Search Results

Search found 403 results on 17 pages for 'separator'.

Page 5/17 | < Previous Page | 1 2 3 4 5 6 7 8 9 10 11 12  | Next Page >

  • Some PowerShell goodness

    - by KyleBurns
    Ever work somewhere where processes dump files into folders to maintain an archive?  Me too and Windows Explorer hates it.  Very often I find myself needing to organize these files into subfolders so that I can go after files without locking up Windows Explorer and my answer used to be to write a program in something like C# to do the job.  These programs will typically enumerate the files in a folder and move each file to a subdirectory named based on a datestamp.  The last such program I wrote had to use lower-level Win32 API calls to perform the enumeration because it appears the standard .Net calls make use of the same method of enumerating the directories that Windows Explorer chokes on when dealing with a large number of entries in a particular directory, so a simple task was accomplished with a lot of code. Of course, this little utility was just something I used to make my life easier and "not a production app", so it was in my local source folder and not source control when my hard drive died.  So... I was getting ready to re-create it and thought it might be a good idea to play with PowerShell a bit - something I had been wanting to do but had not yet met a requirement to make me do it.  The resulting script was amazingly succinct and even building the flexibility for parameterization and adding line breaks for readability was only about 25 lines long.  Here's the code with discussion following: param(     [Parameter(         Mandatory = $false,         Position = 0,         HelpMessage = "Root of the folders or share to archive.  Be sure to end with appropriate path separator"     )]     [String] $folderRoot="\\fileServer\pathToFolderWithLotsOfFiles\",       [Parameter(         Mandatory = $false,         Position = 1     )]     [int] $days = 1 ) dir $folderRoot|?{(!($_.PsIsContainer)) -and ((get-date) - $_.lastwritetime).totaldays -gt $days }|%{     [string]$year=$([string]$_.lastwritetime.year)     [string]$month=$_.lastwritetime.month     [string]$day=$_.lastwritetime.day     $dir=$folderRoot+$year+"\"+$month+"\"+$day     if(!(test-path $dir)){         new-item -type container $dir     }     Write-output $_     move-item $_.fullname $dir } The script starts by declaring two parameters.  The first parameter holds the path to the folder that I am going to be sorting into subdirectories.  The path separator is intended to be included in this argument because I didn't want to mess with determining whether this was local or UNC and picking the right separator in code, but this could be easily improved upon using Path.Combine since PowerShell has access to the full framework libraries.  The second parameter holds a minimum age in days for files to be removed from the root folder.  The script then pipes the dir command through a query to include only files (by excluding containers) and of those, only entries that meet the age requirement based on the last modified datestamp.  For each of those, the datestamp is used to construct a folder name in the format YYYY\MM\DD (if you're in an environment where even a day's worth of files need further divided, you could make this more granular) and the folder is created if it does not yet exist.  Finally, the file is moved into the directory. One of the things that was really cool about using PowerShell for this task is that the new-item command is smart enough to create the entire subdirectory structure with a single call.  In previous code that I have written to do this kind of thing, I would have to test the entire tree leading down to the subfolder I want, leading to a lot of branching code that detracted from being able to quickly look at the code and understand the job it performs. Overall, I have to say I'm really pleased with what has been done making PowerShell powerful and useful.

    Read the article

  • Seperator in dock in osx

    - by sagar
    I have placed too many icons in my dock. there is by default a separator in dock between applications & trash. I want to add more separators in my dock - for grouping purpose. say for example finder, preview, itunes, system pref.,activity monitor FOR Mac osx group Mozilla, safari - for Browsing group Odesk, skype, ipmessanger, adium, team viewer for communication Means, I just want to add separator to identify them very quickly. Is it possible ? if yes - how ? Thanks in advance for sharing your knowledge. sagar

    Read the article

  • Installing Glassfish 3.1 on Ubuntu 10.10 Server

    - by andand
    I've used the directions here to successfully install Glassfish 3.0.1 on an virtualized (VirtualBox and VMWare) Ubuntu 10.10 Server instance without any real difficulty not resolved by more closely following the directions. However when I try applying them to Glassfish 3.1, I seem to keep getting stuck at section 6. "Security configuration before first startup". In particular, there are some differences I noted: 1) There are two keys in the default keystore. The 's1as' key is still there, but another named 'glassfish-instance' is also there. When I saw this, I deleted and recreated them both along with a 'myAlias' key which I was going to use where needed. 2) When turning the security on it seems like part of the server thinks it's on, but others don't. For instances: $ /home/glassfish/bin/asadmin set server-config.network-config.protocols.protocol.admin-listener.security-enabled=true server-config.network-config.protocols.protocol.admin-listener.security-enabled=true Command set executed successfully. $ /home/glassfish/bin/asadmin get server-config.network-config.protocols.protocol.admin-listener.security-enabled server-config.network-config.protocols.protocol.admin-listener.security-enabled=true Command get executed successfully. $ /home/glassfish/bin/asadmin --secure list-jvm-options It appears that server [localhost:4848] does not accept secure connections. Retry with --secure=false. javax.net.ssl.SSLHandshakeException: Remote host closed connection during handshake Command list-jvm-options failed. $ /home/glassfish/bin/asadmin --secure=false list-jvm-options -XX:MaxPermSize=192m -client -Djavax.management.builder.initial=com.sun.enterprise.v3.admin.AppServerMBeanServerBuilder -XX: UnlockDiagnosticVMOptions -Djava.endorsed.dirs=${com.sun.aas.installRoot}/modules/endorsed${path.separator}${com.sun.aas.installRoot}/lib/endorsed -Djava.security.policy=${com.sun.aas.instanceRoot}/config/server.policy -Djava.security.auth.login.config=${com.sun.aas.instanceRoot}/config/login.conf -Dcom.sun.enterprise.security.httpsOutboundKeyAlias=s1as -Xmx512m -Djavax.net.ssl.keyStore=${com.sun.aas.instanceRoot}/config/keystore.jks -Djavax.net.ssl.trustStore=${com.sun.aas.instanceRoot}/config/cacerts.jks -Djava.ext.dirs=${com.sun.aas.javaRoot}/lib/ext${path.separator}${com.sun.aas.javaRoot}/jre/lib/ext${path.separator}${com.sun.aas.in stanceRoot}/lib/ext -Djdbc.drivers=org.apache.derby.jdbc.ClientDriver -DANTLR_USE_DIRECT_CLASS_LOADING=true -Dcom.sun.enterprise.config.config_environment_factory_class=com.sun.enterprise.config.serverbeans.AppserverConfigEnvironmentFactory -Dorg.glassfish.additionalOSGiBundlesToStart=org.apache.felix.shell,org.apache.felix.gogo.runtime,org.apache.felix.gogo.shell,org.apache.felix.gogo.command -Dosgi.shell.telnet.port=6666 -Dosgi.shell.telnet.maxconn=1 -Dosgi.shell.telnet.ip=127.0.0.1 -Dgosh.args=--nointeractive -Dfelix.fileinstall.dir=${com.sun.aas.installRoot}/modules/autostart/ -Dfelix.fileinstall.poll=5000 -Dfelix.fileinstall.log.level=2 -Dfelix.fileinstall.bundles.new.start=true -Dfelix.fileinstall.bundles.startTransient=true -Dfelix.fileinstall.disableConfigSave=false -XX:NewRatio=2 Command list-jvm-options executed successfully. Also the admin console responds only to http (not https) requests. Thoughts?

    Read the article

  • How to work RavenDB Id with ASP.NET MVC Routes

    - by shiju
    By default RavenDB's Id would be sperated by "/". Let's say that we have a category object, the Ids would be like "categories/1". This will make problems when working with ASP.NET MVC's route rule. For a route category/edit/id, the uri would be category/edit/categories/1. You can solve this problem in two waysSolution 1 - Change Id SeparatorWe can use different Id Separator for RavenDB Ids in order to working with ASP.NET MVC route rules. The following code specify that Ids would be seperated by "-" rather than the default "/"  documentStore = new DocumentStore { Url = "http://localhost:8080/" };  documentStore.Initialize();  documentStore.Conventions.IdentityPartsSeparator = "-"; The above IdentityPartsSeparator would be generate Ids like "categories-1"Solution 2 - Modify ASP.NET MVC Route Modify the ASP.NET MVC routes in the Global.asax.cs file, as shown in the following code  routes.MapRoute(     "WithParam",                                           // Route name     "{controller}/{action}/{*id}"                         // URL with parameters     );  We just put "*" in front of the id variable that will be working with the default Id separator of RavenDB

    Read the article

  • Drupal views pane content not visible

    - by jwandborg
    I have a pane on my front page with one content pane and two views panes. I can't see the content of the third view ($pane->pid = "new-3" / comment: # Senaste bilder). Here's my panel <?php $page = new stdClass; $page->disabled = FALSE; /* Edit this to true to make a default page disabled initially */ $page->api_version = 1; $page->name = 'frontpage'; $page->task = 'page'; $page->admin_title = 'Startsida'; $page->admin_description = ''; $page->path = 'hem'; $page->access = array(); $page->menu = array(); $page->arguments = array(); $page->conf = array(); $page->default_handlers = array(); $handler = new stdClass; $handler->disabled = FALSE; /* Edit this to true to make a default handler disabled initially */ $handler->api_version = 1; $handler->name = 'page_frontpage_panel_context'; $handler->task = 'page'; $handler->subtask = 'frontpage'; $handler->handler = 'panel_context'; $handler->weight = 0; $handler->conf = array( 'title' => 'Panel', 'no_blocks' => FALSE, 'css_id' => '', 'css' => '', 'contexts' => array(), 'relationships' => array(), ); $display = new panels_display; $display->layout = 'onecol'; $display->layout_settings = array(); $display->panel_settings = array(); $display->cache = array(); $display->title = ''; $display->content = array(); $display->panels = array(); # Bild $pane = new stdClass; $pane->pid = 'new-1'; $pane->panel = 'middle'; $pane->type = 'custom'; $pane->subtype = 'custom'; $pane->shown = TRUE; $pane->access = array(); $pane->configuration = array( 'admin_title' => '', 'title' => '', 'body' => '<img src="/sites/all/themes/zen/ils-2010/img/graphics-start-text-v3.png" alt="Hej! Vi vet att du och dina klasskompisar har mycket att tänka på under er sista termin i gymnasiet. Därför har vi samlat några saker som vi tror kommer göra er studenttid lite roligare och lite enklare. Välkommen!" />', 'format' => '2', 'substitute' => TRUE, ); $pane->cache = array(); $pane->style = array(); $pane->css = array(); $pane->extras = array(); $pane->position = 0; $display->content['new-1'] = $pane; $display->panels['middle'][0] = 'new-1'; # Topplista $pane = new stdClass; $pane->pid = 'new-2'; $pane->panel = 'middle'; $pane->type = 'views_panes'; $pane->subtype = 'topplista_terms-panel_pane_1'; $pane->shown = TRUE; $pane->access = array(); $pane->configuration = array( 'link_to_view' => 1, 'more_link' => 0, 'use_pager' => 0, 'pager_id' => '', 'items_per_page' => '10', 'offset' => '0', 'path' => 'flaktavling/topplista/klasser', 'override_title' => 0, 'override_title_text' => '', ); $pane->cache = array(); $pane->style = array(); $pane->css = array(); $pane->extras = array(); $pane->position = 1; $display->content['new-2'] = $pane; $display->panels['middle'][1] = 'new-2'; # Senaste bilder $pane = new stdClass; $pane->pid = 'new-3'; $pane->panel = 'middle'; $pane->type = 'views_panes'; $pane->subtype = 'senaste_bilderna-panel_pane_1'; $pane->shown = TRUE; $pane->access = array(); $pane->configuration = array( 'link_to_view' => 0, 'more_link' => 0, 'use_pager' => 0, 'pager_id' => '', 'items_per_page' => '2', 'offset' => '0', 'path' => 'galleri/senaste-bilder', 'override_title' => 0, 'override_title_text' => '', ); $pane->cache = array(); $pane->style = array(); $pane->css = array( 'css_id' => 'pane-senaste-bilderna', 'css_class' => '', ); $pane->extras = array(); $pane->position = 2; $display->content['new-3'] = $pane; $display->panels['middle'][2] = 'new-3'; $display->hide_title = PANELS_TITLE_FIXED; $display->title_pane = 'new-1'; $handler->conf['display'] = $display; $page->default_handlers[$handler->name] = $handler; Here´s the view senaste_bilderna <?php $view = new view; $view->name = 'senaste_bilderna'; $view->description = ''; $view->tag = ''; $view->view_php = ''; $view->base_table = 'node'; $view->is_cacheable = FALSE; $view->api_version = 2; $view->disabled = FALSE; /* Edit this to true to make a default view disabled initially */ $handler = $view->new_display('default', 'Förvalt', 'default'); $handler->override_option('fields', array( 'field_picture_fid' => array( 'id' => 'field_picture_fid', 'table' => 'node_data_field_picture', 'field' => 'field_picture_fid', ), )); $handler->override_option('sorts', array( 'created' => array( 'order' => 'DESC', 'granularity' => 'second', 'id' => 'created', 'table' => 'node', 'field' => 'created', 'relationship' => 'none', ), )); $handler->override_option('filters', array( 'type' => array( 'operator' => 'in', 'value' => array( 'ils_picture' => 'ils_picture', ), 'group' => '0', 'exposed' => FALSE, 'expose' => array( 'operator' => FALSE, 'label' => '', ), 'id' => 'type', 'table' => 'node', 'field' => 'type', 'override' => array( 'button' => 'Åsidosätt', ), 'relationship' => 'none', ), )); $handler->override_option('access', array( 'type' => 'none', )); $handler->override_option('cache', array( 'type' => 'none', )); $handler->override_option('title', 'Senaste bilderna från galleriet'); $handler->override_option('items_per_page', 2); $handler->override_option('row_options', array( 'inline' => array( 'field_picture_fid' => 'field_picture_fid', ), 'separator' => '', 'hide_empty' => 0, )); $handler = $view->new_display('panel_pane', 'Content pane', 'panel_pane_1'); $handler->override_option('pane_title', ''); $handler->override_option('pane_description', ''); $handler->override_option('pane_category', array( 'name' => 'View panes', 'weight' => 0, )); $handler->override_option('allow', array( 'use_pager' => FALSE, 'items_per_page' => FALSE, 'offset' => FALSE, 'link_to_view' => FALSE, 'more_link' => FALSE, 'path_override' => FALSE, 'title_override' => FALSE, 'exposed_form' => FALSE, )); $handler->override_option('argument_input', array()); $handler->override_option('link_to_view', 0); $handler->override_option('inherit_panels_path', 0); $handler = $view->new_display('page', 'Sida', 'page_1'); $handler->override_option('path', 'galleri/senaste-bilderna'); $handler->override_option('menu', array( 'type' => 'none', 'title' => '', 'description' => '', 'weight' => 0, 'name' => 'navigation', )); $handler->override_option('tab_options', array( 'type' => 'none', 'title' => '', 'description' => '', 'weight' => 0, )); I have edited one views template, here's the code in the file views-view-fields--senaste-bilderna.tpl.php <?php // $Id: views-view-fields.tpl.php,v 1.6 2008/09/24 22:48:21 merlinofchaos Exp $ /** * @file views-view-fields.tpl.php * Default simple view template to all the fields as a row. * * - $view: The view in use. * - $fields: an array of $field objects. Each one contains: * - $field->content: The output of the field. * - $field->raw: The raw data for the field, if it exists. This is NOT output safe. * - $field->class: The safe class id to use. * - $field->handler: The Views field handler object controlling this field. Do not use * var_export to dump this object, as it can't handle the recursion. * - $field->inline: Whether or not the field should be inline. * - $field->inline_html: either div or span based on the above flag. * - $field->separator: an optional separator that may appear before a field. * - $row: The raw result object from the query, with all data it fetched. * * @ingroup views_templates */ ?> <?php foreach ($fields as $id => $field): ?> <?php $result = db_query('SELECT * FROM {files} WHERE fid = ' . $row->node_data_field_picture_field_picture_fid ); ?> <?php $data = db_fetch_object( $result ); ?> <div id="senaste-bilderna-first"><img src="<?= imagecache_create_url('senaste_bilderna_thumbnail', $data->filepath) ?>" alt="" /></div> <?php /* if (!empty($field->separator)): <?php print $field->separator; <?php endif; <<?php print $field->inline_html; class="views-field-<?php print $field->class; "> <?php if ($field->label): <label class="views-label-<?php print $field->class; "> <?php print $field->label; : </label> <?php endif; <?php // $field->element_type is either SPAN or DIV depending upon whether or not // the field is a 'block' element type or 'inline' element type. <<?php print $field->element_type; class="field-content"><?php print $field->content; </<?php print $field->element_type; > </<?php print $field->inline_html;> <?php*/ endforeach; ?> This is the result <div class="panel-separator"> </div> <div class="panel-pane pane-views-panes pane-senaste-bilderna-panel-pane-1" id="pane-senaste-bilderna"> <h2 class="pane-title">Senaste bilderna från galleriet </h2> <div class="pane-content"> <div class="view view-senaste-bilderna view-id-senaste_bilderna view-display-id-panel_pane_1 view-dom-id-2"> <div class="view-content"> <div class="views-row views-row-1 views-row-odd views-row-first"> </div> <div class="views-row views-row-2 views-row-even views-row-last"> </div> </div> </div> </div> </div> My Drupal version is 6.16

    Read the article

  • Added splash screen code to my package

    - by Youssef
    Please i need support to added splash screen code to my package /* * T24_Transformer_FormView.java */ package t24_transformer_form; import org.jdesktop.application.Action; import org.jdesktop.application.ResourceMap; import org.jdesktop.application.SingleFrameApplication; import org.jdesktop.application.FrameView; import org.jdesktop.application.TaskMonitor; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import javax.swing.filechooser.FileNameExtensionFilter; import javax.swing.filechooser.FileFilter; // old T24 Transformer imports import java.io.File; import java.io.FileWriter; import java.io.StringWriter; import java.text.SimpleDateFormat; import java.util.ArrayList; import java.util.Date; import java.util.HashMap; import java.util.Iterator; //import java.util.Properties; import java.util.StringTokenizer; import javax.swing.; import javax.xml.parsers.DocumentBuilder; import javax.xml.parsers.DocumentBuilderFactory; import javax.xml.transform.Result; import javax.xml.transform.Source; import javax.xml.transform.Transformer; import javax.xml.transform.TransformerFactory; import javax.xml.transform.dom.DOMSource; import javax.xml.transform.stream.StreamResult; import org.apache.log4j.Logger; import org.apache.log4j.PropertyConfigurator; import org.w3c.dom.Document; import org.w3c.dom.DocumentFragment; import org.w3c.dom.Element; import org.w3c.dom.Node; import org.w3c.dom.NodeList; import com.ejada.alinma.edh.xsdtransform.util.ConfigKeys; import com.ejada.alinma.edh.xsdtransform.util.XSDElement; import com.sun.org.apache.xml.internal.serialize.OutputFormat; import com.sun.org.apache.xml.internal.serialize.XMLSerializer; /* * The application's main frame. */ public class T24_Transformer_FormView extends FrameView { /**} * static holders for application-level utilities * { */ //private static Properties appProps; private static Logger appLogger; /** * */ private StringBuffer columnsCSV = null; private ArrayList<String> singleValueTableColumns = null; private HashMap<String, String> multiValueTablesSQL = null; private HashMap<Object, HashMap<String, Object>> groupAttrs = null; private ArrayList<XSDElement> xsdElementsList = null; /** * initialization */ private void init() /*throws Exception*/ { // init the properties object //FileReader in = new FileReader(appConfigPropsPath); //appProps.load(in); // log4j.properties constant String PROP_LOG4J_CONFIG_FILE = "log4j.properties"; // init the logger if ((PROP_LOG4J_CONFIG_FILE != null) && (!PROP_LOG4J_CONFIG_FILE.equals(""))) { PropertyConfigurator.configure(PROP_LOG4J_CONFIG_FILE); if (appLogger == null) { appLogger = Logger.getLogger(T24_Transformer_FormView.class.getName()); } appLogger.info("Application initialization successful."); } columnsCSV = new StringBuffer(ConfigKeys.FIELD_TAG + "," + ConfigKeys.FIELD_NUMBER + "," + ConfigKeys.FIELD_DATA_TYPE + "," + ConfigKeys.FIELD_FMT + "," + ConfigKeys.FIELD_LEN + "," + ConfigKeys.FIELD_INPUT_LEN + "," + ConfigKeys.FIELD_GROUP_NUMBER + "," + ConfigKeys.FIELD_MV_GROUP_NUMBER + "," + ConfigKeys.FIELD_SHORT_NAME + "," + ConfigKeys.FIELD_NAME + "," + ConfigKeys.FIELD_COLUMN_NAME + "," + ConfigKeys.FIELD_GROUP_NAME + "," + ConfigKeys.FIELD_MV_GROUP_NAME + "," + ConfigKeys.FIELD_JUSTIFICATION + "," + ConfigKeys.FIELD_TYPE + "," + ConfigKeys.FIELD_SINGLE_OR_MULTI + System.getProperty("line.separator")); singleValueTableColumns = new ArrayList<String>(); singleValueTableColumns.add(ConfigKeys.COLUMN_XPK_ROW + ConfigKeys.DELIMITER_COLUMN_TYPE + ConfigKeys.DATA_TYPE_XSD_NUMERIC); multiValueTablesSQL = new HashMap<String, String>(); groupAttrs = new HashMap<Object, HashMap<String, Object>>(); xsdElementsList = new ArrayList<XSDElement>(); } /** * initialize the <code>DocumentBuilder</code> and read the XSD file * * @param docPath * @return the <code>Document</code> object representing the read XSD file */ private Document retrieveDoc(String docPath) { Document xsdDoc = null; File file = new File(docPath); try { DocumentBuilder builder = DocumentBuilderFactory.newInstance().newDocumentBuilder(); xsdDoc = builder.parse(file); } catch (Exception e) { appLogger.error(e.getMessage()); } return xsdDoc; } /** * perform the iteration/modification on the document * iterate to the level which contains all the elements (Single-Value, and Groups) and start processing each * * @param xsdDoc * @return */ private Document processDoc(Document xsdDoc) { ArrayList<Object> newElementsList = new ArrayList<Object>(); HashMap<String, Object> docAttrMap = new HashMap<String, Object>(); Element sequenceElement = null; Element schemaElement = null; // get document's root element NodeList nodes = xsdDoc.getChildNodes(); for (int i = 0; i < nodes.getLength(); i++) { if (ConfigKeys.TAG_SCHEMA.equals(nodes.item(i).getNodeName())) { schemaElement = (Element) nodes.item(i); break; } } // process the document (change single-value elements, collect list of new elements to be added) for (int i1 = 0; i1 < schemaElement.getChildNodes().getLength(); i1++) { Node childLevel1 = (Node) schemaElement.getChildNodes().item(i1); // <ComplexType> element if (childLevel1.getNodeName().equals(ConfigKeys.TAG_COMPLEX_TYPE)) { // first, get the main attributes and put it in the csv file for (int i6 = 0; i6 < childLevel1.getChildNodes().getLength(); i6++) { Node child6 = childLevel1.getChildNodes().item(i6); if (ConfigKeys.TAG_ATTRIBUTE.equals(child6.getNodeName())) { if (child6.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME) != null) { String attrName = child6.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME).getNodeValue(); if (((Element) child6).getElementsByTagName(ConfigKeys.TAG_SIMPLE_TYPE).getLength() != 0) { Node simpleTypeElement = ((Element) child6).getElementsByTagName(ConfigKeys.TAG_SIMPLE_TYPE) .item(0); if (((Element) simpleTypeElement).getElementsByTagName(ConfigKeys.TAG_RESTRICTION).getLength() != 0) { Node restrictionElement = ((Element) simpleTypeElement).getElementsByTagName( ConfigKeys.TAG_RESTRICTION).item(0); if (((Element) restrictionElement).getElementsByTagName(ConfigKeys.TAG_MAX_LENGTH).getLength() != 0) { Node maxLengthElement = ((Element) restrictionElement).getElementsByTagName( ConfigKeys.TAG_MAX_LENGTH).item(0); HashMap<String, String> elementProperties = new HashMap<String, String>(); elementProperties.put(ConfigKeys.FIELD_TAG, attrName); elementProperties.put(ConfigKeys.FIELD_NUMBER, "0"); elementProperties.put(ConfigKeys.FIELD_DATA_TYPE, ConfigKeys.DATA_TYPE_XSD_STRING); elementProperties.put(ConfigKeys.FIELD_FMT, ""); elementProperties.put(ConfigKeys.FIELD_NAME, attrName); elementProperties.put(ConfigKeys.FIELD_SHORT_NAME, attrName); elementProperties.put(ConfigKeys.FIELD_COLUMN_NAME, attrName); elementProperties.put(ConfigKeys.FIELD_SINGLE_OR_MULTI, "S"); elementProperties.put(ConfigKeys.FIELD_LEN, maxLengthElement.getAttributes().getNamedItem( ConfigKeys.ATTR_VALUE).getNodeValue()); elementProperties.put(ConfigKeys.FIELD_INPUT_LEN, maxLengthElement.getAttributes() .getNamedItem(ConfigKeys.ATTR_VALUE).getNodeValue()); constructElementRow(elementProperties); // add the attribute as a column in the single-value table singleValueTableColumns.add(attrName + ConfigKeys.DELIMITER_COLUMN_TYPE + ConfigKeys.DATA_TYPE_XSD_STRING + ConfigKeys.DELIMITER_COLUMN_TYPE + maxLengthElement.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE).getNodeValue()); // add the attribute as an element in the elements list addToElementsList(attrName, attrName); appLogger.debug("added attribute: " + attrName); } } } } } } // now, loop on the elements and process them for (int i2 = 0; i2 < childLevel1.getChildNodes().getLength(); i2++) { Node childLevel2 = (Node) childLevel1.getChildNodes().item(i2); // <Sequence> element if (childLevel2.getNodeName().equals(ConfigKeys.TAG_SEQUENCE)) { sequenceElement = (Element) childLevel2; for (int i3 = 0; i3 < childLevel2.getChildNodes().getLength(); i3++) { Node childLevel3 = (Node) childLevel2.getChildNodes().item(i3); // <Element> element if (childLevel3.getNodeName().equals(ConfigKeys.TAG_ELEMENT)) { // check if single element or group if (isGroup(childLevel3)) { processGroup(childLevel3, true, null, null, docAttrMap, xsdDoc, newElementsList); // insert a new comment node with the contents of the group tag sequenceElement.insertBefore(xsdDoc.createComment(serialize(childLevel3)), childLevel3); // remove the group tag sequenceElement.removeChild(childLevel3); } else { processElement(childLevel3); } } } } } } } // add new elements // this step should be after finishing processing the whole document. when you add new elements to the document // while you are working on it, those new elements will be included in the processing. We don't need that! for (int i = 0; i < newElementsList.size(); i++) { sequenceElement.appendChild((Element) newElementsList.get(i)); } // write the new required attributes to the schema element Iterator<String> attrIter = docAttrMap.keySet().iterator(); while(attrIter.hasNext()) { Element attr = (Element) docAttrMap.get(attrIter.next()); Element newAttrElement = xsdDoc.createElement(ConfigKeys.TAG_ATTRIBUTE); appLogger.debug("appending attr. [" + attr.getAttribute(ConfigKeys.ATTR_NAME) + "]..."); newAttrElement.setAttribute(ConfigKeys.ATTR_NAME, attr.getAttribute(ConfigKeys.ATTR_NAME)); newAttrElement.setAttribute(ConfigKeys.ATTR_TYPE, attr.getAttribute(ConfigKeys.ATTR_TYPE)); schemaElement.appendChild(newAttrElement); } return xsdDoc; } /** * add a new <code>XSDElement</code> with the given <code>name</code> and <code>businessName</code> to * the elements list * * @param name * @param businessName */ private void addToElementsList(String name, String businessName) { xsdElementsList.add(new XSDElement(name, businessName)); } /** * add the given <code>XSDElement</code> to the elements list * * @param element */ private void addToElementsList(XSDElement element) { xsdElementsList.add(element); } /** * check if the <code>element</code> sent is single-value element or group * element. the comparison depends on the children of the element. if found one of type * <code>ComplexType</code> then it's a group element, and if of type * <code>SimpleType</code> then it's a single-value element * * @param element * @return <code>true</code> if the element is a group element, * <code>false</code> otherwise */ private boolean isGroup(Node element) { for (int i = 0; i < element.getChildNodes().getLength(); i++) { Node child = (Node) element.getChildNodes().item(i); if (child.getNodeName().equals(ConfigKeys.TAG_COMPLEX_TYPE)) { // found a ComplexType child (Group element) return true; } else if (child.getNodeName().equals(ConfigKeys.TAG_SIMPLE_TYPE)) { // found a SimpleType child (Single-Value element) return false; } } return false; /* String attrName = null; if (element.getAttributes() != null) { Node attribute = element.getAttributes().getNamedItem(XSDTransformer.ATTR_NAME); if (attribute != null) { attrName = attribute.getNodeValue(); } } if (attrName.startsWith("g")) { // group element return true; } else { // single element return false; } */ } /** * process a group element. recursively, process groups till no more group elements are found * * @param element * @param isFirstLevelGroup * @param attrMap * @param docAttrMap * @param xsdDoc * @param newElementsList */ private void processGroup(Node element, boolean isFirstLevelGroup, Node parentGroup, XSDElement parentGroupElement, HashMap<String, Object> docAttrMap, Document xsdDoc, ArrayList<Object> newElementsList) { String elementName = null; HashMap<String, Object> groupAttrMap = new HashMap<String, Object>(); HashMap<String, Object> parentGroupAttrMap = new HashMap<String, Object>(); XSDElement groupElement = null; if (element.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME) != null) { elementName = element.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME).getNodeValue(); } appLogger.debug("processing group [" + elementName + "]..."); groupElement = new XSDElement(elementName, elementName); // get the attributes if a non-first-level-group // attributes are: groups's own attributes + parent group's attributes if (!isFirstLevelGroup) { // get the current element (group) attributes for (int i1 = 0; i1 < element.getChildNodes().getLength(); i1++) { if (ConfigKeys.TAG_COMPLEX_TYPE.equals(element.getChildNodes().item(i1).getNodeName())) { Node complexTypeNode = element.getChildNodes().item(i1); for (int i2 = 0; i2 < complexTypeNode.getChildNodes().getLength(); i2++) { if (ConfigKeys.TAG_ATTRIBUTE.equals(complexTypeNode.getChildNodes().item(i2).getNodeName())) { appLogger.debug("add group attr: " + ((Element) complexTypeNode.getChildNodes().item(i2)).getAttribute(ConfigKeys.ATTR_NAME)); groupAttrMap.put(((Element) complexTypeNode.getChildNodes().item(i2)).getAttribute(ConfigKeys.ATTR_NAME), complexTypeNode.getChildNodes().item(i2)); docAttrMap.put(((Element) complexTypeNode.getChildNodes().item(i2)).getAttribute(ConfigKeys.ATTR_NAME), complexTypeNode.getChildNodes().item(i2)); } } } } // now, get the parent's attributes parentGroupAttrMap = groupAttrs.get(parentGroup); if (parentGroupAttrMap != null) { Iterator<String> iter = parentGroupAttrMap.keySet().iterator(); while (iter.hasNext()) { String attrName = iter.next(); groupAttrMap.put(attrName, parentGroupAttrMap.get(attrName)); } } // add the attributes to the group element that will be added to the elements list Iterator<String> itr = groupAttrMap.keySet().iterator(); while(itr.hasNext()) { groupElement.addAttribute(itr.next()); } // put the attributes in the attributes map groupAttrs.put(element, groupAttrMap); } for (int i = 0; i < element.getChildNodes().getLength(); i++) { Node childLevel1 = (Node) element.getChildNodes().item(i); if (childLevel1.getNodeName().equals(ConfigKeys.TAG_COMPLEX_TYPE)) { for (int j = 0; j < childLevel1.getChildNodes().getLength(); j++) { Node childLevel2 = (Node) childLevel1.getChildNodes().item(j); if (childLevel2.getNodeName().equals(ConfigKeys.TAG_SEQUENCE)) { for (int k = 0; k < childLevel2.getChildNodes().getLength(); k++) { Node childLevel3 = (Node) childLevel2.getChildNodes().item(k); if (childLevel3.getNodeName().equals(ConfigKeys.TAG_ELEMENT)) { // check if single element or group if (isGroup(childLevel3)) { // another group element.. // unfortunately, a recursion is // needed here!!! :-( processGroup(childLevel3, false, element, groupElement, docAttrMap, xsdDoc, newElementsList); } else { // reached a single-value element.. copy it under the // main sequence and apply the name<>shorname replacement processGroupElement(childLevel3, element, groupElement, isFirstLevelGroup, xsdDoc, newElementsList); } } } } } } } if (isFirstLevelGroup) { addToElementsList(groupElement); } else { parentGroupElement.addChild(groupElement); } appLogger.debug("finished processing group [" + elementName + "]."); } /** * process the sent <code>element</code> to extract/modify required * information: * 1. replace the <code>name</code> attribute with the <code>shortname</code>. * * @param element */ private void processElement(Node element) { String fieldShortName = null; String fieldColumnName = null; String fieldDataType = null; String fieldFormat = null; String fieldInputLength = null; String elementName = null; HashMap<String, String> elementProperties = new HashMap<String, String>(); if (element.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME) != null) { elementName = element.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME).getNodeValue(); } appLogger.debug("processing element [" + elementName + "]..."); for (int i = 0; i < element.getChildNodes().getLength(); i++) { Node childLevel1 = (Node) element.getChildNodes().item(i); if (childLevel1.getNodeName().equals(ConfigKeys.TAG_ANNOTATION)) { for (int j = 0; j < childLevel1.getChildNodes().getLength(); j++) { Node childLevel2 = (Node) childLevel1.getChildNodes().item(j); if (childLevel2.getNodeName().equals(ConfigKeys.TAG_APP_INFO)) { for (int k = 0; k < childLevel2.getChildNodes().getLength(); k++) { Node childLevel3 = (Node) childLevel2.getChildNodes().item(k); if (childLevel3.getNodeName().equals(ConfigKeys.TAG_HAS_PROPERTY)) { if (childLevel3.getAttributes() != null) { String attrName = null; Node attribute = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME); if (attribute != null) { attrName = attribute.getNodeValue(); elementProperties.put(attrName, childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue()); if (attrName.equals(ConfigKeys.FIELD_SHORT_NAME)) { fieldShortName = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(ConfigKeys.FIELD_COLUMN_NAME)) { fieldColumnName = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(ConfigKeys.FIELD_DATA_TYPE)) { fieldDataType = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(ConfigKeys.FIELD_FMT)) { fieldFormat = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(ConfigKeys.FIELD_INPUT_LEN)) { fieldInputLength = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } } } } } } } } } // replace the name attribute with the shortname if (element.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME) != null) { element.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME).setNodeValue(fieldShortName); } elementProperties.put(ConfigKeys.FIELD_SINGLE_OR_MULTI, "S"); constructElementRow(elementProperties); singleValueTableColumns.add(fieldShortName + ConfigKeys.DELIMITER_COLUMN_TYPE + fieldDataType + fieldFormat + ConfigKeys.DELIMITER_COLUMN_TYPE + fieldInputLength); // add the element to elements list addToElementsList(fieldShortName, fieldColumnName); appLogger.debug("finished processing element [" + elementName + "]."); } /** * process the sent <code>element</code> to extract/modify required * information: * 1. copy the element under the main sequence * 2. replace the <code>name</code> attribute with the <code>shortname</code>. * 3. add the attributes of the parent groups (if non-first-level-group) * * @param element */ private void processGroupElement(Node element, Node parentGroup, XSDElement parentGroupElement, boolean isFirstLevelGroup, Document xsdDoc, ArrayList<Object> newElementsList) { String fieldShortName = null; String fieldColumnName = null; String fieldDataType = null; String fieldFormat = null; String fieldInputLength = null; String elementName = null; Element newElement = null; HashMap<String, String> elementProperties = new HashMap<String, String>(); ArrayList<String> tableColumns = new ArrayList<String>(); HashMap<String, Object> groupAttrMap = null; if (element.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME) != null) { elementName = element.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME).getNodeValue(); } appLogger.debug("processing element [" + elementName + "]..."); // 1. copy the element newElement = (Element) element.cloneNode(true); newElement.setAttribute(ConfigKeys.ATTR_MAX_OCCURS, "unbounded"); // 2. if non-first-level-group, replace the element's SimpleType tag with a ComplexType tag if (!isFirstLevelGroup) { if (((Element) newElement).getElementsByTagName(ConfigKeys.TAG_SIMPLE_TYPE).getLength() != 0) { // there should be only one tag of SimpleType Node simpleTypeNode = ((Element) newElement).getElementsByTagName(ConfigKeys.TAG_SIMPLE_TYPE).item(0); // create the new ComplexType element Element complexTypeNode = xsdDoc.createElement(ConfigKeys.TAG_COMPLEX_TYPE); complexTypeNode.setAttribute(ConfigKeys.ATTR_MIXED, "true"); // get the list of attributes for the parent group groupAttrMap = groupAttrs.get(parentGroup); Iterator<String> attrIter = groupAttrMap.keySet().iterator(); while(attrIter.hasNext()) { Element attr = (Element) groupAttrMap.get(attrIter.next()); Element newAttrElement = xsdDoc.createElement(ConfigKeys.TAG_ATTRIBUTE); appLogger.debug("adding attr. [" + attr.getAttribute(ConfigKeys.ATTR_NAME) + "]..."); newAttrElement.setAttribute(ConfigKeys.ATTR_REF, attr.getAttribute(ConfigKeys.ATTR_NAME)); newAttrElement.setAttribute(ConfigKeys.ATTR_USE, "optional"); complexTypeNode.appendChild(newAttrElement); } // replace the old SimpleType node with the new ComplexType node newElement.replaceChild(complexTypeNode, simpleTypeNode); } } // 3. replace the name with the shortname in the new element for (int i = 0; i < newElement.getChildNodes().getLength(); i++) { Node childLevel1 = (Node) newElement.getChildNodes().item(i); if (childLevel1.getNodeName().equals(ConfigKeys.TAG_ANNOTATION)) { for (int j = 0; j < childLevel1.getChildNodes().getLength(); j++) { Node childLevel2 = (Node) childLevel1.getChildNodes().item(j); if (childLevel2.getNodeName().equals(ConfigKeys.TAG_APP_INFO)) { for (int k = 0; k < childLevel2.getChildNodes().getLength(); k++) { Node childLevel3 = (Node) childLevel2.getChildNodes().item(k); if (childLevel3.getNodeName().equals(ConfigKeys.TAG_HAS_PROPERTY)) { if (childLevel3.getAttributes() != null) { String attrName = null; Node attribute = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME); if (attribute != null) { attrName = attribute.getNodeValue(); elementProperties.put(attrName, childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue()); if (attrName.equals(ConfigKeys.FIELD_SHORT_NAME)) { fieldShortName = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(ConfigKeys.FIELD_COLUMN_NAME)) { fieldColumnName = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(ConfigKeys.FIELD_DATA_TYPE)) { fieldDataType = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(ConfigKeys.FIELD_FMT)) { fieldFormat = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(ConfigKeys.FIELD_INPUT_LEN)) { fieldInputLength = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } } } } } } } } } if (newElement.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME) != null) { newElement.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME).setNodeValue(fieldShortName); } // 4. save the new element to be added to the sequence list newElementsList.add(newElement); elementProperties.put(ConfigKeys.FIELD_SINGLE_OR_MULTI, "M"); constructElementRow(elementProperties); // create the MULTI-VALUE table // 0. Primary Key tableColumns.add(ConfigKeys.COLUMN_XPK_ROW + ConfigKeys.DELIMITER_COLUMN_TYPE + ConfigKeys.DATA_TYPE_XSD_STRING + ConfigKeys.DELIMITER_COLUMN_TYPE + ConfigKeys.COLUMN_XPK_ROW_LENGTH); // 1. foreign key tableColumns.add(ConfigKeys.COLUMN_FK_ROW + ConfigKeys.DELIMITER_COLUMN_TYPE + ConfigKeys.DATA_TYPE_XSD_NUMERIC); // 2. field value tableColumns.add(fieldShortName + ConfigKeys.DELIMITER_COLUMN_TYPE + fieldDataType + fieldFormat + ConfigKeys.DELIMITER_COLUMN_TYPE + fieldInputLength); // 3. attributes if (groupAttrMap != null) { Iterator<String> attrIter = groupAttrMap.keySet().iterator(); while (attrIter.hasNext()) { Element attr = (Element) groupAttrMap.get(attrIter.next()); tableColumns.add(attr.getAttribute(ConfigKeys.ATTR_NAME) + ConfigKeys.DELIMITER_COLUMN_TYPE + ConfigKeys.DATA_TYPE_XSD_NUMERIC); } } multiValueTablesSQL.put(sub_table_prefix.getText() + fieldShortName, constructMultiValueTableSQL( sub_table_prefix.getText() + fieldShortName, tableColumns)); // add the element to it's parent group children parentGroupElement.addChild(new XSDElement(fieldShortName, fieldColumnName)); appLogger.debug("finished processing element [" + elementName + "]."); } /** * write resulted files * * @param xsdDoc * @param docPath */ private void writeResults(Document xsdDoc, String resultsDir, String newXSDFileName, String csvFileName) { String rsDir = resultsDir + File.separator + new SimpleDateFormat("yyyyMMdd-HHmm").format(new Date()); try { File resultsDirFile = new File(rsDir); if (!resultsDirFile.exists()) { resultsDirFile.mkdirs(); } // write the XSD doc appLogger.info("writing the transformed XSD..."); Source source = new DOMSource(xsdDoc); Result result = new StreamResult(rsDir + File.separator + newXSDFileName); Transformer xformer = TransformerFactory.newInstance().newTransformer(); // xformer.setOutputProperty("indent", "yes"); xformer.transform(source, result); appLogger.info("finished writing the transformed XSD."); // write the CSV columns file appLogger.info("writing the CSV file..."); FileWriter csvWriter = new FileWriter(rsDir + File.separator + csvFileName); csvWriter.write(columnsCSV.toString()); csvWriter.close(); appLogger.info("finished writing the CSV file."); // write the master single-value table appLogger.info("writing the creation script for master table (single-values)..."); FileWriter masterTableWriter = new FileWriter(rsDir + File.separator + main_edh_table_name.getText() + ".sql"); masterTableWriter.write(constructSingleValueTableSQL(main_edh_table_name.getText(), singleValueTableColumns)); masterTableWriter.close(); appLogger.info("finished writing the creation script for master table (single-values)."); // write the multi-value tables sql appLogger.info("writing the creation script for slave tables (multi-values)..."); Iterator<String> iter = multiValueTablesSQL.keySet().iterator(); while (iter.hasNext()) { String tableName = iter.next(); String sql = multiValueTablesSQL.get(tableName); FileWriter tableSQLWriter = new FileWriter(rsDir + File.separator + tableName + ".sql"); tableSQLWriter.write(sql); tableSQLWriter.close(); } appLogger.info("finished writing the creation script for slave tables (multi-values)."); // write the single-value view appLogger.info("writing the creation script for single-value selection view..."); FileWriter singleValueViewWriter = new FileWriter(rsDir + File.separator + view_name_single.getText() + ".sql"); singleValueViewWriter.write(constructViewSQL(ConfigKeys.SQL_VIEW_SINGLE)); singleValueViewWriter.close(); appLogger.info("finished writing the creation script for single-value selection view."); // debug for (int i = 0; i < xsdElementsList.size(); i++) { getMultiView(xsdElementsList.get(i)); /*// if (xsdElementsList.get(i).getAllDescendants() != null) { // for (int j = 0; j < xsdElementsList.get(i).getAllDescendants().size(); j++) { // appLogger.debug(main_edh_table_name.getText() + "." + ConfigKeys.COLUMN_XPK_ROW // + "=" + xsdElementsList.get(i).getAllDescendants().get(j).getName() + "." + ConfigKeys.COLUMN_FK_ROW); // } // } */ } } catch (Exception e) { appLogger.error(e.getMessage()); } } private String getMultiView(XSDElement element)

    Read the article

  • No properties file found Error for ReloadableResourceBundleMessageSource

    - by samspot
    I'm trying to use a reloadable spring resource bundle but spring cannot find the file. I've tried tons of different paths, but can't get it to work anywhere. In the code below you'll see that i load both the spring bundle and the regular one from the same path variable but only one works. I've been banging my head against this for far too long. Anybody have any ideas? logfile INFO 2010-04-28 11:38:31,805 [main] org.myorg.test.TestMessages: C:\www\htdocs\messages.properties INFO 2010-04-28 11:38:31,805 [main] org.myorg.data.Messages: initializing Spring Message Source to C:\www\htdocs\messages.properties INFO 2010-04-28 11:38:31,821 [main] org.myorg.data.Messages: Attempting to load properties from C:\www\htdocs\messages.properties DEBUG 2010-04-28 11:38:31,836 [main] org.springframework.context.support.ReloadableResourceBundleMessageSource: No properties file found for [C:\www\htdocs\messages.properties_en_US] - neither plain properties nor XML DEBUG 2010-04-28 11:38:31,842 [main] org.springframework.context.support.ReloadableResourceBundleMessageSource: No properties file found for [C:\www\htdocs\messages.properties_en] - neither plain properties nor XML DEBUG 2010-04-28 11:38:31,848 [main] org.springframework.context.support.ReloadableResourceBundleMessageSource: No properties file found for [C:\www\htdocs\messages.properties] - neither plain properties nor XML INFO 2010-04-28 11:38:31,848 [main] org.myorg.test.TestMessages: I am C:\www\htdocs\messages.properties Messages.java package org.myorg.data; import java.io.File; import java.io.FileInputStream; import java.io.IOException; import java.util.PropertyResourceBundle; import java.util.ResourceBundle; import org.apache.commons.logging.Log; import org.apache.commons.logging.LogFactory; import org.springframework.context.support.ReloadableResourceBundleMessageSource; public class Messages { protected static final Log logger = LogFactory.getLog(Messages.class); private static ReloadableResourceBundleMessageSource msgSource = null; private static ResourceBundle RESOURCE_BUNDLE; public static final String PATH = "C:" + File.separator + "www" + File.separator + "htdocs" + File.separator + "messages.properties"; private Messages() { } public static String getString(String key) { initBundle(); return msgSource.getMessage(key, null, RESOURCE_BUNDLE.getString(key), null); } private static void initBundle(){ if(null == msgSource || null == RESOURCE_BUNDLE){ logger.info("initializing Spring Message Source to " + PATH); msgSource = new ReloadableResourceBundleMessageSource(); msgSource.setBasename(PATH); msgSource.setCacheSeconds(1); /* works, but you have to hardcode the platform dependent path starter. It also does not cache */ FileInputStream fis = null; try { logger.info("Attempting to load properties from " + PATH); fis = new FileInputStream(PATH); RESOURCE_BUNDLE = new PropertyResourceBundle(fis); } catch (Exception e) { logger.info("couldn't find " + PATH); } finally { try { if(null != fis) fis.close(); } catch (IOException e) { } } } } } TestMessages.java package org.myorg.test; import org.myorg.data.Messages; public class TestMessages extends AbstractTest { public void testMessage(){ logger.info(Messages.PATH); logger.info(Messages.getString("OpenKey.TEST")); } }

    Read the article

  • Reconstructing Position in the Original Array from the Position in a Stripped Down Array

    - by aronchick
    I have a text file that contains a number of the following: <ID> <Time 1> --> <Time 2> <Quote (potentially multiple line> <New Line Separator> <ID> <Time 1> --> <Time 2> <Quote (potentially multiple line> <New Line Separator> <ID> <Time 1> --> <Time 2> <Quote (potentially multiple line> <New Line Separator> I have a very simple regex for stripping these out into a constant block so it's just: <Quote> <Quote> <Quote> What I'd like to do is present the quotes as a block to the user, and have them select it (using jQuery.fieldSelection) and then use the selected content to back out to the original array, so I can get timing and IDs. Because this has to go out to HTML, and the user has to be able to select the text on the screen, I can't do anything like hidden divs or hidden input fields. The only data I will have is the character range selected on screen. To be specific, this is what it looks like: 1 0:00 --> 0:05 He was bored. So bored. His great intellect, seemingly inexhaustible, was hungry for new challenges but he was the last of the great innovators 2 0:05 --> 0:10 - society's problems had all been solved. 3 0:11 --> 0:20 All seemingly unconnected disciplines had long since been found to be related in horrifically elusive and contrived ways and he had mastered them all. And this is what I'd like to present to the user for selection: He was bored. So bored. His great intellect, seemingly inexhaustible, was hungry for new challenges but he was the last of the great innovators - society's problems had all been solved. All seemingly unconnected disciplines had long since been found to be related in horrifically elusive and contrived ways and he had mastered them all. Has anyone com across something like this before? Any ideas how to take the selected text, or selection position, and go backwards to the original meta-data?

    Read the article

  • How to avoid code repetition initializing final properties?

    - by Hernán Eche
    public class Code{ //many properties //... final String NEWLINE;// ohh a final property! void creation() //this method is for avoid repetition of code { //final initialization can't be put here =( Source= new StringBuffer(); //many other commons new's .. //... } Code() { NEWLINE = System.getProperty("line.separator"); creation(); } Code(String name, int numberr) { NEWLINE = System.getProperty("line.separator"); creation(); name=new Someting(name); number = new Magic(number); } }

    Read the article

  • UpdateModel prefix - ASP.NET MVC

    - by Kristoffer Ahl
    I'm having trouble with TryUpdateModel(). My form fields are named with a prefix but I am using - as my separator and not the default dot. <input type="text" id="Record-Title" name="Record-Title" /> When I try to update the model it does not get updated. If i change the name attribute to Record.Title it works perfectly but that is not what I want to do. bool success = TryUpdateModel(record, "Record"); Is it possible to use a custom separator?

    Read the article

  • scanf("%d", char*) - char-as-int format string?

    - by SF.
    What is the format string modifier for char-as-number? I want to read in a number never exceeding 255 (actually much less) into an unsigned char type variable using sscanf. Using the typical char source[] = "x32"; char separator; unsigned char dest; int len; len = sscanf(source,"%c%d",&separator,&dest); // validate and proceed... I'm getting the expected warning: argument 4 of sscanf is type char*, int* expected. As I understand the specs, there is no modifier for char (like %sd for short, or %lld for 64-bit long) is it dangerous? (will overflow just overflow (roll-over) the variable or will it write outside the allocated space?) is there a prettier way to achieve that than allocating a temporary int variable? ...or would you suggest an entirely different approach altogether?

    Read the article

  • Vertical Scroll not working, are the guides but the screen does not scroll.

    - by Leandro
    package com.lcardenas.infoberry; import net.rim.device.api.system.DeviceInfo; import net.rim.device.api.system.GPRSInfo; import net.rim.device.api.system.Memory; import net.rim.device.api.ui.MenuItem; import net.rim.device.api.ui.component.Dialog; import net.rim.device.api.ui.component.LabelField; import net.rim.device.api.ui.component.Menu; import net.rim.device.api.ui.component.SeparatorField; import net.rim.device.api.ui.container.MainScreen; import net.rim.device.api.ui.container.VerticalFieldManager; import net.rim.device.api.ui.decor.Background; import net.rim.device.api.ui.decor.BackgroundFactory; public class vtnprincipal extends MainScreen { //llamamos a la clase principal private InfoBerry padre; //variables para el menu private MenuItem mnubateria; private MenuItem mnuestado; private MenuItem mnuacerca; public vtnprincipal(InfoBerry padre) { super(); this.padre = padre; } public void incventana(){ VerticalFieldManager _ventana = new VerticalFieldManager(VerticalFieldManager.VERTICAL_SCROLL | VerticalFieldManager.VERTICAL_SCROLLBAR); double tmemoria =((DeviceInfo.getTotalFlashSize()/1024)/1024.00); double fmemoria = ((Memory.getFlashFree()/1024)/1024.00); Background cyan = BackgroundFactory.createSolidBackground(0x00E0FFFF); Background gris = BackgroundFactory.createSolidBackground(0x00DCDCDC ); //Borramos todos de la pantalla this.deleteAll(); //llamamos al menu incMenu(); //DIBUJAMOS LA VENTANA try{ LabelField title = new LabelField("Info Berry", LabelField.FIELD_HCENTER | LabelField.USE_ALL_HEIGHT ); setTitle(title); _ventana.add(new LabelField("Información del Dispositivo", LabelField.FIELD_HCENTER |LabelField.RIGHT | LabelField.USE_ALL_HEIGHT | LabelField.NON_FOCUSABLE )); _ventana.add(new SeparatorField()); _ventana.add(new SeparatorField()); txthorizontal modelo = new txthorizontal("Modelo:", DeviceInfo.getDeviceName()); modelo.setBackground(gris); _ventana.add(modelo); txthorizontal pin = new txthorizontal("PIN:" , Integer.toHexString(DeviceInfo.getDeviceId()).toUpperCase()); pin.setBackground(cyan); _ventana.add(pin); txthorizontal imeid = new txthorizontal("IMEID:" , GPRSInfo.imeiToString(GPRSInfo.getIMEI())); imeid.setBackground(gris); _ventana.add(imeid); txthorizontal version= new txthorizontal("SO Versión:" , DeviceInfo.getSoftwareVersion()); version.setBackground(cyan); _ventana.add(version); txthorizontal plataforma= new txthorizontal("SO Plataforma:" , DeviceInfo.getPlatformVersion()); plataforma.setBackground(gris); _ventana.add(plataforma); txthorizontal numero= new txthorizontal("Numero Telefonico: " , "Hay que firmar"); numero.setBackground(cyan); _ventana.add(numero); _ventana.add(new SeparatorField()); _ventana.add(new SeparatorField()); _ventana.add(new LabelField("Memoria", LabelField.FIELD_HCENTER | LabelField.USE_ALL_HEIGHT | LabelField.NON_FOCUSABLE)); _ventana.add(new SeparatorField()); txthorizontal totalm= new txthorizontal("Memoria app Total:" , mmemoria(tmemoria) + " Mb"); totalm.setBackground(gris); _ventana.add(totalm); txthorizontal disponiblem= new txthorizontal("Memoria app Disponible:" , mmemoria(fmemoria) + " Mb"); disponiblem.setBackground(cyan); _ventana.add(disponiblem); ///txthorizontal estadoram = new txthorizontal("Memoria RAM:" , mmemoria(prueba) + " Mb"); //estadoram.setBackground(gris); //add(estadoram); _ventana.add(new SeparatorField()); _ventana.add(new SeparatorField()); this.add(_ventana); }catch(Exception e){ Dialog.alert("Excepción en clase vtnprincipal: " + e.toString()); } } //DIBUJAMOS EL MENU private void incMenu() { MenuItem.separator(30); mnubateria = new MenuItem("Bateria",40, 10) { public void run() { bateria(); } }; mnuestado = new MenuItem("Estado de Red", 50, 10) { public void run() { estado(); } }; mnuacerca = new MenuItem("Acerca de..", 60, 10) { public void run() { acerca(); } }; MenuItem.separator(70); }; // public void makeMenu(Menu menu, int instance) { if (!menu.isDisplayed()) { menu.deleteAll(); menu.add(MenuItem.separator(30)); menu.add(mnubateria); menu.add(mnuestado); menu.add(mnuacerca); menu.add(MenuItem.separator(60)); } } public void bateria(){ padre.vtnbateria.incventana(); padre.pushScreen(padre.vtnbateria); } public void estado(){ padre.vtnestado.incventana(); padre.pushScreen(padre.vtnestado); } public void acerca(){ padre.vtnacerca.incventana(); padre.pushScreen(padre.vtnacerca); } public boolean onClose(){ Dialog.alert("Hasta Luego"); System.exit(0); return true; } public double mmemoria(double x) { if ( x > 0 ) return Math.floor(x * 100) / 100; else return Math.ceil(x * 100) / 100; } }

    Read the article

  • How to have localized style when writing cell with xlwt

    - by lfagundes
    I'm writing an Excel spreadsheet with Python's xlwt and I need numbers to be formatted using "." as thousands separator, as it is in brazilian portuguese language. I have tried: style.num_format_str = r'#,##0' And it sets the thousands separator as ','. If I try setting num_format_str to '#.##0', I'll get number formatted as 1234.000 instead of 1.234. And if I open document in OpenOffice and format cells, I can set the language of the cell to "Portuguese (Brazil)" and then OpenOffice will show the format code as being "#.##0", but I don't find a way to set the cell's language to brazilian portuguese. Any ideas?

    Read the article

  • bash: how to know NUM option in grep -A -B "on the fly" ?

    - by Michael Mao
    Hello everyone: I am trying to analyze my agent results from a collection of 20 txt files here. If you wonder about the background info, please go see my page, what I am doing here is just one step. Basically I would like to take only my agent's result out of the messy context, so I've got this command for a single file: cat run15.txt | grep -A 50 -E '^Agent Name: agent10479475' | grep -B 50 '^==' This means : after the regex match, continue forward by 50 lines, stop, then match a line separator starts with "==", go back by 50 lines, if possible (This would certainly clash the very first line). This approach depends on the fact that the hard-coded line number counter 50, would be just fine to get exactly one line separator. And this would not work if I do the following code: cat run*.txt | grep -A 50 -E '^Agent Name: agent10479475' | grep -B 50 '^==' The output would be a mess... My question is: how to make sure grep knows exactly when to stop going forward, and when to stop getting backward? Any suggestion or hint is much appreciated.

    Read the article

  • jQuery tag editor function

    - by Mad Hatter
    I'm using jQuery Tag Editor (http://blog.crazybeavers.se/wp-content/demos/jquery.tag.editor/) for a school project. Everything works perfect, but i'm not able to retrieve the array of tags that I added. This is my code: $("#allTags").click(function () { var tags = $("#tagEditor").tagEditor().getTags(); alert(tags); }); The array doesn't return anything. This is the code from the jQuery Tag Editor: (function ($) { $.fn.extend({ tagEditor: function (options) { var defaults = { separator: ',', items: [], className: 'tagEditor', confirmRemoval: false, confirmRemovalText: 'Do you really want to remove the tag?', completeOnSeparator: false, completeOnBlur: false, initialParse: true, } var options = $.extend(defaults, options); var listBase, textBase = this, hiddenText; var itemBase = []; this.getTags = function () { return itemBase.join(options.separator); }; ...

    Read the article

  • Suggestion to reverse string in c#

    - by HasanGursoy
    Is this the right method to reverse a string? I'm planning to use it to reverse a string like: Products » X1 » X3 to X3 « X1 « Products I want it to be a global function which can be used elsewhere. public static string ReverseString(string input, string separator, string outSeparator) { string result = String.Empty; string[] temp = Regex.Split(input, separator, RegexOptions.IgnoreCase); Array.Reverse(temp); for (int i = 0; i < temp.Length; i++) { result += temp[i] + " " + outSeparator + " "; } return result; }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • When is ¦ not equal to ¦?

    - by Trey Jackson
    Background. I'm working with netlists, and in general, people specify different hierarchies by using /. However, it's not illegal to actually use a / as a part of an instance name. For example, X1/X2/X3/X4 might refer to instance X4 inside another instance named X1/X2/X3. Or it might refer an instance named X3/X4 inside an instance named X2 inside an instance named X1. Got it? There's really no "regular" character that cannot be used as a part of an instance name, so you resort to a non-printable one, or ... perhaps one outside of the standard 0..127 ASCII chars. I thought I'd try (decimal) 166, because for me it shows up as the pipe: ¦. So... I've got some C++ code which constructs the path name using ¦ as the hierarchical separator, so the path above looks like X1¦X2/X3¦X4. Now the GUI is written in Tcl/Tk, and to properly translate this into human readable terms I need to do something like the following: set path [getPathFromC++] ;# returns X1¦X2/X3¦X4 set humanreadable [join [split $path ¦] /] Basically, replace the ¦ with / (I could also accomplish this with [string map]). Now, the problem is, the ¦ in the string I get from C++ doesn't match the ¦ I can create in Tcl. i.e. This fails: set path [getPathFromC++] ;# returns X1¦X2/X3¦X4 string match $path [format X1%cX2/X3%cX4 166 166] Visually, the two strings look identical, but string match fails. I even tried using scan to see if I'd mixed up the bit values. But set path [getPathFromC++] ;# returns X1¦X2/X3¦X4 set path2 [format X1%cX2/X3%cX4 166 166] for {set i 0} {$i < [string length $path]} {incr i} { set p [string range $path $i $i] set p2 [string range $path2 $i $i] scan %c $p c scan %c $p2 c2 puts [list $p $c :::: $p2 $c2 equal? [string equal $c $c2]] } Produces output which looks like everything should match, except the [string equal] fails for the ¦ characters with a print line: ¦ 166 :::: ¦ 166 equal? 0 For what it's worth, the character in C++ is defined as: const char SEPARATOR = 166; Any ideas why a character outside the regular ASCII range would fail like this? When I changed the separator to (decimal) 28 (^\), things worked fine. I just don't want to get bit by a similar problem on a different platform. (I'm currently using Redhat Linux).

    Read the article

  • bash: hwo to know NUM option in grep -A -B "on the fly" ?

    - by Michael Mao
    Hello everyone: I am trying to analyze my agent results from a collection of 20 txt files here. If you wonder about the background info, please go see my page, what I am doing here is just one step. Basically I would like to take only my agent's result out of the messy context, so I've got this command for a single file: cat run15.txt | grep -A 50 -E '^Agent Name: agent10479475' | grep -B 50 '^==' This means : after the regex match, continue forward by 50 lines, stop, then match a line separator starts with "==", go back by 50 lines, if possible (This would certainly clash the very first line). This approach depends on the fact that the hard-coded line number counter 50, would be just fine to get exactly one line separator. And this would not work if I do the following code: cat run*.txt | grep -A 50 -E '^Agent Name: agent10479475' | grep -B 50 '^==' The output would be a mess... My question is: how to make sure grep knows exactly when to stop going forward, and when to stop getting backward? Any suggestion or hint is much appreciated.

    Read the article

  • Add folder, which contains java sources, to classpath at runtime

    - by markovuksanovic
    Is it possible to add a folder which contains java source code as a classpath element. I have tried a few things and it seems that the classloadr is not picking up java soruce files? One of my attempts is shown below.... File uncompressedSrc = new File("uncompressed" + File.separator + "src" + File.separator); URL uncompressedSrcURL = null; try { uncompressedSrcURL = new URL("file://" + uncompressedSrc.getAbsolutePath()); } catch (MalformedURLException e) { e.printStackTrace(); } URL elements[] = { uncompressedSrcURL }; new URLClassLoader(elements, ClassLoader.getSystemClassLoader());

    Read the article

  • How does Mach-O loader recognize a bunch of NSString objects?

    - by overboming
    I have known that If you define a bunch of @"" NSString objects in the source code in Mac OS. These NSStrings will be stored in a segment in the Mach-O library. Section sectname __ustring segname __TEXT addr 0x000b3b54 size 0x000001b7 offset 731988 align 2^1 (2) reloff 0 nreloc 0 flags 0x00000000 reserved1 0 reserved2 0 If I hex dump the binary, they are aligned closely one by one with a 0x0000as separator. What I want to know is how does the loader in Mac OS X load these NSStrings when the program runs? Are they loaded simpily by recognize the 0x0000 separator or these is a string offset table elsewhere in the binary pointing to separate NSString objects? Thanks. (What I really want to do is the increase the length of one of the NSString, so I have to know how the loader recognize these separate objects)

    Read the article

  • How does Mach-O loader loads different NSString objects?

    - by overboming
    I have known that If you define a bunch of @"" NSString objects in the source code in Mac OS. These NSStrings will be stored in a segment in the Mach-O library. Section sectname __ustring segname __TEXT addr 0x000b3b54 size 0x000001b7 offset 731988 align 2^1 (2) reloff 0 nreloc 0 flags 0x00000000 reserved1 0 reserved2 0 If I hex dump the binary, they are aligned closely one by one with a 0x0000as separator. What I want to know is how does the loader in Mac OS X load these NSStrings when the program runs? Are they loaded simpily by recognize the 0x0000 separator or these is a string offset table elsewhere in the binary pointing to separate NSString objects? Thanks. (What I really want to do is the increase the length of one of the NSString, so I have to know how the loader recognize these separate objects)

    Read the article

  • Why is Flexigird not working on IE

    - by Jrubins
    Hi I have a page with a flexigrid on it and it works on FF,Chrome,Opera except IE. it points out that the error is at line of "if(!btn.separator)" which is null or not an object. Well, every thing inside that block is an error on IE cause i think the error is on the "btn" objects.. has anyone ever encountered this error? this is from the latest version of flexigrid for(i=0;i< p.buttons.length;i++){ var btnfor = p.buttons[i]; if(!btn.separator) { //do things here } } Thanks Jrubins

    Read the article

  • Comparing an id to id of different tables rows mysql

    - by jett
    So I am trying to retrieve all interests from someone, and be able to list them. This works with the following query. SELECT *,( SELECT GROUP_CONCAT(interest_id SEPARATOR ",") FROM people_interests WHERE person_id = people.id ) AS interests FROM people WHERE id IN ( SELECT person_id FROM people_interests WHERE interest_id = '.$site->db->clean($_POST['showinterest_id']).' ) ORDER BY lastname, firstname In this one which I am having trouble with, I want to select only those who happen to have their id in the table named volleyballplayers. The table just has an id, person_id, team_id, and date fields. SELECT *,( SELECT GROUP_CONCAT(interest_id SEPARATOR ",") FROM people_interests WHERE person_id = people.id ) AS interests FROM people WHERE id IN ( SELECT person_id FROM people_interests WHERE volleyballplayers.person_id = person_id ) ORDER BY lastname, firstname I just want to make sure that only the people who are in the volleyballplayers table show up, but I am getting an error saying that Unknown column 'volleyballplayers.person_id' in 'where clause' although I am quite sure of the name of table and I know the column is named person_id.

    Read the article

  • process incoming mail and parse out original text

    - by florin
    I have inherited a rails forum (Rails 2.3.2 I think) that alerts people of new posts/replies for the forums or threads they are watching. To make it easier for people to answer to threads I would like to enable reply-to-post, similar to basecamp and a bunch of other forums and tools out there. I would add a separator text (like "----add your reply above this line-----") in the original email. I need to: - process incoming email - extract the new text (above the separator line) - ideally strip out text like "on ... [email protected] wrote:" that is automatically added by some mail clients - identify the thread this email is referring to (either using the incoming address or the subject line) - identify the sender - post the content as new reply Any suggestions on how to get started? Any good plugins for this? I've seen many mentioning Mailman and Fetcher, are there any other and which one is the best for this little feature? Thanks!

    Read the article

< Previous Page | 1 2 3 4 5 6 7 8 9 10 11 12  | Next Page >