Search Results

Search found 16413 results on 657 pages for 'array manipulation'.

Page 501/657 | < Previous Page | 497 498 499 500 501 502 503 504 505 506 507 508  | Next Page >

  • friendship and operator overloading help

    - by sil3nt
    hello there, I have the following class #ifndef Container_H #define Container_H #include <iostream> using namespace std; class Container{ friend bool operator==(const Container &rhs,const Container &lhs); public: void display(ostream & out) const; private: int sizeC; // size of Container int capacityC; // capacity of dynamic array int * elements; // pntr to dynamic array }; ostream & operator<< (ostream & out, const Container & aCont); #endif and this source file #include "container.h" /*----------------------------********************************************* note: to test whether capacityC and sizeC are equal, must i add 1 to sizeC? seeing as sizeC starts off with 0?? */ Container::Container(int maxCapacity){ capacityC = maxCapacity; elements = new int [capacityC]; sizeC = 0; } Container::~Container(){ delete [] elements; } Container::Container(const Container & origCont){ //copy constructor? int i = 0; for (i = 0; i<capacityC; i++){ //capacity to be used here? (*this).elements[i] = origCont.elements[i]; } } bool Container::empty() const{ if (sizeC == 0){ return true; }else{ return false; } } void Container::insert(int item, int index){ if ( sizeC == capacityC ){ cout << "\n*** Next: Bye!\n"; return; // ? have return here? } if ( (index >= 0) && (index <= capacityC) ){ elements[index] = item; sizeC++; } if ( (index < 0) && (index > capacityC) ){ cout<<"*** Illegal location to insert--"<< index << ". Container unchanged. ***\n"; }//error here not valid? according to original a3? have i implemented wrong? } void Container::erase(int index){ if ( (index >= 0) && (index <= capacityC) ){ //correct here? legal location? int i = 0; while (i<capacityC){ //correct? elements[index] = elements[index+1]; //check if index increases here. i++; } sizeC=sizeC-1; //correct? updated sizeC? }else{ cout<<"*** Illegal location to be removed--"<< index << ". Container unchanged. ***\n"; } } int Container::size()const{ return sizeC; //correct? } /* bool Container::operator==(const Container &rhs,const Container &lhs){ int equal = 0, i = 0; for (i = 0; i < capacityC ; i++){ if ( rhs.elements[i] == lhs.elements[i] ){ equal++; } } if (equal == sizeC){ return true; }else{ return false; } } ostream & operator<< (ostream & out, const Container & aCont){ int i = 0; for (i = 0; i<sizeC; i++){ out<< aCont.elements[i] << " " << endl; } } */ I dont have the other functions in the header file (just a quikie). Anyways, the last two functions in "/* */" I cant get to work, what am I doing wrong here? the first function is to see whether the two arrays are equal to one another

    Read the article

  • How can I use a variable as a module name in Perl?

    - by mjn12
    I know it is possible to use a variable as a variable name for package variables in Perl. I would like to use the contents of a variable as a module name. For instance: package Foo; our @names =("blah1", "blah2"); 1; And in another file I want to be able be able to set the contents of a scalar to "foo" and then access the names array in Foo through that scalar. my $packageName = "Foo"; Essentially I want to do something along the lines of: @{$packageName}::names; #This obviously doesn't work. I know I can use my $names = eval '$'. $packageName . "::names" But only if Foo::names is a scalar. Is there another way to do this without the eval statement?

    Read the article

  • jQuery Set Child CSS Attribute Problem

    - by Jascha
    I have a child element of a div named "bob" that's class is '.divTitle' <div id="bob"> <div class="divTitle"> <a href="#"> <h1>Title</h1> </a> </div> </div> I am trying to set the background color of "divTitle" to red but for the life of me can't get this to work. Right now I am trying two things... $('#bob').children('.divTitle')[0].css('background-color', '#0f0'); // assuming children is returning an array... and $('#bob').children('.divTitle').css('background-color', '#0f0'); neither with any success... can anyone tell me what I am missing here? Do I have to go deeper than ".children"?

    Read the article

  • What is the scope of JS variables in anonymous functions

    - by smorhaim
    Why does this code returns $products empty? If I test for $products inside the function it does show data... but once it finishes I can't seem to get the data. var $products = new Array(); connection.query($sql, function(err, rows, fields) { if (err) throw err; for(i=0; i< rows.length; i++) { $products[rows[i].source_identifier] = "xyz"; } }); connection.end(); console.log($products); // Shows empty.

    Read the article

  • Problem searching a NSMutableArray

    Basically, I have a UISearchBar searching an NSMutableArray of stories that make up an RSS feed, and when you select a story, it loads in my app's UIWebView. It's difficult to explain, but I have a list of entries 1, 2, 3, and 4 and you search for '4'. 4 will be the first entry in the now-filtered list of data, right? You'd think that by selecting 4, it would load in the UIWebView. Well, the app seems to not recognize that you're selecting the first entry in a filtered list of data, and instead thinks that you're selecting the first entry in the unfiltered array of data, so it loads entry 1. Everything looks right in my code, but obviously it isn't. I know it's a confusing problem, but I hope I made it somewhat clear. Anyway, here's the relevant source so that you may see exactly what I mean: Search.h: http://www.scribd.com/doc/13107802/Searchh Search.m: http://www.scribd.com/doc/13107812/Searchm

    Read the article

  • JSON in an AJAX request

    - by Josh K
    I have a PHP API I'm working with that outputs everything as JSON. I need to call one of the API methods and parse it out using an AJAX request. I am using jQuery (though it shouldn't matter). When I make the request it errors out with a "parsererror" as the textStatus and a "Syntax Error: invalid label" when I make the request. Simplified code: $.ajax ({ type: "POST", url: "http://mydomain.com/api/get/userlist/"+mid, dataType: "json", dataFilter: function(data, type) { /* Here we assume and pray */ users = eval(data); alert(users[1].id); }, success: function(data, textStatus, XMLHttpRequest) { alert(data.length); // Should be an array, yet is undefined. }, error: function(XMLHttpRequest, textStatus, errorThrown) { alert(textStatus); alert(errorThrown); }, complete: function(XMLHttpRequest, textStatus) { alert("Done"); } });

    Read the article

  • Curl automatically display the result?

    - by Emily
    I'm using php 5.3.2 and when i execute a curl it display the result directly without adding a print or echo function. Here is my code: <?php $pvars = array('query' => 'ice age', 'orderby' => 'popularity'); $timeout = 30; $myurl = "http://www.website.com"; $curl = curl_init(); curl_setopt($curl, CURLOPT_URL, $myurl); curl_setopt($curl, CURLOPT_TIMEOUT, $timeout); curl_setopt($curl, CURLOPT_POST, 1); curl_setopt($curl, CURLOPT_POSTFIELDS, $pvars); $xml = curl_exec($curl); curl_close ($curl); ?> What's wrong with my code and why it displays the result?

    Read the article

  • problem in return value from server to client in ajax useing zend-framework

    - by user1400
    hello i try to use ajax and zend in my application , i could pass variable to server but i can not get data from server , it does not return values, it return all html code page, where is my mistake? $('#myForm').submit(function($e){ $e.preventDefault(); var $paramToServer=$("#myForm").serialize(); $.ajax({ type:'POST', url:'test', data:$paramToServer , success:function(re){ var res = $.evalJSON(re); console.log(res.id); // to see in firebog }, dataType:'json' }); }); public function testAction() { // action body $this->_helper->getHelper('viewRenderer')->setNoRender(); // If you use layout, disable it Zend_Layout::getMvcInstance()->disableLayout(); $name=$this->getRequest()->getParam ( 'name' ); //pass $name to server $return = array( 'id' => '5', 'family' => 'hello ', ); $return = Zend_Json::encode( $return); // Response $this->getResponse()->setBody($return); }

    Read the article

  • DataView Vs DataTable.Select()

    - by Aseem Gautam
    Considering the code below: Dataview someView = new DataView(sometable) someView.RowFilter = someFilter; if(someView.count > 0) { …. } Quite a number of articles which say Datatable.Select() is better than using DataViews, but these are prior to VS2008. Solved: The Mystery of DataView's Poor Performance with Large Recordsets Array of DataRecord vs. DataView: A Dramatic Difference in Performance So in a situation where I just want a subset of datarows based on some filter criteria(single query) and what is better DataView or DataTable.Select()?

    Read the article

  • Read only particular fields from CSV File in vb.net

    - by fireBand
    Hi, I have this code to read a CVS file. It reads each line, devides each line by delimiter ',' and stored the field values in array 'strline()' . How do I extract only required fields from the CSV file? For example if I have a CSV File like Type,Group,No,Sequence No,Row No,Date (newline) 0,Admin,3,345678,1,26052010 (newline) 1,Staff,5,78654,3,26052010 I Need only the value of columns Group,Sequence No and date. Thanks in advance for any ideas. Dim myStream As StreamReader = Nothing ' Hold the Parsed Data Dim strlines() As String Dim strline() As String Try myStream = File.OpenText(OpenFile.FileName) If (myStream IsNot Nothing) Then ' Hold the amount of lines already read in a 'counter-variable' Dim placeholder As Integer = 0 strlines = myStream.ReadToEnd().Split(Environment.NewLine) Do While strlines.Length <> -1 ' Is -1 when no data exists on the next line of the CSV file strline = strlines(placeholder).Split(",") placeholder += 1 Loop End If Catch ex As Exception LogErrorException(ex) Finally If (myStream IsNot Nothing) Then myStream.Close() End If End Try

    Read the article

  • Session in Iframe working in Firefox but not in Internet Explorer

    - by Younes
    Im trying to get a form working in Internet Explorer. I see that when i submit this form in Firefox I can start a session and send my webbrowser to the right page based on that Session. In Internet Explorer however when i'm debugging the $_SESSION i retrieve an empty array back, this means that in Internet Explorer the session isn't started on my second page. This is the code i'm using to print the session on my second page: session_start(); //unset($_SESSION['bp_email']); include("includes/_dbconnect.php"); print_r($_SESSION); die();

    Read the article

  • layout messed up once spinner has entries

    - by AndyAndroid
    Hello, I have <LinearLayout android:id="@+id/LinearLayoutPlayer" xmlns:android="http://schemas.android.com/apk/res/android" android:orientation="horizontal" android:layout_width="fill_parent" android:layout_height="wrap_content"> <Spinner android:id="@+id/Spinner01" android:layout_width="fill_parent" android:layout_height="wrap_content" android:layout_weight="100"></Spinner> <ToggleButton android:text="@+id/ToggleButton01" android:id="@+id/ToggleButton01" android:layout_height="wrap_content" android:layout_width="wrap_content" android:layout_weight="1"></ToggleButton> </LinearLayout> Which displays a spinner and next to it a toggle button. Everything okay so far. Of course the spinner need some entries, so I add to the spinner the attribute: android:entries="@array/myentries" The problem now is that the toggle button is a bit lower than the spinner and the botton of the toggle button is cut off, maybe 3 or 5 lines of pixels. Anyone an idea what is wrong here? Android is version 2.2 Thanks!

    Read the article

  • Completion block not being called. How to check validity?

    - by HCHogan
    I have this method which takes a block, but that block isn't always called. See the method: - (void)updateWithCompletion:(void (^)(void))completion { [MYObject myMethodWithCompletion:^(NSArray *array, NSError *error) { if (error) { NSLog(@"%s, ERROR not nil", __FUNCTION__); completion(); return; } NSLog(@"%s, calling completion %d", __FUNCTION__, &completion); completion(); NSLog(@"%s, finished completion", __FUNCTION__); }]; } I have some more NSLogs inside completion. Sometimes this program counter just blows right past the call to completion() in the code above. I don't see why this would be as the calling code always passes a literal block of code as input. If you're curious of the output of the line containing the addressof operator, it's always something different, but never 0 or nil. What would cause completion not to be executed?

    Read the article

  • Regular Expression Help - Brackets within brackets

    - by adbox
    Hello I'm trying to develop a function that can sort through a string that looks like this: Donny went to the {park|store|{beach with friends|beach alone}} so he could get a breath of freash air. What I intend to do is search the text recursively for {} patterns where there is no { or } inside the {}, so only the innermost sandwiched text is selected, where I will then run a php to array the contents and select one at random, repeating process until the whole string has been parsed, showing a complete sentence. I just cannot wrap my head around regular expressions though. Appreciate any help!

    Read the article

  • iPhone - Drawing 2D Shapes

    - by Hawdon
    Hi guys! I have an array of 2D points which make an irregular polygon. What I want to do is draw the borders of it and then fill it with a color. I am using Cocos2d to code the game around, but I have not found a fill function in Cocos2d, only the ccDrawLine and such. Is there a simple way to draw filled shapes in Cocos2? I have also noted that Core Graphics would work beautifully for this purpose, but I am not able to integrate it with Cocos2d. I put this in to the draw function of my CCLayer: CGContextRef ctx = UIGraphicsGetCurrentContext(); CGContextClearRect(ctx, [[UIScreen mainScreen] bounds]); And every time I run it i get this error: <Error>: CGContextClearRect: invalid context I really need to get this working... Any ideas?

    Read the article

  • Can an Excel VBA UDF called from the worksheet ever be passed an instance of any Excel VBA object mo

    - by jtolle
    I'm 99% sure that the answer is "no", but I'm wondering if someone who is 100% sure can say so. Consider a VBA UDF: Public Function f(x) End Function When you call this from the worksheet, 'x' will be a number, string, boolean, error, array, or object of type 'Range'. Can it ever be, say, an instance of 'Chart', 'ListObject', or any other Excel-VBA object model class? (The question arose from me moving to Excel 2007 and playing with Tables, and wondering if I could write UDFs that accept them as parameters instead of Ranges. The answer to that seems to be no, but then I realized I didn't know for sure in general.)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Scala and HttpClient: How do I resolve this error?

    - by Benjamin Metz
    I'm using scala with Apache HttpClient, and working through examples. I'm getting the following error: /Users/benjaminmetz/IdeaProjects/JakartaCapOne/src/JakExamp.scala Error:Error:line (16)error: overloaded method value execute with alternatives (org.apache.http.HttpHost,org.apache.http.HttpRequest)org.apache.http.HttpResponse <and> (org.apache.http.client.methods.HttpUriRequest,org.apache.http.protocol.HttpContext)org.apache.http.HttpResponse cannot be applied to (org.apache.http.client.methods.HttpGet,org.apache.http.client.ResponseHandler[String]) val responseBody = httpclient.execute(httpget, responseHandler) Here is the code with the error and line in question highlighted: import org.apache.http.client.ResponseHandler import org.apache.http.client.HttpClient import org.apache.http.client.methods.HttpGet import org.apache.http.impl.client.BasicResponseHandler import org.apache.http.impl.client.DefaultHttpClient object JakExamp { def main(args : Array[String]) : Unit = { val httpclient: HttpClient = new DefaultHttpClient val httpget: HttpGet = new HttpGet("www.google.com") println("executing request..." + httpget.getURI) val responseHandler: ResponseHandler[String] = new BasicResponseHandler val responseBody = httpclient.execute(httpget, responseHandler) // ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ println(responseBody) client.getConnectionManager.shutdown } } I can successfully run the example in java...

    Read the article

  • How do I convert the below PHP code to VB.NET?

    - by Greg
    How do I convert the below PHP code to VB.NET? <?php $X_HOST ="foo.com"; $X_URL = "/index.php"; $X_PORT ="8080"; $X_USERNAME = "foo"; $X_PASSWORD = "bar"; $s_POST_DATA = "Channel=UK.VODAFONE"; // Channel $s_POST_DATA .= "&Shortcode=12345"; // Shortcode $s_POST_DATA .= "&SourceReference=3456"; // Source Reference $s_POST_DATA .= "&MSISDN=447811111111"; // Phone $s_POST_DATA .= "&Content=test"; // Content $s_POST_DATA .= "&DataType=0"; // Data Type $s_POST_DATA .= "&Premium=1"; // Premium $s_POST_DATA .= "&CampaignID=4321"; // CampaignID $s_Request = "POST ".$X_URL." HTTP/1.0\r\n"; $s_Request .="Host: ".$X_HOST.":".$X_PORT."\r\n"; $s_Request .="Authorization: Basic ".base64_encode($X_USERNAME.":".$X_PASSWORD)."\r\n"; $s_Request .="Content-Type: application/x-www-form-urlencoded\r\n"; $s_Request .="Content-Length: ".strlen($s_POST_DATA)."\r\n"; $s_Request .="\r\n".$s_POST_DATA; //Sends out the request to the server. $fp = fsockopen ($X_HOST, $X_PORT, $errno, $errstr, 30) or die("Error!!!"); fputs ($fp, $s_Request); while (!feof($fp)) { $s_GatewayResponse .= fgets ($fp, 128); } fclose ($fp); //Array of official response codes. $a_Responses = array( "100" => "Server has returned an unspecified error.", "101" => "Server successfully received the request.", "102" => "Server has returned an database error", "103" => "Server has returned an syntax error." ); echo "<HTML>\n<BODY>\n\n"; //Checks for an official response code. foreach ($a_Responses as $s_ResponseCode => $s_ResponseDescription) { if (stristr($s_GatewayResponse, "\n$s_ResponseCode\n")) { echo "A response code of $s_ResponseCode was returned – "; echo $s_ResponseDescription"; $b_CodeReturned = true; } } //Checks for an authorization failure where an official response code has //not been recognized. if (!$b_CodeReturned) { if (stristr($s_GatewayResponse, "HTTP/1.1 401")) { echo "The server rejected your username/password (HTTP 401)."; } else { echo "No recognised response code was returned by the server."; } } echo "\n\n</BODY>\n</HTML>"; ?> and <?php $s_ref = $HTTP_POST_VARS["Reference"]; // Reference $s_trg = $HTTP_POST_VARS["Trigger"]; // trigger $s_shc = $HTTP_POST_VARS["Shortcode"]; // shortcode $s_pho = $HTTP_POST_VARS["MSISDN"]; // MSISDN $s_con = $HTTP_POST_VARS["Content"]; // Content $s_chn = $HTTP_POST_VARS["Channel"]; // Channel $s_pay = $HTTP_POST_VARS["DataType"]; // Data Type $s_dat = $HTTP_POST_VARS["DateReceived"]; // Date Received $s_cam = $HTTP_POST_VARS["CampaignID"]; // CampaignID $b_IsValid = getValidateRequest($s_ref, $s_trg, $s_shc, $s_pho, $s_con, $s_cam, $s_chn, $s_pay, $s_dat); if ($b_IsValid) { $s_ResponseCode = "success"; } else { $s_ResponseCode = "fail"; } exit($s_ResponseCode); /*******************************************************************************/ function getValidateRequest ($s_req_ref, $s_req_trg, $s_req_shc, $s_req_pho, $s_req_con, $s_req_cam, $s_req_chn, $s_req_pay, $s_req_dat) { /* * Stub function to be replaced with whatever process is needed to * process/validate request from server by specific client requirements. */ return(true); } ?> lastly <?php $s_ref = $HTTP_POST_VARS["Reference"]; // Reference $s_sta = $HTTP_POST_VARS["Status"]; // Status $s_dat = $HTTP_POST_VARS["DateDelivered"]; // Date Delivered $b_IsValid = getValidateReceipt($s_ref, $s_sta, $s_dat); if ($b_IsValid) { $s_ResponseCode = "success"; } else { $s_ResponseCode = "fail"; } exit($s_ResponseCode); /*******************************************************************************/ function getValidateReceipt ($s_req_ref, $s_req_sta, $s_req_dat) { /* * Stub function to be replaced with whatever process is needed to * process/validate receipts from server by specific client requirements. */ return(true); } ?> Thank you very much in advance Regards Greg

    Read the article

  • Php what does <<< mean ?

    - by Doodle
    In the following code from http://us2.php.net/manual/en/language.oop5.properties.php what does the <<< symbol mean? <?php class SimpleClass { // invalid property declarations: public $var1 = 'hello ' . 'world'; public $var2 = <<<EOD hello world EOD; public $var3 = 1+2; public $var4 = self::myStaticMethod(); public $var5 = $myVar; // valid property declarations: public $var6 = myConstant; public $var7 = array(true, false); // This is allowed only in PHP 5.3.0 and later. public $var8 = <<<'EOD' hello world EOD; } ?>

    Read the article

  • Uploading a picture to a album using the graph api

    - by kielie
    Hi guys, I am trying to upload an image to a album, but it's not working, here is the code I am using, $uid = $facebook->getUser(); $args = array('message' => $uid); $file_path = "http://www.site.com/path/to/file.jpg"; $album_id = '1234'; $args['name'] = '@' . realpath($file_path); $data = $facebook->api('/'. $album_id . '/photos', 'post', $args); print_r($data); This code is in a function.php file that gets called when a user clicks on a button inside of a flash file that is embedded on my canvas, so basically what I want it to do is, when the flash takes a screen shot and passes the variable "image" to the function, it should upload $_GET['image'] to the album. How could I go about doing this? Thanx in advance!

    Read the article

  • C# BinarySearch breaks when inheriting from something that implements IComparable<T>?

    - by Ender
    In .NET the BinarySearch algorithm (in Lists, Arrays, etc.) appears to fail if the items you are trying to search inherit from an IComparable instead of implementing it directly: List<B> foo = new List<B>(); // B inherits from A, which implements IComparable<A> foo.Add(new B()); foo.BinarySearch(new B()); // InvalidOperationException, "Failed to compare two elements in the array." Where: public abstract class A : IComparable<A> { public int x; public int CompareTo(A other) { return x.CompareTo(other.x); } } public class B : A {} Is there a way around this? Implementing CompareTo(B other) in class B doesn't seem to work.

    Read the article

  • how to use a pear package!?

    - by Naughty.Coder
    I want to use HTTP_DOWNLOAD to manage my downloads ,, I have never used PEAR before !! HTTP_DOWNLOAD depends on many other packages , I downloaded them and the ones they , in turn , depend on and this is the structure I made : Download.PHP <---HTTP_DOWNLOAD MAIN FILE Header.php <--- HTTP_HEADER MAIN FILE PEAR.php PEAR5.php Type.php <--- MIME_Type >Type <---- FOLDER - Extension.php MIME_Type File - Parameter.php MIME_Type File assuming that Http_DOWNLOAD depends on : * PHP 4.2.0 * PEAR 1.4.0b1 * PEAR * HTTP_Header * pcre extension * Archive_Tar (Optional) * Archive_Zip (Optional) * MIME_Type (Optional) * mime_magic extension (Optional) * pgsql extension (Optional) and I edited the paths inside each file to reflect this structure , and I tried to run the following code : <?php require_once 'Download.php'; $params = array('file'=>'file.zip'); $down = new HTTP_Download($params); $down->send(true); ?> nothing happens !! I also got a hard time trying to figure how to use the class and I think this code should work .. but not sure ! Help Please !

    Read the article

  • Prototype to JQuery - how to access originator of event

    - by ciaranarcher
    Hi there I'm coming from a Prototype background and looking into JQuery. I'd like to know the 'right' way to do attach a click event to a bunch of elements, but then know in the event handler which one of my elements was clicked. I've come up with the following: MYNS.CarouselHelper.prototype.attachImgHandlers = function () { $j(".carouselItem").bind("click", this, function(e){ e.data.openCarouselImage(e) }); } I then have the following in my event handler: MYNS.CarouselHelper.prototype.openCarouselImage = function(e) { var img = e.currentTarget; // Do stuff to the image element }; Is this 'right'? It feels wrong to me as I am used to explicitly passing the element to the event handler in Prototype as I loop through an array of elements. Thanks in advance.

    Read the article

  • "[object Object]" passed instead of the actual object as parameter

    - by Andrew Latham
    I am using Heroku with a Ruby on Rails application, and running from Safari. I have the following Ajax call: $.ajax({ type : 'POST', url : '/test_page', data : {stuff: arr1}, dataType : 'script' }); arr1 is supposed to be an array of objects. There's a console.log right before that, and it is: [Object, Object, Object, Object, Object, ...] However, I got an error on the server side when I made this ajax call. The logs showed 2012-10-01T03:13:34+00:00 app[web.1]: Parameters: {"stuff"=>"[object Object]"} 2012-10-01T03:13:34+00:00 app[web.1]: WARNING: Can't verify CSRF token authenticity 2012-10-01T03:13:34+00:00 app[web.1]: NoMethodError (undefined method `to_hash' for "[object Object]":String): 2012-10-01T03:13:34+00:00 app[web.1]: Completed 500 Internal Server Error in 1ms I'm unable to replicate the error. It's really confusing to me - what would cause that string to sometimes be passed to the server instead of the object?

    Read the article

< Previous Page | 497 498 499 500 501 502 503 504 505 506 507 508  | Next Page >