Search Results

Search found 409 results on 17 pages for 'delimiter'.

Page 5/17 | < Previous Page | 1 2 3 4 5 6 7 8 9 10 11 12  | Next Page >

  • Script dies, I'm not sure why

    - by Webnet
    I'm trying to parse a 6,000 line 500 KB file into an array so I can import the data into our system. The problem is that the script stops executing somewhere between lines 3000-4000. There are no breaks in the code, we use it on other imports. Any ideas on why this might be happening and what I can do to prevent it? /** * Takes a seperated value string and makes it an array * @param $delimiter string The delimiter to be seperated by, usually a comma or tab * @param $string string The string to seperate * @return array The resulting array */ public function svToArray ($delimiter, $string) { $x = 0; $rowList = array(); $splitContent = preg_split("#\n+#", trim($string)); foreach ($splitContent as $key => $value) { $newData = preg_split("#".$delimiter."#", $value); if ($x == 0) { $headerValues = array_values($newData); } else { $tempRow = array(); foreach ($newData as $rowColumnKey => $rowColumnValue) { $tempRow[$headerValues[$rowColumnKey]] = $rowColumnValue; } $rowList[] = $tempRow; } $x++; } return $rowList; }

    Read the article

  • System.Linq.Dynamic and DateTime

    - by Matthew Hood
    I am using System.Linq.Dynamic to do custom where clauses from an ajax call in .Net MVC 1.0. It works fine for strings, int etc but not for DateTime, I get the exception cannot compare String to DateTime. The very simple test code is items = items.Where(string.Format(@" {0} {1}{2}{1} ", searchField, delimiter, searchString)); Where searchField will be for example start_date and the data type is DateTime, delimiter is " (tried with nothing as well) and searchString will be 01-Jan-2009 (tried with 01/01/2009 as well) and items is an IQueryable from LinqToSql. Is there a way of specifying the data type in a dynamic where, or is there a better approach. It is currently already using some reflection to work out what type of delimiter is required.

    Read the article

  • Awk or Sed: File Annotation

    - by lukmac
    Hallo, my SO friend, my question is: Specification: annotate the fields of FILE_2 to the corresponding position of FILE_1. A field is marked, and hence identified, by a delimiter pair. I did this job in python before I knew awk and sed, with a couple hundred lines of code. Now I want to see how powerful and efficient awk and sed can be. Show me some masterpiece of awk or sed, please! The delimiter pairs can be configured in FILE_3, but let's assume the first delimiter in a pair is 'Marker (number i) start', the other one is 'Marker (number i) done' Example: |-----------------FILE_1------------------| text text text text blabla Marker_1_start Marker_1_done any text in between blabla Marker_2_start Marker_2_done text text |-----------------FILE_2------------------| Marker_1_start 11 1111 Marker_1_done Marker_2_start 2222 22 Marker_2_done Expected Output: |-----------------FILE_Out------------------| text text text text blabla Marker_1_start 11 1111 Marker_1_done any text in between blabla Marker_2_start 2222 22 Marker_2_done text text

    Read the article

  • OverRiding Help

    - by user445714
    Few questions on over riding. I am interiting a method openRead from another class, the method is to be overridden so that the scanner class uses the provided delimiter pattern, which is referenced. I need to make use of the scanner class useDelmiter method method from another class [code] public boolean openRead() throws FileNotFoundException { sc = new Scanner(new File(fileName)); if (fileName != null) { return true; } else { return false; } } [/code] delimiter [code] protected final String DELIMITERS = "[\s[^'a-zA-Z]]"; [/code] I'm at a loss to how i over ride this using the constant delimiter.

    Read the article

  • speeding up parsing of files

    - by user248237
    the following function parses a CSV file into a list of dictionaries, where each element in the list is a dictionary where the values are indexed by the header of the file (assumed to be the first line.) this function is very very slow, taking ~6 seconds for a file that's relatively small (less than 30,000 lines.) how can I speed it up? def csv2dictlist_raw(filename, delimiter='\t'): f = open(filename) header_line = f.readline().strip() header_fields = header_line.split(delimiter) dictlist = [] # convert data to list of dictionaries for line in f: values = map(tryEval, line.strip().split(delimiter)) dictline = dict(zip(header_fields, values)) dictlist.append(dictline) return (dictlist, header_fields) thanks.

    Read the article

  • SQL Developer: Why Do You Require Semicolons When Executing SQL in the Worksheet?

    - by thatjeffsmith
    There are many database tools out there that support Oracle database. Oracle SQL Developer just happens to be the one that is produced and shipped by the same folks that bring you the database product. Several other 3rd party tools out there allow you to have a collection of SQL statements in their editor and execute them without requiring a statement delimiter (usually a semicolon.) Let’s look at a quick example: select * from scott.emp select * from hr.employees delete from HR_COPY.BEER where HR_COPY.BEER.STATE like '%West Virginia% In some tools, you can simply place your cursor on say the 2nd statement and ask to execute that statement. The tool assumes that the blank line between it and the next statement, a DELETE, serves as a statement delimiter. This is not bad in and of itself. However, it is very important to understand how your tools work. If you were to try the same trick by running the delete statement, it would empty my entire BEER table instead of just trimming out the breweries from my home state. SQL Developer only executes what you ask it to execute You can paste this same code into SQL Developer and run it without problems and without having to add semicolons to your statements. Highlight what you want executed, and hit Ctrl-Enter If you don’t highlight the text, here’s what you’ll see: See the statement at the cursor vs what SQL Developer actually executed? The parser looks for a query and keeps going until the statement is terminated with a semicolon – UNLESS it’s highlighted, then it assumes you only want to execute what is highlighted. In both cases you are being explicit with what is being sent to the database. Again, there’s not necessarily a ‘right’ or ‘wrong’ debate here. What you need to be aware of is the differences and to learn new workflows if you are moving from other database tools to Oracle SQL Developer. I say, when in doubt, back away from the tool, especially if you’re in production. Oh, and to answer the original question… Because we’re trying to emulate SQL*Plus behavior. You end statements in SQL*Plus with delimiters, and the default delimiter is a semicolon.

    Read the article

  • Interactive console based CSV editor

    - by Penguin Nurse
    Although spreadsheet applications for editing CSV files on the console used to be one of the earliest killer applications for personal computers, only few of them and even less documentation about them is still actively maintained. After having done extensive search on the web, manpages and source code, I ended up with the following three applications that all have fundamental drawbacks: sc: abbrev. for spreadsheet calculator; nice tool with vi keybings, but it does not put strings containing the delimiter into quotas when exporting to delimiter separated format and can't import csv files correctly, i.e. all numbers are interpreted as strings GNU oleo: doesn't seem to be actively maintained any longer since 2001 and there are therefore no packages for major linux distributions teapot: offers packages for various operating systems, but uses for example counter-intuitive naming for cells (numbers for row and column, i.e. 11 seems to be intended to be row 1, column 1) and superfluous code for FLTK GUI Various Emacs modes also do not quote strings containing the delimiter well or are require much more typing for entering the scaffold of a table. Therefore I would be very grateful for overcoming one of theses drawbacks or any hints towards another console based CSV editor. It actually needn't do any calculations just editing cells or column- and rowise.

    Read the article

  • Use a stored procedure parameter for unit parameter of DATE_SUB

    - by Mike
    I would like to know if it's possible to pass a parameter to a mysql stored procedure and use this parameter as the unit parameter of the DATE_SUB function. It seems that the unit parameter is a reserved word so I don't know if there's a type for unit. Exemple of what I'm trying to do : DELIMITER $$ DROP PROCEDURE IF EXISTS `test` $$ CREATE DEFINER=`root`@`%` PROCEDURE `test`(param1 unit) BEGIN select DATE_SUB(now(), INTERVAL 1 param1); END $$ DELIMITER ;

    Read the article

  • Search multiple datepicker on same grid

    - by DHF
    I'm using multiple datepicker on same grid and I face the problem to get a proper result. I used 3 datepicker in 1 grid. Only the first datepicker (Order Date)is able to output proper result while the other 2 datepicker (Start Date & End Date) are not able to generate proper result. There is no problem with the query, so could you find out what's going on here? Thanks in advance! php wrapper <?php ob_start(); require_once 'config.php'; // include the jqGrid Class require_once "php/jqGrid.php"; // include the PDO driver class require_once "php/jqGridPdo.php"; // include the datepicker require_once "php/jqCalendar.php"; // Connection to the server $conn = new PDO(DB_DSN,DB_USER,DB_PASSWORD); // Tell the db that we use utf-8 $conn->query("SET NAMES utf8"); // Create the jqGrid instance $grid = new jqGridRender($conn); // Write the SQL Query $grid->SelectCommand = "SELECT c.CompanyID, c.CompanyCode, c.CompanyName, c.Area, o.OrderCode, o.Date, m.maID ,m.System, m.Status, m.StartDate, m.EndDate, m.Type FROM company c, orders o, maintenance_agreement m WHERE c.CompanyID = o.CompanyID AND o.OrderID = m.OrderID "; // Set the table to where you update the data $grid->table = 'maintenance_agreement'; // set the ouput format to json $grid->dataType = 'json'; // Let the grid create the model $grid->setPrimaryKeyId('maID'); // Let the grid create the model $grid->setColModel(); // Set the url from where we obtain the data $grid->setUrl('grouping_ma_details.php'); // Set grid caption using the option caption $grid->setGridOptions(array( "sortable"=>true, "rownumbers"=>true, "caption"=>"Group by Maintenance Agreement", "rowNum"=>20, "height"=>'auto', "width"=>1300, "sortname"=>"maID", "hoverrows"=>true, "rowList"=>array(10,20,50), "footerrow"=>false, "userDataOnFooter"=>false, "grouping"=>true, "groupingView"=>array( "groupField" => array('CompanyName'), "groupColumnShow" => array(true), //show or hide area column "groupText" =>array('<b> Company Name: {0}</b>',), "groupDataSorted" => true, "groupSummary" => array(true) ) )); if(isset($_SESSION['login_admin'])) { $grid->addCol(array( "name"=>"Action", "formatter"=>"actions", "editable"=>false, "sortable"=>false, "resizable"=>false, "fixed"=>true, "width"=>60, "formatoptions"=>array("keys"=>true), "search"=>false ), "first"); } // Change some property of the field(s) $grid->setColProperty("CompanyID", array("label"=>"ID","hidden"=>true,"width"=>30,"editable"=>false,"editoptions"=>array("readonly"=>"readonly"))); $grid->setColProperty("CompanyName", array("label"=>"Company Name","hidden"=>true,"editable"=>false,"width"=>150,"align"=>"center","fixed"=>true)); $grid->setColProperty("CompanyCode", array("label"=>"Company Code","hidden"=>true,"width"=>50,"align"=>"center")); $grid->setColProperty("OrderCode", array("label"=>"Order Code","width"=>110,"editable"=>false,"align"=>"center","fixed"=>true)); $grid->setColProperty("maID", array("hidden"=>true)); $grid->setColProperty("System", array("width"=>150,"fixed"=>true,"align"=>"center")); $grid->setColProperty("Type", array("width"=>280,"fixed"=>true)); $grid->setColProperty("Status", array("width"=>70,"align"=>"center","edittype"=>"select","editoptions"=>array("value"=>"Yes:Yes;No:No"),"fixed"=>true)); $grid->setSelect('System', "SELECT DISTINCT System, System AS System FROM master_ma_system ORDER BY System", false, true, true, array(""=>"All")); $grid->setSelect('Type', "SELECT DISTINCT Type, Type AS Type FROM master_ma_type ORDER BY Type", false, true, true, array(""=>"All")); $grid->setColProperty("StartDate", array("label"=>"Start Date","width"=>120,"align"=>"center","fixed"=>true, "formatter"=>"date", "formatoptions"=>array("srcformat"=>"Y-m-d H:i:s","newformat"=>"d M Y") )); // this is only in this case since the orderdate is set as date time $grid->setUserTime("d M Y"); $grid->setUserDate("d M Y"); $grid->setDatepicker("StartDate",array("buttonOnly"=>false)); $grid->datearray = array('StartDate'); $grid->setColProperty("EndDate", array("label"=>"End Date","width"=>120,"align"=>"center","fixed"=>true, "formatter"=>"date", "formatoptions"=>array("srcformat"=>"Y-m-d H:i:s","newformat"=>"d M Y") )); // this is only in this case since the orderdate is set as date time $grid->setUserTime("d M Y"); $grid->setUserDate("d M Y"); $grid->setDatepicker("EndDate",array("buttonOnly"=>false)); $grid->datearray = array('EndDate'); $grid->setColProperty("Date", array("label"=>"Order Date","width"=>100,"editable"=>false,"align"=>"center","fixed"=>true, "formatter"=>"date", "formatoptions"=>array("srcformat"=>"Y-m-d H:i:s","newformat"=>"d M Y") )); // this is only in this case since the orderdate is set as date time $grid->setUserTime("d M Y"); $grid->setUserDate("d M Y"); $grid->setDatepicker("Date",array("buttonOnly"=>false)); $grid->datearray = array('Date'); // This command is executed after edit $maID = jqGridUtils::GetParam('maID'); $Status = jqGridUtils::GetParam('Status'); $StartDate = jqGridUtils::GetParam('StartDate'); $EndDate = jqGridUtils::GetParam('EndDate'); $Type = jqGridUtils::GetParam('Type'); // This command is executed immediatley after edit occur. $grid->setAfterCrudAction('edit', "UPDATE maintenance_agreement SET m.Status=?, m.StartDate=?, m.EndDate=?, m.Type=? WHERE m.maID=?", array($Status,$StartDate,$EndDate,$Type,$maID)); $selectorder = <<<ORDER function(rowid, selected) { if(rowid != null) { jQuery("#detail").jqGrid('setGridParam',{postData:{CompanyID:rowid}}); jQuery("#detail").trigger("reloadGrid"); // Enable CRUD buttons in navigator when a row is selected jQuery("#add_detail").removeClass("ui-state-disabled"); jQuery("#edit_detail").removeClass("ui-state-disabled"); jQuery("#del_detail").removeClass("ui-state-disabled"); } } ORDER; // We should clear the grid data on second grid on sorting, paging, etc. $cleargrid = <<<CLEAR function(rowid, selected) { // clear the grid data and footer data jQuery("#detail").jqGrid('clearGridData',true); // Disable CRUD buttons in navigator when a row is not selected jQuery("#add_detail").addClass("ui-state-disabled"); jQuery("#edit_detail").addClass("ui-state-disabled"); jQuery("#del_detail").addClass("ui-state-disabled"); } CLEAR; $grid->setGridEvent('onSelectRow', $selectorder); $grid->setGridEvent('onSortCol', $cleargrid); $grid->setGridEvent('onPaging', $cleargrid); $grid->setColProperty("Area", array("width"=>100,"hidden"=>false,"editable"=>false,"fixed"=>true)); $grid->setColProperty("HeadCount", array("label"=>"Head Count","align"=>"center", "width"=>100,"hidden"=>false,"fixed"=>true)); $grid->setSelect('Area', "SELECT DISTINCT AreaName, AreaName AS Area FROM master_area ORDER BY AreaName", false, true, true, array(""=>"All")); $grid->setSelect('CompanyName', "SELECT DISTINCT CompanyName, CompanyName AS CompanyName FROM company ORDER BY CompanyName", false, true, true, array(""=>"All")); $custom = <<<CUSTOM jQuery("#getselected").click(function(){ var selr = jQuery('#grid').jqGrid('getGridParam','selrow'); if(selr) { window.open('http://www.smartouch-cdms.com/order.php?CompanyID='+selr); } else alert("No selected row"); return false; }); CUSTOM; $grid->setJSCode($custom); // Enable toolbar searching $grid->toolbarfilter = true; $grid->setFilterOptions(array("stringResult"=>true,"searchOnEnter"=>false,"defaultSearch"=>"cn")); // Enable navigator $grid->navigator = true; // disable the delete operation programatically for that table $grid->del = false; // we need to write some custom code when we are in delete mode. // get the grid operation parameter to see if we are in delete mode // jqGrid sends the "oper" parameter to identify the needed action $deloper = $_POST['oper']; // det the company id $cid = $_POST['CompanyID']; // if the operation is del and the companyid is set if($deloper == 'del' && isset($cid) ) { // the two tables are linked via CompanyID, so let try to delete the records in both tables try { jqGridDB::beginTransaction($conn); $comp = jqGridDB::prepare($conn, "DELETE FROM company WHERE CompanyID= ?", array($cid)); $cont = jqGridDB::prepare($conn,"DELETE FROM contact WHERE CompanyID = ?", array($cid)); jqGridDB::execute($comp); jqGridDB::execute($cont); jqGridDB::commit($conn); } catch(Exception $e) { jqGridDB::rollBack($conn); echo $e->getMessage(); } } // Enable only deleting if(isset($_SESSION['login_admin'])) { $grid->setNavOptions('navigator', array("pdf"=>true, "excel"=>true,"add"=>false,"edit"=>true,"del"=>false,"view"=>true, "search"=>true)); } else $grid->setNavOptions('navigator', array("pdf"=>true, "excel"=>true,"add"=>false,"edit"=>false,"del"=>false,"view"=>true, "search"=>true)); // In order to enable the more complex search we should set multipleGroup option // Also we need show query roo $grid->setNavOptions('search', array( "multipleGroup"=>false, "showQuery"=>true )); // Set different filename $grid->exportfile = 'Company.xls'; // Close the dialog after editing $grid->setNavOptions('edit',array("closeAfterEdit"=>true,"editCaption"=>"Update Company","bSubmit"=>"Update","dataheight"=>"auto")); $grid->setNavOptions('add',array("closeAfterAdd"=>true,"addCaption"=>"Add New Company","bSubmit"=>"Update","dataheight"=>"auto")); $grid->setNavOptions('view',array("Caption"=>"View Company","dataheight"=>"auto","width"=>"1100")); ob_end_clean(); //solve TCPDF error // Enjoy $grid->renderGrid('#grid','#pager',true, null, null, true,true); $conn = null; ?> javascript code jQuery(document).ready(function ($) { jQuery('#grid').jqGrid({ "width": 1300, "hoverrows": true, "viewrecords": true, "jsonReader": { "repeatitems": false, "subgrid": { "repeatitems": false } }, "xmlReader": { "repeatitems": false, "subgrid": { "repeatitems": false } }, "gridview": true, "url": "session_ma_details.php", "editurl": "session_ma_details.php", "cellurl": "session_ma_details.php", "sortable": true, "rownumbers": true, "caption": "Group by Maintenance Agreement", "rowNum": 20, "height": "auto", "sortname": "maID", "rowList": [10, 20, 50], "footerrow": false, "userDataOnFooter": false, "grouping": true, "groupingView": { "groupField": ["CompanyName"], "groupColumnShow": [false], "groupText": ["<b> Company Name: {0}</b>"], "groupDataSorted": true, "groupSummary": [true] }, "onSelectRow": function (rowid, selected) { if (rowid != null) { jQuery("#detail").jqGrid('setGridParam', { postData: { CompanyID: rowid } }); jQuery("#detail").trigger("reloadGrid"); // Enable CRUD buttons in navigator when a row is selected jQuery("#add_detail").removeClass("ui-state-disabled"); jQuery("#edit_detail").removeClass("ui-state-disabled"); jQuery("#del_detail").removeClass("ui-state-disabled"); } }, "onSortCol": function (rowid, selected) { // clear the grid data and footer data jQuery("#detail").jqGrid('clearGridData', true); // Disable CRUD buttons in navigator when a row is not selected jQuery("#add_detail").addClass("ui-state-disabled"); jQuery("#edit_detail").addClass("ui-state-disabled"); jQuery("#del_detail").addClass("ui-state-disabled"); }, "onPaging": function (rowid, selected) { // clear the grid data and footer data jQuery("#detail").jqGrid('clearGridData', true); // Disable CRUD buttons in navigator when a row is not selected jQuery("#add_detail").addClass("ui-state-disabled"); jQuery("#edit_detail").addClass("ui-state-disabled"); jQuery("#del_detail").addClass("ui-state-disabled"); }, "datatype": "json", "colModel": [ { "name": "Action", "formatter": "actions", "editable": false, "sortable": false, "resizable": false, "fixed": true, "width": 60, "formatoptions": { "keys": true }, "search": false }, { "name": "CompanyID", "index": "CompanyID", "sorttype": "int", "label": "ID", "hidden": true, "width": 30, "editable": false, "editoptions": { "readonly": "readonly" } }, { "name": "CompanyCode", "index": "CompanyCode", "sorttype": "string", "label": "Company Code", "hidden": true, "width": 50, "align": "center", "editable": true }, { "name": "CompanyName", "index": "CompanyName", "sorttype": "string", "label": "Company Name", "hidden": true, "editable": false, "width": 150, "align": "center", "fixed": true, "edittype": "select", "editoptions": { "value": "Aquatex Industries:Aquatex Industries;Benithem Sdn Bhd:Benithem Sdn Bhd;Daily Bakery Sdn Bhd:Daily Bakery Sdn Bhd;Eurocor Asia Sdn Bhd:Eurocor Asia Sdn Bhd;Evergrown Technology:Evergrown Technology;Goldpar Precision:Goldpar Precision;MicroSun Technologies Asia:MicroSun Technologies Asia;NCI Industries Sdn Bhd:NCI Industries Sdn Bhd;PHHP Marketing:PHHP Marketing;Smart Touch Technology:Smart Touch Technology;THOSCO Treatech:THOSCO Treatech;YHL Trading (Johor) Sdn Bhd:YHL Trading (Johor) Sdn Bhd;Zenxin Agri-Organic Food:Zenxin Agri-Organic Food", "separator": ":", "delimiter": ";" }, "stype": "select", "searchoptions": { "value": ":All;Aquatex Industries:Aquatex Industries;Benithem Sdn Bhd:Benithem Sdn Bhd;Daily Bakery Sdn Bhd:Daily Bakery Sdn Bhd;Eurocor Asia Sdn Bhd:Eurocor Asia Sdn Bhd;Evergrown Technology:Evergrown Technology;Goldpar Precision:Goldpar Precision;MicroSun Technologies Asia:MicroSun Technologies Asia;NCI Industries Sdn Bhd:NCI Industries Sdn Bhd;PHHP Marketing:PHHP Marketing;Smart Touch Technology:Smart Touch Technology;THOSCO Treatech:THOSCO Treatech;YHL Trading (Johor) Sdn Bhd:YHL Trading (Johor) Sdn Bhd;Zenxin Agri-Organic Food:Zenxin Agri-Organic Food", "separator": ":", "delimiter": ";" } }, { "name": "Area", "index": "Area", "sorttype": "string", "width": 100, "hidden": true, "editable": false, "fixed": true, "edittype": "select", "editoptions": { "value": "Cemerlang:Cemerlang;Danga Bay:Danga Bay;Kulai:Kulai;Larkin:Larkin;Masai:Masai;Nusa Cemerlang:Nusa Cemerlang;Nusajaya:Nusajaya;Pasir Gudang:Pasir Gudang;Pekan Nenas:Pekan Nenas;Permas Jaya:Permas Jaya;Pontian:Pontian;Pulai:Pulai;Senai:Senai;Skudai:Skudai;Taman Gaya:Taman Gaya;Taman Johor Jaya:Taman Johor Jaya;Taman Molek:Taman Molek;Taman Pelangi:Taman Pelangi;Taman Sentosa:Taman Sentosa;Tebrau 4:Tebrau 4;Ulu Tiram:Ulu Tiram", "separator": ":", "delimiter": ";" }, "stype": "select", "searchoptions": { "value": ":All;Cemerlang:Cemerlang;Danga Bay:Danga Bay;Kulai:Kulai;Larkin:Larkin;Masai:Masai;Nusa Cemerlang:Nusa Cemerlang;Nusajaya:Nusajaya;Pasir Gudang:Pasir Gudang;Pekan Nenas:Pekan Nenas;Permas Jaya:Permas Jaya;Pontian:Pontian;Pulai:Pulai;Senai:Senai;Skudai:Skudai;Taman Gaya:Taman Gaya;Taman Johor Jaya:Taman Johor Jaya;Taman Molek:Taman Molek;Taman Pelangi:Taman Pelangi;Taman Sentosa:Taman Sentosa;Tebrau 4:Tebrau 4;Ulu Tiram:Ulu Tiram", "separator": ":", "delimiter": ";" } }, { "name": "OrderCode", "index": "OrderCode", "sorttype": "string", "label": "Order No.", "width": 110, "editable": false, "align": "center", "fixed": true }, { "name": "Date", "index": "Date", "sorttype": "date", "label": "Order Date", "width": 100, "editable": false, "align": "center", "fixed": true, "formatter": "date", "formatoptions": { "srcformat": "Y-m-d H:i:s", "newformat": "d M Y" }, "editoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } }, "searchoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } } }, { "name": "maID", "index": "maID", "sorttype": "int", "key": true, "hidden": true, "editable": true }, { "name": "System", "index": "System", "sorttype": "string", "width": 150, "fixed": true, "align": "center", "edittype": "select", "editoptions": { "value": "Payroll:Payroll;TMS:TMS;TMS & Payroll:TMS & Payroll", "separator": ":", "delimiter": ";" }, "stype": "select", "searchoptions": { "value": ":All;Payroll:Payroll;TMS:TMS;TMS & Payroll:TMS & Payroll", "separator": ":", "delimiter": ";" }, "editable": true }, { "name": "Status", "index": "Status", "sorttype": "string", "width": 70, "align": "center", "edittype": "select", "editoptions": { "value": "Yes:Yes;No:No" }, "fixed": true, "editable": true }, { "name": "StartDate", "index": "StartDate", "sorttype": "date", "label": "Start Date", "width": 120, "align": "center", "fixed": true, "formatter": "date", "formatoptions": { "srcformat": "Y-m-d H:i:s", "newformat": "d M Y" }, "editoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } }, "searchoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } }, "editable": true }, { "name": "EndDate", "index": "EndDate", "sorttype": "date", "label": "End Date", "width": 120, "align": "center", "fixed": true, "formatter": "date", "formatoptions": { "srcformat": "Y-m-d H:i:s", "newformat": "d M Y" }, "editoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } }, "searchoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } }, "editable": true }, { "name": "Type", "index": "Type", "sorttype": "string", "width": 530, "fixed": true, "edittype": "select", "editoptions": { "value": "Comprehensive MA:Comprehensive MA;FOC service, 20% spare part discount:FOC service, 20% spare part discount;Standard Package, FOC 1 time service, 20% spare part discount:Standard Package, FOC 1 time service, 20% spare part discount;Standard Package, FOC 2 time service, 20% spare part discount:Standard Package, FOC 2 time service, 20% spare part discount;Standard Package, FOC 3 time service, 20% spare part discount:Standard Package, FOC 3 time service, 20% spare part discount;Standard Package, FOC 4 time service, 20% spare part discount:Standard Package, FOC 4 time service, 20% spare part discount;Standard Package, FOC 6 time service, 20% spare part discount:Standard Package, FOC 6 time service, 20% spare part discount;Standard Package, no free:Standard Package, no free", "separator": ":", "delimiter": ";" }, "stype": "select", "searchoptions": { "value": ":All;Comprehensive MA:Comprehensive MA;FOC service, 20% spare part discount:FOC service, 20% spare part discount;Standard Package, FOC 1 time service, 20% spare part discount:Standard Package, FOC 1 time service, 20% spare part discount;Standard Package, FOC 2 time service, 20% spare part discount:Standard Package, FOC 2 time service, 20% spare part discount;Standard Package, FOC 3 time service, 20% spare part discount:Standard Package, FOC 3 time service, 20% spare part discount;Standard Package, FOC 4 time service, 20% spare part discount:Standard Package, FOC 4 time service, 20% spare part discount;Standard Package, FOC 6 time service, 20% spare part discount:Standard Package, FOC 6 time service, 20% spare part discount;Standard Package, no free:Standard Package, no free", "separator": ":", "delimiter": ";" }, "editable": true } ], "postData": { "oper": "grid" }, "prmNames": { "page": "page", "rows": "rows", "sort": "sidx", "order": "sord", "search": "_search", "nd": "nd", "id": "maID", "filter": "filters", "searchField": "searchField", "searchOper": "searchOper", "searchString": "searchString", "oper": "oper", "query": "grid", "addoper": "add", "editoper": "edit", "deloper": "del", "excel": "excel", "subgrid": "subgrid", "totalrows": "totalrows", "autocomplete": "autocmpl" }, "loadError": function(xhr, status, err) { try { jQuery.jgrid.info_dialog(jQuery.jgrid.errors.errcap, '<div class="ui-state-error">' + xhr.responseText + '</div>', jQuery.jgrid.edit.bClose, { buttonalign: 'right' } ); } catch(e) { alert(xhr.responseText); } }, "pager": "#pager" }); jQuery('#grid').jqGrid('navGrid', '#pager', { "edit": true, "add": false, "del": false, "search": true, "refresh": true, "view": true, "excel": true, "pdf": true, "csv": false, "columns": false }, { "drag": true, "resize": true, "closeOnEscape": true, "dataheight": "auto", "errorTextFormat": function (r) { return r.responseText; }, "closeAfterEdit": true, "editCaption": "Update Company", "bSubmit": "Update" }, { "drag": true, "resize": true, "closeOnEscape": true, "dataheight": "auto", "errorTextFormat": function (r) { return r.responseText; }, "closeAfterAdd": true, "addCaption": "Add New Company", "bSubmit": "Update" }, { "errorTextFormat": function (r) { return r.responseText; } }, { "drag": true, "closeAfterSearch": true, "multipleSearch": true }, { "drag": true, "resize": true, "closeOnEscape": true, "dataheight": "auto", "Caption": "View Company", "width": "1100" } ); jQuery('#grid').jqGrid('navButtonAdd', '#pager', { id: 'pager_excel', caption: '', title: 'Export To Excel', onClickButton: function (e) { try { jQuery("#grid").jqGrid('excelExport', { tag: 'excel', url: 'session_ma_details.php' }); } catch (e) { window.location = 'session_ma_details.php?oper=excel'; } }, buttonicon: 'ui-icon-newwin' }); jQuery('#grid').jqGrid('navButtonAdd', '#pager', { id: 'pager_pdf', caption: '', title: 'Export To Pdf', onClickButton: function (e) { try { jQuery("#grid").jqGrid('excelExport', { tag: 'pdf', url: 'session_ma_details.php' }); } catch (e) { window.location = 'session_ma_details.php?oper=pdf'; } }, buttonicon: 'ui-icon-print' }); jQuery('#grid').jqGrid('filterToolbar', { "stringResult": true, "searchOnEnter": false, "defaultSearch": "cn" }); jQuery("#getselected").click(function () { var selr = jQuery('#grid').jqGrid('getGridParam', 'selrow'); if (selr) { window.open('http://www.smartouch-cdms.com/order.php?CompanyID=' + selr); } else alert("No selected row"); return false; }); });

    Read the article

  • QValidator for hex input

    - by Evan Teran
    I have a Qt widget which should only accept a hex string as input. It is very simple to restrict the input characters to [0-9A-Fa-f], but I would like to have it display with a delimiter between "bytes" so for example if the delimiter is a space, and the user types 0011223344 I would like the line edit to display 00 11 22 33 44 Now if the user presses the backspace key 3 times, then I want it to display 00 11 22 3. I almost have what i want, so far there is only one subtle bug involving using the delete key to remove a delimiter. Does anyone have a better way to implement this validator? Here's my code so far: class HexStringValidator : public QValidator { public: HexStringValidator(QObject * parent) : QValidator(parent) {} public: virtual void fixup(QString &input) const { QString temp; int index = 0; // every 2 digits insert a space if they didn't explicitly type one Q_FOREACH(QChar ch, input) { if(std::isxdigit(ch.toAscii())) { if(index != 0 && (index & 1) == 0) { temp += ' '; } temp += ch.toUpper(); ++index; } } input = temp; } virtual State validate(QString &input, int &pos) const { if(!input.isEmpty()) { // TODO: can we detect if the char which was JUST deleted // (if any was deleted) was a space? and special case this? // as to not have the bug in this case? const int char_pos = pos - input.left(pos).count(' '); int chars = 0; fixup(input); pos = 0; while(chars != char_pos) { if(input[pos] != ' ') { ++chars; } ++pos; } // favor the right side of a space if(input[pos] == ' ') { ++pos; } } return QValidator::Acceptable; } }; For now this code is functional enough, but I'd love to have it work 100% as expected. Obviously the ideal would be the just separate the display of the hex string from the actual characters stored in the QLineEdit's internal buffer but I have no idea where to start with that and I imagine is a non-trivial undertaking. In essence, I would like to have a Validator which conforms to this regex: "[0-9A-Fa-f]( [0-9A-Fa-f])*" but I don't want the user to ever have to type a space as delimiter. Likewise, when editing what they types, the spaces should be managed implicitly.

    Read the article

  • Mysql stored procedure where clause

    - by Mneva skoko
    I am having a problem with this stored procedure: Delimiter // Create procedure(in varchar(50)) Begin Select * from employees where email = eml; End// Delimiter ; I don't get errors when I run this procedure but when i call it in my php script it returns nothing.

    Read the article

  • What is wrong with this trigger in mysql?

    - by Jimit
    Hi all, Below is trigger that I need to create but It is not getting created.Please any buddy can explain me what is wrong with this trigger ? Help me please. DELIMITER $$ CREATE TRIGGER property_history_update AFTER UPDATE ON `properties` FOR EACH ROW BEGIN IF OLD.ListPrice != NEW.ListPrice THEN INSERT INTO `property_history` SET ListingKey=OLD.ListingKey,ListPrice = NEW.ListPrice, ListingStatus = OLD.ListingStatus,LastUpdatedTime = NEW.LocalLastModifiedOn; END IF; END$$ DELIMITER ;

    Read the article

  • Get scanner to include but ignore quoted text?

    - by user1086516
    Basically my problem is this, I need to parse text where , is the delimiter but anything in " " quotes should not be checked for a delimiter. Is this what the Scanner.skip method is for? I would check it myself but I don't understand how to write a regex pattern in java where the token is something in between two " ". I also want to include any quoted text in the proper token which was delimited by the valid ,.

    Read the article

  • Please verify the trigger created below for delete is correct or not?

    - by Parth
    Please verify the trigger created below for delete is correct or not? Its for the insertion of every field of deleted row in audit table.. Please reply whether this trigger will work for me? delimiter // CREATE TRIGGER audit_menu BEFORE DELETE ON menu FOR EACH ROW BEGIN INSERT INTO audit (menuid, field, oldvalue, changedone) VALUES (OLD.menuid, 'name', OLD.name, UNIX_TIMESTAMP() ), (OLD.menuid, 'age', OLD.age, UNIX_TIMESTAMP() ), (OLD.menuid, 'address', OLD.address, UNIX_TIMESTAMP() ), (OLD.menuid, 'sex', OLD.sex, UNIX_TIMESTAMP() ), (OLD.menuid, 'town', OLD.town, UNIX_TIMESTAMP() ) END;// delimiter ;

    Read the article

  • MySQL get variable from SELECT

    - by rlb.usa
    MySQL keeps saying my syntax is incorrect. I want to do this: DELIMITER $$ DROP PROCEDURE IF EXISTS `myprocedure` $$ CREATE DEFINER=`db`@`%` PROCEDURE `myprocedure`( var_name varchar(10) ) BEGIN /* syntax errors below */ DECLARE countTemp integer; SET countTemp=(SELECT COUNT(Name) FROM mytable WHERE Name= var_name); /* more stuff */ END $$ DELIMITER ; What's the correct syntax?

    Read the article

  • How to quickly parse a list of strings

    - by math
    If I want to split a list of words separated by a delimiter character, I can use >>> 'abc,foo,bar'.split(',') ['abc', 'foo', 'bar'] But how to easily and quickly do the same thing if I also want to handle quoted-strings which can contain the delimiter character ? In: 'abc,"a string, with a comma","another, one"' Out: ['abc', 'a string, with a comma', 'another, one'] Related question: How can i parse a comma delimited string into a list (caveat)?

    Read the article

  • Is there a workaround for JDBC w/liquibase and MySQL session variables & client side SQL instructions

    - by David
    Slowly building a starter changeSet xml file for one of three of my employer's primary schema's. The only show stopper has been incorporating the sizable library of MySQL stored procedures to be managed by liquibase. One sproc has been somewhat of a pain to deal with: The first few statements go like use TargetSchema; select "-- explanatory inline comment thats actually useful --" into vDummy; set @@session.sql_mode='TRADITIONAL' ; drop procedure if exists adm_delete_stats ; delimiter $$ create procedure adm_delete_stats( ...rest of sproc I cut out the use statement as its counter-productive, but real issue is the set @@session.sql_mode statement which causes an exception like liquibase.exception.MigrationFailedException: Migration failed for change set ./foobarSchema/sprocs/adm_delete_stats.xml::1293560556-151::dward_autogen dward: Reason: liquibase.exception.DatabaseException: Error executing SQL ... And then the delimiter statement is another stumbling block. Doing do dilligence research I found this rejected MySQL bug report here and this MySQL forum thread that goes a little bit more in depth to the problem here. Is there anyway I can use the sproc scripts that currently exist with Liquibase or would I have to re-write several hundred stored procedures? I've tried createProcedure, sqlFile, and sql liquibase tags without much luck as I think the core issue is that set, delimiter, and similar SQL commands are meant to be interpreted and acted upon by the client side interpreter before being delivered to the server.

    Read the article

  • Why does this MySQL function return null?

    - by Shore
    Description: the query actually run have 4 results returned,as can be see from below, what I did is just concate the items then return, but unexpectedly,it's null. I think the code is self-explanatory: DELIMITER | DROP FUNCTION IF EXISTS get_idiscussion_ask| CREATE FUNCTION get_idiscussion_ask(iask_id INT UNSIGNED) RETURNS TEXT DETERMINISTIC BEGIN DECLARE done INT DEFAULT 0; DECLARE body varchar(600); DECLARE created DATETIME; DECLARE anonymous TINYINT(1); DECLARE screen_name varchar(64); DECLARE result TEXT; DECLARE cur1 CURSOR FOR SELECT body,created,anonymous,screen_name from idiscussion left join users on idiscussion.uid=users.id where idiscussion.iask_id=iask_id; DECLARE CONTINUE HANDLER FOR SQLSTATE '02000' SET done = 1; SET result = ''; OPEN cur1; REPEAT FETCH cur1 INTO body, created, anonymous, screen_name; SET result = CONCAT(result,'<comment><body><![CDATA[',body,']]></body>','<replier>',if(screen_name is not null and !anonymous,screen_name,''),'</replier>','<created>',created,'</created></comment>'); UNTIL done END REPEAT; CLOSE cur1; RETURN result; END | DELIMITER ; mysql> DELIMITER ; mysql> select get_idiscussion_ask(1); +------------------------+ | get_idiscussion_ask(1) | +------------------------+ | NULL | +------------------------+ 1 row in set (0.01 sec) mysql> SELECT body,created,anonymous,screen_name from idiscussion left join users on idiscussion.uid=users.id where idiscussion.iask_id=1; +------+---------------------+-----------+-------------+ | body | created | anonymous | screen_name | +------+---------------------+-----------+-------------+ | haha | 2009-05-27 04:57:51 | 0 | NULL | | haha | 2009-05-27 04:57:52 | 0 | NULL | | haha | 2009-05-27 04:57:52 | 0 | NULL | | haha | 2009-05-27 04:57:53 | 0 | NULL | +------+---------------------+-----------+-------------+ 4 rows in set (0.00 sec) For those who don't think the code is self-explanatory: Why the function returns NULL?

    Read the article

  • MySQL db Audit Trail Trigger

    - by Natkeeran
    I need to track changes (audit trail) in certain tables in a MySql Db. I am trying to implement the solution suggested here. I have an AuditLog Table with the following columns: AuditLogID, TableName, RowPK, FieldName, OldValue, NewValue, TimeStamp. The mysql stored procedure is the following (this executes fine, and creates the procedure): The call to the procedure such as: CALL addLogTrigger('ProductTypes', 'ProductTypeID'); executes, but does not create any triggers (see the image). SHOW TRIGGERS returns empty set. Please let me know what could be the issue, or an alternate way to implement this. DROP PROCEDURE IF EXISTS addLogTrigger; DELIMITER $ CREATE PROCEDURE addLogTrigger(IN tableName VARCHAR(255), IN pkField VARCHAR(255)) BEGIN SELECT CONCAT( 'DELIMITER $\n', 'CREATE TRIGGER ', tableName, '_AU AFTER UPDATE ON ', tableName, ' FOR EACH ROW BEGIN ', GROUP_CONCAT( CONCAT( 'IF NOT( OLD.', column_name, ' <=> NEW.', column_name, ') THEN INSERT INTO AuditLog (', 'TableName, ', 'RowPK, ', 'FieldName, ', 'OldValue, ', 'NewValue' ') VALUES ( ''', table_name, ''', NEW.', pkField, ', ''', column_name, ''', OLD.', column_name, ', NEW.', column_name, '); END IF;' ) SEPARATOR ' ' ), ' END;$' ) FROM information_schema.columns WHERE table_schema = database() AND table_name = tableName; END$ DELIMITER ;

    Read the article

  • import text file containing line breaks into excel

    - by Maximilian Tyrtania
    I have a plain text file looking like this: "some text containing line breaks" I'm trying to talk excel 2004 (Mac, v.11.5) into opening this file correctly. I'd expect to see only one cell (A1) containing all of the above (without the quotes)... But alas, I can't make it happen, because Excel seems to insist on using the CR's as row delimiters, even if I set the text qualifier to double quote. I was sort of hoping that Excel would understand that those line breaks are part of the value - they are embedded in double quotes which should qualify them as part of the value. So my Excel sheet has 5 rows, which is not what I want. I also tried this Applescript to no avail: tell application "Microsoft Excel" activate open text file filename ¬ "Users:maximiliantyrtania:Desktop:linebreaks" data type delimited ¬ text qualifier text qualifier double quote ¬ field info {{1, text format}} ¬ origin Macintosh with tab end tell If I could tell Excel to use a row delimiter other than CR (or LF), well, I'd be a happy camper, but excel seems to allow the change of the field delimiter only, not the row delimiter. Any pointers? Thanks, Max Excel's open

    Read the article

  • Stop writing blank line at the end of CSV file (using MATLAB)

    - by Grant M.
    Hello all ... I'm using MATLAB to open a batch of CSV files containing column headers and data (using the 'importdata' function), then I manipulate the data a bit and write the headers and data to new CSV files using the 'dlmwrite' function. I'm using the '-append' and 'newline' attributes of 'dlmwrite' to add each line of text/data on a new line. Each of my new CSV files has a blank line at the end, whereas this blank line was not there before when I read in the data ... and I'm not using 'newline' on my final call of 'dlmwrite'. Does anyone know how I can keep from writing this blank line to the end of my CSV files? Thanks for your help, Grant EDITED 5/18/10 1:35PM CST - Added information about code and text file per request ... you'll notice after performing the procedure below that there appears to be a carriage return at the end of the last line in the new text file. Consider a text file named 'textfile.txt' that looks like this: Column1, Column2, Column3, Column4, Column 5 1, 2, 3, 4, 5 1, 2, 3, 4, 5 1, 2, 3, 4, 5 1, 2, 3, 4, 5 1, 2, 3, 4, 5 Here's a sample of the code I am using: % import data importedData = importdata('textfile.txt'); % manipulate data importedData.data(:,1) = 100; % store column headers into single comma-delimited % character array (for easy writing later) columnHeaders = importedData.textdata{1}; for counter = 2:size(importedData.textdata,2) columnHeaders = horzcat(columnHeaders,',',importedData.textdata{counter}); end % write column headers to new file dlmwrite('textfile_updated.txt',columnHeaders,'Delimiter','','newline','pc') % append all but last line of data to new file for dataCounter = 1:(size(importedData.data,2)-1) dlmwrite('textfile_updated.txt',importedData.data(dataCounter,:),'Delimiter',',','newline','pc','-append') end % append last line of data to new file, not % creating new line at end dlmwrite('textfile_updated.txt',importedData.data(end,:),'Delimiter',',','-append')

    Read the article

  • Easiest way to open CSV with commas in Excel

    - by Borek
    CSV files are automatically associated with Excel but when I open them, all the rows are basically in the first column, like this: It's probably because when Excel thinks "comma-separated values", it actually searches for some other delimiter (I think it's semicolon but it's not important). Now when I have already opened this file in Excel, is there a button or something to tell it "reopen this file and use comma as a delimiter"? I know I can import the data into a new worksheet etc. but I'm asking specifically for a help with situation where I already have a CSV file with commas in it and I want to open it in Excel without creating new workbook or transforming the original file.

    Read the article

  • Adding a MySQL StoredProcedure causes not responding state

    - by Omie
    Hello I'm on Windows 7 ultimate 32bit + xampp 1.7.2 [MySQL v5.1.37] This is my stored procedure : delimiter // CREATE PROCEDURE updatePoints(IN parentid INT(5),IN userid INT(5)) DECLARE chpoints INT(5); BEGIN SELECT points INTO chpoints FROM quiz_challenges WHERE id = parentid; UPDATE quiz_users SET points = points + chpoints WHERE forumid=userid; END; // delimiter ; At first it was showing error 1064 while creating stored procedure. I added delimiters part and when I tried running the query from phpmyadmin, Firefox went into not responding state. After that I started Internet Explorer and tried opening my pages which use the same database, it worked fine. However, I tried opening phpmyadmin and IE went into not responding state as well. I restarted both servers. Later restarted PC. Tried again but its same behavior. So whats wrong with this tiny little code ? Am I missing something which might be causing infinite loop ? Thanks

    Read the article

  • Adding a MySQL StoredProcedure causes not responding state

    - by Omie
    I'm on Windows 7 ultimate 32bit + xampp 1.7.2 [MySQL v5.1.37] This is my stored procedure : delimiter // CREATE PROCEDURE updatePoints(IN parentid INT(5),IN userid INT(5)) DECLARE chpoints INT(5); BEGIN SELECT points INTO chpoints FROM quiz_challenges WHERE id = parentid; UPDATE quiz_users SET points = points + chpoints WHERE forumid=userid; END; // delimiter ; At first it was showing error 1064 while creating stored procedure. I added delimiters part and when I tried running the query from phpmyadmin, Firefox went into not responding state. After that I started Internet Explorer and tried opening my pages which use the same database, it worked fine. However, I tried opening phpmyadmin and IE went into not responding state as well. I restarted both servers. Later restarted PC. Tried again but its same behavior. So whats wrong with this tiny little code ? Am I missing something which might be causing infinite loop ? Thanks

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

< Previous Page | 1 2 3 4 5 6 7 8 9 10 11 12  | Next Page >