the shared folder so that when i do something like: src="subdomain.domain.com/Image1.png" I wont get access denied? IN IIS I have subdomain.domain.com as a separate website.

  Read the article

• mysqldump trigger crashed tables

  - by m4rc

  We had a database crash this morning starting at 1 minute past midnight (when the database backup runs). The exception emails I was getting said "Table './core/content' is marked as crashed and should be repaired". My question is basically, can mysqldump cause tables to crash, if so how and why? And are there any tools which can detect a crashed table and run a repair on it? Thanks in advance.

  Read the article

• Transcend jetflash 64GB Windows XP

  - by reuvenab

  I have Transced jetflash 64GB with some information on it. When I connect it to my XP with SP3 machine system prompts me to format disk. However when connected to Win7 machine disk works and display disk content

  Read the article

• How to use rsync when filenames contain double quotes?

  - by wfoolhill

  I am trying to synchronize the content of the directory my_dir/ from /home to /backup. This directory contains a file which name has a double quote in it, such as to"to. Here is my rsync command: rsync -Cazh /home/my_dir/ /backup/my_dir/ And I get the following message: rsync: mkstemp "/backup/my_dir/.to"to.d93PZr" failed: Invalid argument (22) For info, rsync works well when the synchronized filenames contain single quote, parenthesis and space. Thus, why is it bugging with a double quote? Thanks for any help.

  Read the article

• How can I read out internal pdf creation/modified date with Windows PowerShell?

  - by Martin

  PDF files seem to have a separate set of file properties which contain (among others) a creation date and a modified date (see screenshot here: http://ventajamarketing.com/writingblog/wp-content/uploads/2012/02/Acrobat-Document-Properties1-300x297.png). Those date obviously can differ from the creation and modified date shown in the file system (Windows Explorer). How can I access the date information in the PDF file and read it out in Windows 7 with Windows PowerShell (or maybe another method)?

  Read the article

• Safe to disable compile options for Nginx (when used only as reverse proxy/cache)

  - by Alex

  I have read that I can do this to make a smaller footprint Nginx when used as static content cache/reverse proxy: --without-mail_pop3_module --without-mail_imap_module --without-mail_smtp_module What other options are safe to disable? SSI, FastCGI? Others? The only requirements for the reverse proxy is to be able to do https and gzip compression. Will disabling all the module really help with footprint and/or performance?

  Read the article

• How to ensure precedence of files over directories with Apache?

  - by janeden

  My httpd.conf uses the MultiViews option to serve HTML files for URLs like http://server/blog. This works fine, unless there are directories with the same name – Apache will then try to serve the directory. Is there any way to ensure precedence of blog.html over blog/, or rather: can I make Apache process content negotiation according to MultiView although a matching entity (the directory) is present? In nginx, I can do this explicitly: try_files $uri $uri.html $uri/ =404;

  Read the article

• sed or grep or awk to match very very long lines

  - by yael

  more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

  Read the article

• Beginner server local installation

  - by joanjgm

  Here's the thing I own a small business and currently my emails are being managed by some regular hosting using cpanel and that I bought a small server and installed windows server and exchange Can you tell what I did wrong here Installed and configured my current existing domain Configured all email address Installed noip in case my public address change In the cpanel of the domain I've added an MX record to the noip domain of the server with priority 0 so now emails are being received by my own server Now whenever I send an email to anyone gmail hotmail etc I get a response that cannot be delivered since may be junk This didn't happen when I sent emails from the hosting What's missing what did I do wrong heres the code mx.google.com rejected your message to the following e-mail addresses: Joan J. Guerra Makaren ([email protected]) mx.google.com gave this error: [186.88.202.13 12] Our system has detected that this message is likely unsolicited mail. To reduce the amount of spam sent to Gmail, this message has been blocked. Please visit http://support.google.com/mail/bin/answer.py?hl=en&answer=188131 for more information. cn9si815432vcb.71 - gsmtp Your message wasn't delivered due to a permission or security issue. It may have been rejected by a moderator, the address may only accept e-mail from certain senders, or another restriction may be preventing delivery. Diagnostic information for administrators: Generating server: SERVERMEGA.megaconstrucciones.com.ve [email protected] mx.google.com #550-5.7.1 [186.88.202.13 12] Our system has detected that this message is 550-5.7.1 likely unsolicited mail. To reduce the amount of spam sent to Gmail, 550-5.7.1 this message has been blocked. Please visit 550-5.7.1 http://support.google.com/mail/bin/answer.py?hl=en&answer=188131 for 550 5.7.1 more information. cn9si815432vcb.71 - gsmtp ## Original message headers: Received: from SERVERMEGA.megaconstrucciones.com.ve ([fe80::9096:e9c2:405b:6112]) by SERVERMEGA.megaconstrucciones.com.ve ([fe80::9096:e9c2:405b:6112%10]) with mapi; Thu, 29 May 2014 11:32:19 -0430 From: prueba <[email protected]> To: "Joan J. Guerra Makaren" <[email protected]> Subject: Probando correos Thread-Topic: Probando correos Thread-Index: Ac97V1eW4OBFmoqJTRGoD7IPTC2azg== Date: Thu, 29 May 2014 16:04:35 +0000 Message-ID: <[email protected]> Accept-Language: en-US, es-VE Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: Content-Type: multipart/alternative; boundary="_000_000f42494487966276f7b241megaconstruccionescomve_" MIME-Version: 1.0

  Read the article

• Java application delivery through CDN

  - by tuler

  We have a java application bundled as an applet or as webstart. The client java plugin caches the jar files on the client machine and downloads a new version if there is one. Is it possible to deliver this jar files using a CDN? What are the issues involved? Which CDNs would work for jar delivery? Is this different from static content delivery like images or video?

  Read the article

• Does hosting multiple sites on one server hurt your SEO?

  - by MarathonStudios

  I have a handful of (content unrelated) sites with decent PRs and I'm considering hosting them all on the same server. I've heard that if you do this, internal linking between two seperate domains on that server may be seen as less "valid" by Google in PageRank terms (since you obviously own both of the sites as they share an IP address). Anyone have any experience in this? I'd love to save some hosting cash by consolidating, but not at the expense of losing the ability to link my sites together powerfully.

  Read the article

• nginx url rewrites for php-urls

  - by Tronic

  i have to permament redirect some old urls in nginx. the old urls are old-style php urls including a parameter for loading content. they look like this: http://www.foo.com/index.php?site=foo http://www.foo.com/index.php?site=bar i want to redirect them to other urls like: http://www.foo.com/news http://www.foo.com/gallery any advice on how i can achieve this? my tries failed. thanks in advance!

  Read the article

• Copying SharePoint DB to a new SharePoint 2010 server

  - by LJe

  Hi - we would like to know what is the best and easy way to configure a new SharePoint 2010 Server, we have backup the existing DB of SharePoint 2007 (up and running). We would like to mirror the same settings and content of our current SharePoint setup to the new server using the SharePoint 2010.

  Read the article

• a command to get the lines around a specific line of a text file

  - by sanjan

  I'm looking for a command to get text around a specific line of a file. ex: file content: a b c d e f g h i j a command like: ]$ commandname -text f -lines 3 giving the output c d e f g h i

  Read the article

• IIS, SSL, and Virtual Directories

  - by yodie

  I'm running a webserver on WS 2k3, IIS 6.0. Some of the content is on that server, but most is in a virtual directory linked to another server. Everything works (almost) fine when no SSL is used. However, when using SSL, I cannot access the files in the virtual directory. Instead I get a generic error 500. Any advice?

  Read the article

• Mails are coming from mail server to my account automatically...???

  - by Jayakrishnan T

  Hi all, i am getting same mail from admin account of my mail server every day automatically.The content of the mail is given below. Click here to access your spam quarantine. The spam quarantine contains emails that are being held from your email account. Quarantined emails can be released to your inbox or deleted using the spam quarantine link. Please give me an advice to solve this problem.

  Read the article

• Is the guideline: don't open email attachments or execute downloads or run plug-ins (Flash, Java) from untrusted sites enough to avert infection?

  - by therobyouknow

  I'd like to know if the following is enough to avert malware as I feel that the press and other advisory resources aren't always precisely clear on all the methods as to how PCs get infected. To my mind, the key step to getting infected is a conscious choice by the user to run an executable attachment from an email or download, but also viewing content that requires a plug-in (Flash, Java or something else). This conscious step breaks down into the following possibilities: don't open email attachments: certainly agree with this. But lets try to be clear: email comes in 2 parts -the text and the attachment. Just reading the email should not be risky, right? But opening (i.e. running) email attachments IS risky (malware can be present in the attachment) don't execute downloads (e.g. from sites linked from in suspect emails or otherwise): again certainly agree with this (malware can be present in the executable). Usually the user has to voluntary click to download, or at least click to run the executable. Question: has there ever been a case where a user has visited a site and a download has completed on its own and run on its own? don't run content requiring plug-ins: certainly agree: malware can be present in the executable. I vaguely recall cases with Flash but know of the Java-based vulnerabilities much better. Now, is the above enough? Note that I'm much more cautious than this. What I'm concerned about is that the media is not always very clear about how the malware infection occurs. They talk of "booby-trapped sites", "browser attacks" - HOW exactly? I'd presume the other threat would be malevolent use of Javascript to make an executable run on the user's machine. Would I be right and are there details I can read up on about this. Generally I like Javascript as a developer, please note. An accepted answer would fill in any holes I've missed here so we have a complete general view of what the threats are (even though the actual specific details of new threats vary, but the general vectors are known).

  Read the article

< Previous Page | 494 495 496 497 498 499 500 501 502 503 504 505  | Next Page >