Search Results

Search found 16445 results on 658 pages for 'array initialization'.

Page 501/658 | < Previous Page | 497 498 499 500 501 502 503 504 505 506 507 508  | Next Page >

  • How to handle subclasses in JasperReports?

    - by gotch4
    I've two classes (A and B) that extend a base class BASE. I need to make a report that takes an array of such classes and the prints the fields of A or B. I tought of using conditional expressions, then casting to one or another (depending on a field value). But I can't cast, because I don't know how to refere to the current bean. To do this I am using a JRBeanCollectionDataSource filled with a List<BASE>. How do I cast every bean to A or B in a report (or subreport)? I tried: ((A)this) but it says basically that this contains the report instance, not the current bean and gives error.

    Read the article

  • In Drupal, how to change the values passed to Pathauto?

    - by Vinicius Pinto
    I have Pathauto configured to generate an alias based on the title of a node, for a specific content type. The problem is that I want to make small changes in this title before Pathauto uses it to generate the alias. The first comment in this post suggests the use of hook_token_values, but I couldn't really understand how to use it, even after reading the docs. In my tests, when I implement this hook, the alias generated is always "array", which means I'm missing something. Any help? Thanks.

    Read the article

  • Rails3. How do I display two different objects in a search?

    - by JZ
    I am using a simple search that displays search results: @adds = Add.search(params[:search]) In addition to the search results I'm trying to utilize a method, nearbys(), which displays objects that are close in proximity to the search result. The following method displays objects which are close to 2, but it does not display object 2. How do I display object 2 in conjunction with the nearby objects? @adds = Add.find(2).nearbys(10) While the above code functions, when I use search, @adds = Add.search(params[:search]).nearbys(10) a no method error is returned, undefined methodnearbys' for Array:0x30c3278` How can I search the model for an object AND use the nearbys() method AND display all results returned?

    Read the article

  • Difference between two commands of fetching Shopping Cart Items in Magento

    - by Knowledge Craving
    In Magento, if you need to get / fetch the Shopping Cart's Item details, you can do it in any of the two possible ways, which will provide you with all the shopped Items in an array:- $cartItems1 = $cart->getQuote()->getAllItems(); $cartItems2 = $cart->getItems()->getData(); But before using any one of the above two methods, you need to initialize the shopping cart object as:- $cart = new Mage_Checkout_Model_Cart(); $cart->init(); Can anyone please describe in details as to what the two options provide & their differences between each other, along with their possible usage. In any more such option is available in Magento, can anyone please highlight it?

    Read the article

  • Efficient data structure for fast random access, search, insertion and deletion

    - by Leonel
    I'm looking for a data structure (or structures) that would allow me keep me an ordered list of integers, no duplicates, with indexes and values in the same range. I need four main operations to be efficient, in rough order of importance: taking the value from a given index finding the index of a given value inserting a value at a given index deleting a value at a given index Using an array I have 1 at O(1), but 2 is O(N) and insertion and deletions are expensive (O(N) as well, I believe). A Linked List has O(1) insertion and deletion (once you have the node), but 1 and 2 are O(N) thus negating the gains. I tried keeping two arrays a[index]=value and b[value]=index, which turn 1 and 2 into O(1) but turn 3 and 4 into even more costly operations. Is there a data structure better suited for this?

    Read the article

  • Prototype to JQuery - how to access originator of event

    - by ciaranarcher
    Hi there I'm coming from a Prototype background and looking into JQuery. I'd like to know the 'right' way to do attach a click event to a bunch of elements, but then know in the event handler which one of my elements was clicked. I've come up with the following: MYNS.CarouselHelper.prototype.attachImgHandlers = function () { $j(".carouselItem").bind("click", this, function(e){ e.data.openCarouselImage(e) }); } I then have the following in my event handler: MYNS.CarouselHelper.prototype.openCarouselImage = function(e) { var img = e.currentTarget; // Do stuff to the image element }; Is this 'right'? It feels wrong to me as I am used to explicitly passing the element to the event handler in Prototype as I loop through an array of elements. Thanks in advance.

    Read the article

  • Is NSDictionary key order guaranteed the same as initialized if it never changes?

    - by Thaurin
    I've run into the same problem as found in this question. However, I have a follow-up question. I seem to be in the same situation as the original asker: I have a plist with a hierarchy of dictionaries that define a configuration screen. These are not mutable and will stay the same throughout the application. Since the original discussion seems to focus on problems arising from mutating the dictionary, I must ask for comfirmation: is the order of a dictionary guaranteed the same as they are in the plist, i.e. as it is read (with initWithContentsOfFile)? Can I use allKeys on it in this case to get a correct-order array of keys if the dictionary never changes?

    Read the article

  • formatting NSArray

    - by califguy
    So from the code below, I have managed to get the string *tempstring into an array chunk. Now chunk[0] contains 'a' while chunk[1] contains 'aa'. I am trying to format chunk[0] to '0a' which I can using the replaceObjectAtIndex method. Here's my question: How do I detect that chunk[0] is formatted as 'a' and not '0a'. I want to check all the indexes and make sure they have double digits and if not use a 0 to prefix it. NSString *tempstring = @"a-aa-bb"; NSMutableArray *chunk = [tempstring componentsSeparatedByString: @"-"]; NSLog(@"%@",[chunk objectAtIndex:0]);

    Read the article

  • How do you data drive task dependencies via properties in psake?

    - by Jordan
    In MSBuild you can data drive target dependencies by passing a item group into a target, like so: <ItemGroup> <FullBuildDependsOn Include="Package;CoreFinalize" Condition="@(FullBuildDependsOn) == ''" /> </ItemGroup> <Target Name="FullBuild" DependsOnTargets="@(FullBuildDependsOn)" /> If you don't override the FullBuildDependsOn item group, the FullBuild target defaults to depending on the Package and CoreFinalize targets. However, you can override this by defining your own FullBuildDependsOn item group. I'd like to do the same in psake - for example: properties { $FullBuildDependsOn = "Package", "CoreFinalize" } task default -depends FullBuild # this won't work because $FullBuildDependsOn hasn't been defined yet - the "Task" function will see this as a null depends array task FullBuild -depends $FullBuildDependsOn What do I need to do to data drive the task dependencies in psake?

    Read the article

  • Tomcat v7.0 failed to start on Eclipse

    - by Questions
    Whenever I am running a program on Eclipse, my tomcat is failing to start. I get a dialog box stating this message Server Tomcat v7.0 Server at localhost failed to start. In the console, I am getting this messages Nov 17, 2011 11:56:04 AM org.apache.catalina.core.AprLifecycleListener init INFO: The APR based Apache Tomcat Native library which allows optimal performance in production environments was not found on the java.library.path: C:\Program Files\Java\jre6\bin;C:\WINDOWS\Sun\Java\bin;C:\WINDOWS\system32;C:\WINDOWS;C:/Program Files/Java/jre6/bin/client;C:/Program Files/Java/jre6/bin;C:/Program Files/Java/jre6/lib/i386;C:\WINDOWS\system32;C:\WINDOWS;C:\WINDOWS\System32\Wbem;C:\Program Files\Intel\WiFi\bin\;C:\Program Files\Java\jdk1.6.0_01\bin;C:\Program Files\Java\jre1.6.0_01\bin;C:\ILOG\CPLEX_Studio_Preview122\opl\bin\x86_win32;C:\ILOG\CPLEX_Studio_Preview122\opl\oplide\;C:\ILOG\CPLEX_Studio_Preview122\cplex\bin\x86_win32;C:\ILOG\CPLEX_Studio_Preview122\cpoptimizer\bin\x86_win32;;D:\JSP_Setup\eclipse-jee-helios-SR2-win32\eclipse;;. Nov 17, 2011 11:56:04 AM org.apache.tomcat.util.digester.SetPropertiesRule begin WARNING: [SetPropertiesRule]{Server/Service/Engine/Host/Context} Setting property 'source' to 'org.eclipse.jst.jee.server:servletConfigTest' did not find a matching property. Nov 17, 2011 11:56:04 AM org.apache.tomcat.util.digester.SetPropertiesRule begin WARNING: [SetPropertiesRule]{Server/Service/Engine/Host/Context} Setting property 'source' to 'org.eclipse.jst.jee.server:BeerAdvice3' did not find a matching property. Nov 17, 2011 11:56:04 AM org.apache.tomcat.util.digester.SetPropertiesRule begin WARNING: [SetPropertiesRule]{Server/Service/Engine/Host/Context} Setting property 'source' to 'org.eclipse.jst.jee.server:BeerAdvice1' did not find a matching property. Nov 17, 2011 11:56:05 AM org.apache.coyote.http11.Http11Protocol init INFO: Initializing Coyote HTTP/1.1 on http-8080 Nov 17, 2011 11:56:05 AM org.apache.coyote.ajp.AjpProtocol init INFO: Initializing Coyote AJP/1.3 on ajp-8009 Nov 17, 2011 11:56:05 AM org.apache.catalina.startup.Catalina load INFO: Initialization processed in 682 ms Nov 17, 2011 11:56:05 AM org.apache.catalina.core.StandardService startInternal INFO: Starting service Catalina Nov 17, 2011 11:56:05 AM org.apache.catalina.core.StandardEngine startInternal INFO: Starting Servlet Engine: Apache Tomcat/7.0.2 java.lang.reflect.InvocationTargetException at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at org.apache.catalina.startup.Bootstrap.start(Bootstrap.java:288) at org.apache.catalina.startup.Bootstrap.main(Bootstrap.java:415) Caused by: java.lang.IllegalArgumentException: Invalid <url-pattern> entry_checking in servlet mapping at org.apache.catalina.core.StandardContext.addServletMapping(StandardContext.java:2823) at org.apache.catalina.core.StandardContext.addServletMapping(StandardContext.java:2799) at org.apache.catalina.deploy.WebXml.configureContext(WebXml.java:1278) at org.apache.catalina.startup.ContextConfig.webConfig(ContextConfig.java:1255) at org.apache.catalina.startup.ContextConfig.configureStart(ContextConfig.java:878) at org.apache.catalina.startup.ContextConfig.lifecycleEvent(ContextConfig.java:313) at org.apache.catalina.util.LifecycleSupport.fireLifecycleEvent(LifecycleSupport.java:119) at org.apache.catalina.util.LifecycleBase.fireLifecycleEvent(LifecycleBase.java:89) at org.apache.catalina.core.StandardContext.startInternal(StandardContext.java:4667) at org.apache.catalina.util.LifecycleBase.start(LifecycleBase.java:139) at org.apache.catalina.core.ContainerBase.startInternal(ContainerBase.java:988) at org.apache.catalina.core.StandardHost.startInternal(StandardHost.java:771) at org.apache.catalina.util.LifecycleBase.start(LifecycleBase.java:139) at org.apache.catalina.core.ContainerBase.startInternal(ContainerBase.java:988) at org.apache.catalina.core.StandardEngine.startInternal(StandardEngine.java:275) at org.apache.catalina.util.LifecycleBase.start(LifecycleBase.java:139) at org.apache.catalina.core.StandardService.startInternal(StandardService.java:427) at org.apache.catalina.util.LifecycleBase.start(LifecycleBase.java:139) at org.apache.catalina.core.StandardServer.startInternal(StandardServer.java:649) at org.apache.catalina.util.LifecycleBase.start(LifecycleBase.java:139) at org.apache.catalina.startup.Catalina.start(Catalina.java:585) ... 6 more I had run the code previously, but now it is giving this problems. Also, I went through this post http://forums.opensuse.org/applications/391114-tomcat6-eclipse-not-working.html But is not helping me. Please help at the earliest.

    Read the article

  • What risks are there in using extracted PHP superglobals?

    - by Zephiro
    Hola usando estas funciones, que riesgo corro en tener problemas de seguridad, es necesesario usar extract() o hay alguna manera mejor de convertir las variables superglobales (array) en trozos de variables. Good, there is some risk in using the function extract in the superglobal variables as $_POS and $_GET, I work of the following way. There is risk of SQL INJECTION or there is an alternative to extract if ( get_magic_quotes_gpc() ) { $_GET = stripslashes( $_GET ); $_POST =stripslashes( $_POST ); } function vars_globals($value = '') { if (is_array ( $value )) $r = &$value; else parse_str ( $value, $r ); return $r; } $r = vars_globals( $_GET ); extract($r, EXTR_SKIP);

    Read the article

  • Suggestion to reverse string in c#

    - by HasanGursoy
    Is this the right method to reverse a string? I'm planning to use it to reverse a string like: Products » X1 » X3 to X3 « X1 « Products I want it to be a global function which can be used elsewhere. public static string ReverseString(string input, string separator, string outSeparator) { string result = String.Empty; string[] temp = Regex.Split(input, separator, RegexOptions.IgnoreCase); Array.Reverse(temp); for (int i = 0; i < temp.Length; i++) { result += temp[i] + " " + outSeparator + " "; } return result; }

    Read the article

  • SQL Server 2005 Fail: Return Dates As Strings

    - by Abs
    Hello all, I am using the SQL Server PHP Driver, I think this question can be answered without knowing what this is. I have come across this many times, what does it mean by NAMES? Column names?: SET NAMES utf8 Is there a query similar to the above that will get my dates to be returned as a string? For some reason on my SQL Sever 2008 on Vista, this works: $connectionInfo = array('Database' => $dbname, 'ReturnDatesAsStrings' => true) But the above 'ReturnDatesAsStrings' does not work on my SQL Server 2005 on a windows server machine? I can't execute any queries after setting the above! Does SQL Server 2005 support ReturnDatesAsStrings? Is there some other parameter I can pass to do the same? Thanks all for any help EDIT I should of mentioned this but if there is a solution I am hoping for one that is in the form of a setting that can be set before any queries can be executed as I do not have control on what queries will be executed.

    Read the article

  • /clr option in c++

    - by muhammad-aslam
    hello friendzz plz give me a solution for this error "fatal error C1190: managed targeted code requires a '/clr' option" HOw can i resolve this problem?? My configuration is .. Visual studio 2008 windows 7 Here is the code (i got by using net resources) using using namespace System; using namespace System::IO; int main() { // Create a reference to the current directory. DirectoryInfo* di = new DirectoryInfo(Environment::CurrentDirectory); // Create an array representing the files in the current directory. FileInfo* fi[] = di-GetFiles(); Console::WriteLine(S"The following files exist in the current directory:"); // Print out the names of the files in the current directory. Collections::IEnumerator* myEnum = fi-GetEnumerator(); while (myEnum-MoveNext()) { FileInfo* fiTemp = __try_cast(myEnum-Current); Console::WriteLine(fiTemp-Name); } } PLZZZZZZZZ

    Read the article

  • Setting Mnemonics and Hot Keys for a JOptionPane Dialog

    - by Daniel Bingham
    Is it possible to assign hotkeys and mnemonics to the buttons in a JOptionPane Dialog? I'd like to be able, in a JOptionPane generated message dialog with the options Yes, No and Cancel, press Y to hit the Yes button, N to hit the No button and escape to activate the escape button. Similarly in a dialog with Okay and Cancel buttons I'd like to be able to activate them with enter and escape. I've attempted passing JButtons into the JOptionPane's button Object array with the Mnemonics set already. The mnemonics work and the buttons show up correctly in the dialogs, however, they do not act properly when they are activated. Most noticeably they do not dispose of the dialog. What is the correct way to add hotkeys and Mnemonics to a JOptionPane Dialog's buttons? As always, my apologies ahead of time if this is a duplicate - I searched both Google and Stackoverflow and found nothing.

    Read the article

  • Add UIView Above All Other Views, Including StatusBar

    - by Mike Stead
    I'm wanting to create a view (UIControl) which blocks all input and shows a UIActivityIndicatorView while authenticating a user. The UIActionSheet and UIAlertView both manage to add a black semi-transparent view over the top of all other views to block input and I'd like to do similar. I've tried adding my view to the top UIWindow in the [[UIApplication sharedApplication] windows] array, and while this does place it above the UIKeyboard if it's visible, it doesn't place it over the StatusBar (which makes sense). My next attempt was to extend UIAlertView, remove all of its subviews and set its layer.contents = nil, then add the ActivityIndicator as a subview. This works well, but I can't seem to kill the default bouncy transition of the UIAlertView when you call it to "show". Does anyone have any pointers towards the best way tackle this problem that gives me full control? Oh and I know blocking input is not great but I do ensure it's for a short period of time and it has the benefit of making it clear to the user that their action, which must complete for them to progress, is processing.

    Read the article

  • CodePlex Daily Summary for Thursday, May 08, 2014

    CodePlex Daily Summary for Thursday, May 08, 2014Popular ReleasesOneNote Tagging Kit: OneNoteTaggingKit Add-In v2.3.5241.24721: Bugfix Release First time add-in registration problem fixed (issue 973 ). Was introduced by changing installer technology. Page tags retrieved from page meta element rather than outline to avoid round-trip encoding issues and avoid tags getting out of sync if someone edits the tags in the outline. Fixed issue with popup which showed an incorrect message for a short timeAST - a tool for exploring windows kernel: Ast-0.1-win8.1x86: Ast-0.1-win8.1x86Ghostscript.NET: Ghostscript.NET v.1.1.8.: 1.1.8. fixed incompatibility problem with 'gsapisetarg_encoding' function in Ghostscript releases prior to 9.10. (this function was introduced in 9.10 release) fixed older versions incompatibility problem with '-dMaxBitmap=1g' switch bugfix which in some cases turns on text antialiasing for Ghostscript 9.14 added better initialization checking 1.1.7. implemented Ghostscript native library verification with a friendly error message that will clear out the confusion when used native Ghosts...SimCityPak: SimCityPak 0.3.0.0: Contains several bugfixes, newly identified properties and some UI improvements. Main new features UI overhaul for the main index list: Icons for each different index, including icons for different property files Tooltips for all relevant fields Removed clutter Identified hundreds of additional properties (thanks to MaxisGuillaume) - this should make modding gameplay easierSeal Report: Seal Report 1.4: New Features: Report Designer: New option to convert a Report Source into a Repository Source. Report Designer: New contextual helper menus to select, remove, copy, prompt elements in a model. Web Server: New option to expand sub-folders displayed in the tree view. Web Server: Web Folder Description File can be a .cshtml file to display a MVC View. Views: additional CSS parameters for some DIVs. NVD3 Chart: Some default configuration values have been changed. Issues Addressed:16 ...Magick.NET: Magick.NET 6.8.9.002: Magick.NET linked with ImageMagick 6.8.9.0.VidCoder: 1.5.22 Beta: Added ability to burn SRT subtitles. Updated to HandBrake SVN 6169. Added checks to prevent VidCoder from running with a database version newer than it expects. Tooltips in the Advanced Video panel now trigger on the field labels as well as the fields themselves. Fixed updating preset/profile/tune/level settings on changing video encoder. This should resolve some problems with QSV encoding. Fixed tunes and profiles getting set to blank when switching between x264 and x265. Fixed co...NuGet: NuGet 2.8.2: We will be releasing a 2.8.2 version of our own NuGet packages and the NuGet.exe command-line tool. The 2.8.2 release will not include updated VS or WebMatrix extensions. NuGet.Server.Extensions.dll needs to be used alongside NuGet-Signed.exe to provide the NuGet.exe mirror functionality.SmartStore.NET - Free ASP.NET MVC Ecommerce Shopping Cart Solution: SmartStore.NET 2.0.2: SmartStore.NET 2.0.2 is primarily a maintenance release for version 2.0.0, which has been released on April 04 2014. It contains several improvements & important fixes. BugfixesIMPORTANT FIX: Memory leak leads to OutOfMemoryException in application after a while Installation fix: some varchar(MAX) columns get created as varchar(4000). Added a migration to fix the column specs. Installation fix: Setup fails with exception Value cannot be null. Parameter name: stream Bugfix for stock iss...Channel9's Absolute Beginner Series: Windows Phone 8.1: Entire source code for Windows Phone 8.1 Absolute Beginner Series.BIDS Helper: BIDS Helper 1.6.6: This BIDS Helper beta release brings support for SQL Server 2014 and SSDTBI for Visual Studio 2013. (Note that SSDTBI for Visual Studio 2013 is currently unavailable to download from Microsoft. We are releasing BIDS Helper support to help those who downloaded it before it became unavailable, and we will recheck BIDS Helper 2014 is compatible after SSDTBI becomes available to download again.) BIDS Helper 2014 Beta Limitations: SQL Server 2014 support for Biml is still in progress, so this bet...Windows Phone IsoStoreSpy (a cool WP8.1 + WP8 Isolated Storage Explorer): IsoStoreSpy WP8.1 3.0.0.0 (Win8 only): 3.0.0.0 + WP8.1 & WP8 device allowed + Local, Roaming or Temp directory Selector for WindowsRuntime apps + Version number in the title :)CS-Script for Notepad++ (C# intellisense and code execution): Release v1.0.24.0: ShortcutMapping panel now allows direct modification of the shortcuts. Custom updater dropped support for MSI installation but it still allows downloading of MSI http://www.csscript.net/npp/codeplex/non_msi_update.pngProDinner - ASP.NET MVC Sample (EF5, N-Tier, jQuery): 8.2: upgrade to mvc 5 upgrade to ASP.net MVC Awesome 4.0, EF 6.1, latest jcrop, Windsor Castle etc. ability to show/hide the dog using tinymce for the feedback page mobile friendly uiASP.net MVC Awesome - jQuery Ajax Helpers: 4.0: version 4.0 ========================== - added InitPopup, InitPopupForm helpers, open initialized popups using awe.open(name, params) - added Tag or Tags for all helpers, usable in mod code - added popup aweclose, aweresize events - popups have api accessible via .data('api'), with methods open, close and destroy - all popups have .awe-popup class - popups can be grouped using .Group(string), only 1 popup in the same group can exist at the same time - added awebeginload event for...SEToolbox: SEToolbox 01.028.008 Release 2: Fixes for drag-drop copying. Added ship joiner, to rejoin a broken ship! Installation of this version will replace older version.ScreenToGif: Release 1.0: What's new: • Small UI tweaks everywhere. • You can add Text, Subtitles and Title Frames. • Processing the gif now takes less time. • Languages: Spanish, Italian and Tamil added. • Single .exe multi language. • Takes less time to apply blur and pixelated efect. • Restart button. • Language picker. (If the user wants to select a diferent language than the system's) • "Encoding Finished" page with a link to open the file. • GreenScreen unchanged pixels to save kilobytes. • "Check for Updates" t...Touchmote: Touchmote 1.0 beta 11: Changes Support for multiple monitor setup Additional settings for analog sticks More reliable pairing Bug fixes and improvementsMicrosoft Script Analyzer: Microsoft Script Analyzer 1.1: The Script Analyzer scans your current PowerShell script code against some PowerShell best practice rules, and provide suggestions to improve the script quality and readability. By double-clicking the checking result, the relevant script code will be highlighted in the code editor. Script Analyzer result You can configure the Script Analyzer rules in the Settings window of Script Analyzer. Script Analyzer settings The current release includes 5 PowerShell best practice rules. Invoke-...Microsoft Script Browser: Script Browser 1.1: Script Browser for Windows PowerShell ISE was designed and developed in response to many IT Pros’ and MVPs’ feedback during the MVP Global Summit. It puts nearly 10K script examples at IT Pros fingertips when they write scripts to automate their IT tasks. Users can search, learn, download and manage scripts from within their scripting environment - PowerShell ISE - with just a few button clicks. It saves the time of switching back and forth between webpages and scripting environment, and also...New ProjectsAgenda do Estudante: Aplicativo para auxiliar estudantes no gerenciamento do tempo, disponível na WEB, buscando possuir ampla acessibilidade. Code Analysis Rule Collection: Contains a set of diagnostics, code fixes and refactorings built on the Microsoft .NET Compiler Platform "Roslyn".CRM User Diagnostics Tool: DiagnosticsDbWord: this tools use xml.sql generate daily report and weekly report from word. EasyWork: ADO.NET Entity Framework Common Service Locator Unity Unity Interception Extension MEF ASP.NET MVC jQWidgetsEjerciciosFer: Ultimate Summary re LocoGestionEvenement: ASP .NET applicationINNOVA: Sistema web-movil para disponiblidad...,.Internal: This is an internal project for personal usageLearnserve CORE - SCORM LMS: Learnserve CORE LMS is a comprehensive .NET SCORM LMS Module designed to extend DNN into a CMS/LMS that can deliver any online training.M2B Gestion Entretiens: Gestion des entretiensModern DevOps Tools: Modern DevOps Tools is based around building an tools that uses recommended practices that will work inside of your continuous delivery cycle.Monopoly NOHI: Monopoly for the NOHIORT MAY 2014 HOTELUCHO C# MVC3 EF5: Academic web project using MVC 3, Entity Framework 5. Hotel reservations management. User registration and room reservations.ProfSteeve: ProfSteeve is a teaching tool.Project issue resolution lists: wenti Registry Settings Export Library: The main purpose of this project is to enable the creation of .reg files from registry keys.Scroll++: Enables scrolling ui-elements without focusing them. SIGCBI: Sistema para Gestión de las áreas de Almacén, Administración y Ventas del Complejo Turístico Baños del Inca.SISPERRHH - WEB: Sistema de Gestión de RRHH.Trabajo Practico Laboratorio V: Trabajo Practico Laboratorio VTraining_MEF_MVC: Training MEF MVCTraining_MEF_SimpleCalculator: Simple Calculator MEFTraining_MVC_ExploringMVCParts: Training Exploring MVC PartsTres Punto Cinco: Tres Punto CincoUI Exception Handler: UI Exception Handler is a simple library that provides error windows for unexpected .Net application exceptions.Widjet_jQueryUI_CustomLineSelector: Custom line selector

    Read the article

  • UI not updated while using ProgressMonitorInputStream in Swing to monitor compressed file decompress

    - by Bozhidar Batsov
    I'm working on swing application that relies on an embedded H2 database. Because I don't want to bundle the database with the app(the db is frequently updated and I want new users of the app to start with a recent copy), I've implemented a solution which downloads a compressed copy of the db the first time the application is started and extracts it. Since the extraction process might be slow I've added a ProgressMonitorInputStream to show to progress of the extraction process - unfortunately when the extraction starts, the progress dialog shows up but it's not updated at all. It seems like to events are getting through to the event dispatch thread. Here is the method: public static String extractDbFromArchive(String pathToArchive) { if (SwingUtilities.isEventDispatchThread()) { System.out.println("Invoking on event dispatch thread"); } // Get the current path, where the database will be extracted String currentPath = System.getProperty("user.home") + File.separator + ".spellbook" + File.separator; LOGGER.info("Current path: " + currentPath); try { //Open the archive FileInputStream archiveFileStream = new FileInputStream(pathToArchive); // Read two bytes from the stream before it used by CBZip2InputStream for (int i = 0; i < 2; i++) { archiveFileStream.read(); } // Open the gzip file and open the output file CBZip2InputStream bz2 = new CBZip2InputStream(new ProgressMonitorInputStream( null, "Decompressing " + pathToArchive, archiveFileStream)); FileOutputStream out = new FileOutputStream(ARCHIVED_DB_NAME); LOGGER.info("Decompressing the tar file..."); // Transfer bytes from the compressed file to the output file byte[] buffer = new byte[1024]; int len; while ((len = bz2.read(buffer)) > 0) { out.write(buffer, 0, len); } // Close the file and stream bz2.close(); out.close(); } catch (FileNotFoundException e) { e.printStackTrace(); } catch (IOException ex) { ex.printStackTrace(); } try { TarInputStream tarInputStream = null; TarEntry tarEntry; tarInputStream = new TarInputStream(new ProgressMonitorInputStream( null, "Extracting " + ARCHIVED_DB_NAME, new FileInputStream(ARCHIVED_DB_NAME))); tarEntry = tarInputStream.getNextEntry(); byte[] buf1 = new byte[1024]; LOGGER.info("Extracting tar file"); while (tarEntry != null) { //For each entry to be extracted String entryName = currentPath + tarEntry.getName(); entryName = entryName.replace('/', File.separatorChar); entryName = entryName.replace('\\', File.separatorChar); LOGGER.info("Extracting entry: " + entryName); FileOutputStream fileOutputStream; File newFile = new File(entryName); if (tarEntry.isDirectory()) { if (!newFile.mkdirs()) { break; } tarEntry = tarInputStream.getNextEntry(); continue; } fileOutputStream = new FileOutputStream(entryName); int n; while ((n = tarInputStream.read(buf1, 0, 1024)) > -1) { fileOutputStream.write(buf1, 0, n); } fileOutputStream.close(); tarEntry = tarInputStream.getNextEntry(); } tarInputStream.close(); } catch (Exception e) { } currentPath += "db" + File.separator + DB_FILE_NAME; if (!currentPath.isEmpty()) { LOGGER.info("DB placed in : " + currentPath); } return currentPath; } This method gets invoked on the event dispatch thread (SwingUtilities.isEventDispatchThread() returns true) so the UI components should be updated. I haven't implemented this as an SwingWorker since I need to wait for the extraction anyways before I can proceed with the initialization of the program. This method get invoked before the main JFrame of the application is visible. I don't won't a solution based on SwingWorker + property changed listeners - I think that the ProgressMonitorInputStream is exactly what I need, but I guess I'm not doing something right. I'm using Sun JDK 1.6.18. Any help would be greatly appreciated.

    Read the article

  • Calling UITableViews delegate methods directly.

    - by RickiG
    Hi I was looking for a way to call the edit method directly. - (void)tableView:(UITableView *)theTableView commitEditingStyle:(UITableViewCellEditingStyle)editingStyle forRowAtIndexPath:(NSIndexPath *)indexPath I have all my logic for animating manipulated cells, removing from my model array etc. in this method. It is getting called when a user swipes, adds or rearranges, but I would like to call it manually/directly as a background thread changes my model. I have constructed an NSIndexPath like so: NSIndexPath *path = [NSIndexPath indexPathForRow:i inSection:1]; I just can't figure out how to call something like: [self.tableview commitEditingStyle:UITableViewCellEditingStyleDelete forRowAtIndexPath:path]; Do I need to gain access to the methods of this plain style UITableView in another way? Thanks:)

    Read the article

  • Python: Traffic-Simulation (cars on a road)

    - by kame
    Hello! I want to create a traffic simulator like here: http://www.doobybrain.com/wp-content/uploads/2008/03/traffic-simulation.gif But I didn't thougt very deep about this. I would create the class car. Every car has his own color, position and so on. And I could create the road with an array. But how to tell the car where to go? Could I hear your ideas? EDIT: Is it forbidden to get new ideas from good programmers? Why do some people want to close this thread? Or were to ask such questions? I dont understand them. :(

    Read the article

  • what is for....in statement in javascript

    - by dramasea
    anyone can explain how to use for...in statement in javascript. I had read the w3school article but i think it is not so clear.Below is the code, please explain this: <html> <body> <script type="text/javascript"> var x; var mycars = new Array(); mycars[10] = "Saab"; mycars[20] = "Volvo"; mycars[30] = "BMW"; for (x in mycars) { document.write(mycars[x] + "<br />"); } </script> </body> </html>

    Read the article

  • [C++]Advantage of using a static member function instead of an equivalent non-static member function

    - by jonathanasdf
    I was wondering whether there's any advantages to using a static member function when there is a non-static equivalent. Will it result in faster execution (because of not having to care about all of the member variables), or maybe less use of memory (because of not being included in all instances)? Basically, the function I'm looking at is an utility function to rotate an integer array representing pixel colours an arbitrary number of degrees around an arbitrary centre point. It is placed in my abstract Bullet base class, since only the bullets will be using it and I didn't want the overhead of calling it in some utility class. It's a bit too long and used in every single derived bullet class, making it probably not a good idea to inline. How would you suggest I define this function? As a static member function of Bullet, of a non-static member function of Bullet, or maybe not as a member of Bullet but defined outside of the class in Bullet.h? What are the advantages and disadvantages of each?

    Read the article

  • Regular expression for parsing CSV in PHP

    - by Discodancer
    I already managed to split the CSV file using this regex: "/,(?=(?:[^\"]\"[^\"]\")(?![^\"]\"))/" But I ended up with an array of strings that contain the opening and ending double quotes. Now I need a regex that would strip those strings of the delimiter double quotes. As far as I know the CSV format can encapsulate strings in double quotes, and all the double quotes that are already a part of the string are doubled. For example: My "other" cat becomes "My ""other"" cat" What I basically need is a regex that will replace all sequences of N doublequotes with a sequence of (N/2 - rounded down) double quotes. Or is there a better way ? Thanks in advance.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • problem in counting children category

    - by moustafa
    I have this table: fourn_category (id , sub) I am using this code to count: function CountSub($id){ $root = array($id); $query = mysql_query("SELECT id FROM fourn_category WHERE sub = '$id'"); while( $row = mysql_fetch_array( $query, MYSQL_ASSOC ) ){ array_push($root,$row['id']); CountSub($row['id']); } return implode(",",$root); } It returns the category id as 1,2,3,4,5 to using it to count the sub by IN() But the problem is that it counts this: category 1 category 2 category 3 category 4 category 5 Category 1 has 1 child not 4. Why? How can I get all children's trees?

    Read the article

< Previous Page | 497 498 499 500 501 502 503 504 505 506 507 508  | Next Page >