Search Results

Search found 1294 results on 52 pages for 'hs err'.

Page 51/52 | < Previous Page | 47 48 49 50 51 52  | Next Page >

  • Hard Disk DRDY error: is it a crash

    - by pranjal
    I am using IBM Thinkpad, 1.7GHz, 512 RAM with Linux Mint 9 installed. I have two partitions in addition to root. One of the partitions became read-only yesterday, after which I rebooted my system. It is extremely slow along with DRDY Error : Is my Hard disk crashed ? Error Log while booting. Differences between boot sector and its backup. failed command : READ DMA BMDMA : stat 0X25 ata 1.00 : status : { DRDY ERR } ata 1.00 : status :{ UNC } Buffer I/O error on logical device, logical block 65467 smartctl output for the partition: mint mint # smartctl -a /dev/sda1 smartctl version 5.38 [i686-pc-linux-gnu] Copyright (C) 2002-8 Bruce Allen Home page is http://smartmontools.sourceforge.net/ === START OF INFORMATION SECTION === Device Model: TOSHIBA MK4026GAX RoHS Serial Number: X5LY1623T Firmware Version: PA107E User Capacity: 40,007,761,920 bytes Device is: Not in smartctl database [for details use: -P showall] ATA Version is: 6 ATA Standard is: Exact ATA specification draft version not indicated Local Time is: Thu Feb 17 06:48:25 2011 UTC SMART support is: Available - device has SMART capability. SMART support is: Enabled === START OF READ SMART DATA SECTION === SMART overall-health self-assessment test result: PASSED General SMART Values: Offline data collection status: (0x84) Offline data collection activity was suspended by an interrupting command from host. Auto Offline Data Collection: Enabled. Self-test execution status: ( 0) The previous self-test routine completed without error or no self-test has ever been run. Total time to complete Offline data collection: ( 153) seconds. Offline data collection capabilities: (0x1b) SMART execute Offline immediate. Auto Offline data collection on/off support. Suspend Offline collection upon new command. Offline surface scan supported. Self-test supported. No Conveyance Self-test supported. No Selective Self-test supported. SMART capabilities: (0x0003) Saves SMART data before entering power-saving mode. Supports SMART auto save timer. Error logging capability: (0x01) Error logging supported. No General Purpose Logging support. Short self-test routine recommended polling time: ( 2) minutes. Extended self-test routine recommended polling time: ( 30) minutes. SMART Attributes Data Structure revision number: 16 Vendor Specific SMART Attributes with Thresholds: ID# ATTRIBUTE_NAME FLAG VALUE WORST THRESH TYPE UPDATED WHEN_FAILED RAW_VALUE 1 Raw_Read_Error_Rate 0x000b 100 100 050 Pre-fail Always - 0 2 Throughput_Performance 0x0005 100 100 050 Pre-fail Offline - 0 3 Spin_Up_Time 0x0027 100 100 001 Pre-fail Always - 310 4 Start_Stop_Count 0x0032 100 100 000 Old_age Always - 3968 5 Reallocated_Sector_Ct 0x0033 100 100 050 Pre-fail Always - 40 7 Seek_Error_Rate 0x000b 100 100 050 Pre-fail Always - 0 8 Seek_Time_Performance 0x0005 100 100 050 Pre-fail Offline - 0 9 Power_On_Hours 0x0032 082 082 000 Old_age Always - 7257 10 Spin_Retry_Count 0x0033 179 100 030 Pre-fail Always - 0 12 Power_Cycle_Count 0x0032 100 100 000 Old_age Always - 3484 192 Power-Off_Retract_Count 0x0032 100 100 000 Old_age Always - 489 193 Load_Cycle_Count 0x0032 064 064 000 Old_age Always - 367150 194 Temperature_Celsius 0x0022 100 100 000 Old_age Always - 36 (Lifetime Min/Max 14/57) 196 Reallocated_Event_Count 0x0032 100 100 000 Old_age Always - 33 197 Current_Pending_Sector 0x0032 100 100 000 Old_age Always - 82 198 Offline_Uncorrectable 0x0030 100 100 000 Old_age Offline - 1 199 UDMA_CRC_Error_Count 0x0032 200 253 000 Old_age Always - 0 220 Disk_Shift 0x0002 100 100 000 Old_age Always - 101 222 Loaded_Hours 0x0032 085 085 000 Old_age Always - 6146 223 Load_Retry_Count 0x0032 100 100 000 Old_age Always - 0 224 Load_Friction 0x0022 100 100 000 Old_age Always - 0 226 Load-in_Time 0x0026 100 100 000 Old_age Always - 227 240 Head_Flying_Hours 0x0001 100 100 001 Pre-fail Offline - 0 SMART Error Log Version: 1 ATA Error Count: 2371 (device log contains only the most recent five errors) CR = Command Register [HEX] FR = Features Register [HEX] SC = Sector Count Register [HEX] SN = Sector Number Register [HEX] CL = Cylinder Low Register [HEX] CH = Cylinder High Register [HEX] DH = Device/Head Register [HEX] DC = Device Command Register [HEX] ER = Error register [HEX] ST = Status register [HEX] Powered_Up_Time is measured from power on, and printed as DDd+hh:mm:SS.sss where DD=days, hh=hours, mm=minutes, SS=sec, and sss=millisec. It "wraps" after 49.710 days. Error 2371 occurred at disk power-on lifetime: 7256 hours (302 days + 8 hours) When the command that caused the error occurred, the device was active or idle. After command completion occurred, registers were: ER ST SC SN CL CH DH -- -- -- -- -- -- -- 40 51 05 1a 1b 00 e0 Error: UNC 5 sectors at LBA = 0x00001b1a = 6938 Commands leading to the command that caused the error were: CR FR SC SN CL CH DH DC Powered_Up_Time Command/Feature_Name -- -- -- -- -- -- -- -- ---------------- -------------------- c8 00 05 1a 1b 00 e0 00 00:03:10.061 READ DMA f8 00 00 00 00 00 e0 00 00:03:10.061 READ NATIVE MAX ADDRESS ec 00 00 00 00 00 a0 02 00:03:10.053 IDENTIFY DEVICE ef 03 45 00 00 00 a0 02 00:03:10.053 SET FEATURES [Set transfer mode] f8 00 00 00 00 00 e0 00 00:03:10.053 READ NATIVE MAX ADDRESS Error 2370 occurred at disk power-on lifetime: 7256 hours (302 days + 8 hours) When the command that caused the error occurred, the device was active or idle. After command completion occurred, registers were: ER ST SC SN CL CH DH -- -- -- -- -- -- -- 40 51 05 1a 1b 00 e0 Error: UNC 5 sectors at LBA = 0x00001b1a = 6938 Commands leading to the command that caused the error were: CR FR SC SN CL CH DH DC Powered_Up_Time Command/Feature_Name -- -- -- -- -- -- -- -- ---------------- -------------------- c8 00 05 1a 1b 00 e0 00 00:03:03.328 READ DMA f8 00 00 00 00 00 e0 00 00:03:03.327 READ NATIVE MAX ADDRESS ec 00 00 00 00 00 a0 02 00:03:03.320 IDENTIFY DEVICE ef 03 45 00 00 00 a0 02 00:03:03.319 SET FEATURES [Set transfer mode] f8 00 00 00 00 00 e0 00 00:03:03.319 READ NATIVE MAX ADDRESS Error 2369 occurred at disk power-on lifetime: 7256 hours (302 days + 8 hours) When the command that caused the error occurred, the device was active or idle. After command completion occurred, registers were: ER ST SC SN CL CH DH -- -- -- -- -- -- -- 40 51 05 1a 1b 00 e0 Error: UNC 5 sectors at LBA = 0x00001b1a = 6938 Commands leading to the command that caused the error were: CR FR SC SN CL CH DH DC Powered_Up_Time Command/Feature_Name -- -- -- -- -- -- -- -- ---------------- -------------------- c8 00 05 1a 1b 00 e0 00 00:02:56.582 READ DMA f8 00 00 00 00 00 e0 00 00:02:56.582 READ NATIVE MAX ADDRESS ec 00 00 00 00 00 a0 02 00:02:56.574 IDENTIFY DEVICE ef 03 45 00 00 00 a0 02 00:02:56.574 SET FEATURES [Set transfer mode] f8 00 00 00 00 00 e0 00 00:02:56.574 READ NATIVE MAX ADDRESS Error 2368 occurred at disk power-on lifetime: 7256 hours (302 days + 8 hours) When the command that caused the error occurred, the device was active or idle. After command completion occurred, registers were: ER ST SC SN CL CH DH -- -- -- -- -- -- -- 40 51 05 1a 1b 00 e0 Error: UNC 5 sectors at LBA = 0x00001b1a = 6938 Commands leading to the command that caused the error were: CR FR SC SN CL CH DH DC Powered_Up_Time Command/Feature_Name -- -- -- -- -- -- -- -- ---------------- -------------------- c8 00 05 1a 1b 00 e0 00 00:02:49.809 READ DMA f8 00 00 00 00 00 e0 00 00:02:49.809 READ NATIVE MAX ADDRESS ec 00 00 00 00 00 a0 02 00:02:49.801 IDENTIFY DEVICE ef 03 45 00 00 00 a0 02 00:02:49.801 SET FEATURES [Set transfer mode] f8 00 00 00 00 00 e0 00 00:02:49.801 READ NATIVE MAX ADDRESS Error 2367 occurred at disk power-on lifetime: 7256 hours (302 days + 8 hours) When the command that caused the error occurred, the device was active or idle. After command completion occurred, registers were: ER ST SC SN CL CH DH -- -- -- -- -- -- -- 40 51 05 1a 1b 00 e0 Error: UNC 5 sectors at LBA = 0x00001b1a = 6938 Commands leading to the command that caused the error were: CR FR SC SN CL CH DH DC Powered_Up_Time Command/Feature_Name -- -- -- -- -- -- -- -- ---------------- -------------------- c8 00 05 1a 1b 00 e0 00 00:02:43.056 READ DMA f8 00 00 00 00 00 e0 00 00:02:43.056 READ NATIVE MAX ADDRESS ec 00 00 00 00 00 a0 02 00:02:43.048 IDENTIFY DEVICE ef 03 45 00 00 00 a0 02 00:02:43.048 SET FEATURES [Set transfer mode] f8 00 00 00 00 00 e0 00 00:02:43.047 READ NATIVE MAX ADDRESS SMART Self-test log structure revision number 1 No self-tests have been logged. [To run self-tests, use: smartctl -t] Device does not support Selective Self Tests/Logging Do I need to get a new Hard Disk my PC ?

    Read the article

  • IRQ problem with 2.6.32/2.6.39 kernel on Debian Squeeze x86_64

    - by MasterM
    I recently assembled a new computer so that all hardware is pretty new. Since then I've been experiencing some problem with IRQs when running Debian 6.0. On random occasions, usually after an hour or so of running I hear a beep and this shows up in dmesg: [ 3537.762795] irq 16: nobody cared (try booting with the "irqpoll" option) [ 3537.762797] Pid: 0, comm: swapper Tainted: P W O 2.6.39-2-amd64 #1 [ 3537.762798] Call Trace: [ 3537.762799] <IRQ> [<ffffffff810924d4>] ? __report_bad_irq+0x3a/0xa2 [ 3537.762803] [<ffffffff810926a4>] ? note_interrupt+0x168/0x1da [ 3537.762805] [<ffffffff81090dd4>] ? handle_irq_event_percpu+0x171/0x18f [ 3537.762807] [<ffffffff8100e0e2>] ? read_tsc+0x5/0x16 [ 3537.762809] [<ffffffff8106b8a2>] ? update_ts_time_stats+0x32/0x6b [ 3537.762810] [<ffffffff81090e26>] ? handle_irq_event+0x34/0x52 [ 3537.762812] [<ffffffff81063fb7>] ? sched_clock_idle_wakeup_event+0x12/0x1c [ 3537.762813] [<ffffffff81092df2>] ? handle_fasteoi_irq+0x82/0xa4 [ 3537.762815] [<ffffffff8100aadb>] ? handle_irq+0x1a/0x23 [ 3537.762816] [<ffffffff8100a384>] ? do_IRQ+0x45/0xaa [ 3537.762818] [<ffffffff81332c93>] ? common_interrupt+0x13/0x13 [ 3537.762818] <EOI> [<ffffffff81332c8e>] ? common_interrupt+0xe/0x13 [ 3537.762821] [<ffffffff81026800>] ? native_safe_halt+0x2/0x3 [ 3537.762829] [<ffffffffa016ed58>] ? acpi_idle_do_entry+0x39/0x62 [processor] [ 3537.762831] [<ffffffffa016edde>] ? acpi_idle_enter_c1+0x5d/0xad [processor] [ 3537.762834] [<ffffffff81261033>] ? cpuidle_idle_call+0x11f/0x1cc [ 3537.762835] [<ffffffff81008dd2>] ? cpu_idle+0xab/0xe1 [ 3537.762837] [<ffffffff8169fc60>] ? start_kernel+0x3e0/0x3eb [ 3537.762838] [<ffffffff8169f3c8>] ? x86_64_start_kernel+0x102/0x10f [ 3537.762839] handlers: [ 3537.762840] [<ffffffffa0358d5a>] (rtl8169_interrupt+0x0/0x2d7 [r8169]) [ 3537.762842] [<ffffffffa08ff2ca>] (nv_kern_isr+0x0/0x54 [nvidia]) [ 3537.762902] Disabling IRQ #16 After that Xorg either hogs on CPU or is unstable (up to hanging the system completely). When I restart Xorg everything is fine again and the problem doesn't occur until next reboot. I tried to upgrade the kernel from stock 2.6.32 to 2.6.39 from unstable repository but that didn't help. Booting with irqpoll option only seems to prolong the initial time period after which the problem occurs. I'm using latest NVIDIA drivers and Realtek firmware from firmware-realtek package. I have two GTX 560Ti that run in SLI. Disabling SLI or taking out one card completely doesn't solve the problem either. Output of uname -a is: Linux whitestar 2.6.39-2-amd64 #1 SMP Wed Jun 8 11:01:04 UTC 2011 x86_64 GNU/Linux Output of lspci is: 00:00.0 Host bridge: Intel Corporation Sandy Bridge DRAM Controller (rev 09) 00:01.0 PCI bridge: Intel Corporation Sandy Bridge PCI Express Root Port (rev 09) 00:01.1 PCI bridge: Intel Corporation Sandy Bridge PCI Express Root Port (rev 09) 00:16.0 Communication controller: Intel Corporation Cougar Point HECI Controller #1 (rev 04) 00:19.0 Ethernet controller: Intel Corporation 82579V Gigabit Network Connection (rev 05) 00:1a.0 USB Controller: Intel Corporation Cougar Point USB Enhanced Host Controller #2 (rev 05) 00:1b.0 Audio device: Intel Corporation Cougar Point High Definition Audio Controller (rev 05) 00:1c.0 PCI bridge: Intel Corporation Cougar Point PCI Express Root Port 1 (rev b5) 00:1c.1 PCI bridge: Intel Corporation Cougar Point PCI Express Root Port 2 (rev b5) 00:1c.2 PCI bridge: Intel Corporation Cougar Point PCI Express Root Port 3 (rev b5) 00:1c.4 PCI bridge: Intel Corporation Cougar Point PCI Express Root Port 5 (rev b5) 00:1c.6 PCI bridge: Intel Corporation 82801 PCI Bridge (rev b5) 00:1d.0 USB Controller: Intel Corporation Cougar Point USB Enhanced Host Controller #1 (rev 05) 00:1f.0 ISA bridge: Intel Corporation Cougar Point LPC Controller (rev 05) 00:1f.2 SATA controller: Intel Corporation Cougar Point 6 port SATA AHCI Controller (rev 05) 00:1f.3 SMBus: Intel Corporation Cougar Point SMBus Controller (rev 05) 01:00.0 VGA compatible controller: nVidia Corporation Device 1200 (rev a1) 01:00.1 Audio device: nVidia Corporation Device 0e0c (rev a1) 02:00.0 VGA compatible controller: nVidia Corporation Device 1200 (rev a1) 02:00.1 Audio device: nVidia Corporation Device 0e0c (rev a1) 04:00.0 USB Controller: NEC Corporation uPD720200 USB 3.0 Host Controller (rev 04) 06:00.0 USB Controller: NEC Corporation uPD720200 USB 3.0 Host Controller (rev 04) 07:00.0 PCI bridge: Device 1b21:1080 (rev 01) 08:02.0 Ethernet controller: Realtek Semiconductor Co., Ltd. RTL-8110SC/8169SC Gigabit Ethernet (rev 10) 08:03.0 FireWire (IEEE 1394): VIA Technologies, Inc. VT6306/7/8 [Fire II(M)] IEEE 1394 OHCI Controller (rev c0) Contents of /proc/interrupts: CPU0 CPU1 CPU2 CPU3 CPU4 CPU5 CPU6 CPU7 0: 77 0 0 0 0 0 0 0 IO-APIC-edge timer 1: 2 0 0 0 0 0 0 0 IO-APIC-edge i8042 8: 1 0 0 0 0 0 0 0 IO-APIC-edge rtc0 9: 0 0 0 0 0 0 0 0 IO-APIC-fasteoi acpi 12: 4 0 0 0 0 0 0 0 IO-APIC-edge i8042 16: 699083 0 0 0 0 0 0 0 IO-APIC-fasteoi nvidia, eth0 17: 87810 0 0 0 0 0 0 0 IO-APIC-fasteoi firewire_ohci, hda_intel, nvidia 18: 242 0 0 0 0 0 0 0 IO-APIC-fasteoi hda_intel 23: 85925 0 0 0 0 0 0 0 IO-APIC-fasteoi ehci_hcd:usb5, ehci_hcd:usb6 40: 0 0 0 0 0 0 0 0 PCI-MSI-edge PCIe PME 41: 0 0 0 0 0 0 0 0 PCI-MSI-edge PCIe PME 42: 0 0 0 0 0 0 0 0 PCI-MSI-edge PCIe PME 43: 0 0 0 0 0 0 0 0 PCI-MSI-edge PCIe PME 44: 0 0 0 0 0 0 0 0 PCI-MSI-edge PCIe PME 45: 0 0 0 0 0 0 0 0 PCI-MSI-edge PCIe PME 46: 79853 0 0 0 0 0 0 0 PCI-MSI-edge ahci 48: 1 0 0 0 0 0 0 0 PCI-MSI-edge xhci_hcd 49: 0 0 0 0 0 0 0 0 PCI-MSI-edge xhci_hcd 50: 0 0 0 0 0 0 0 0 PCI-MSI-edge xhci_hcd 51: 0 0 0 0 0 0 0 0 PCI-MSI-edge xhci_hcd 52: 0 0 0 0 0 0 0 0 PCI-MSI-edge xhci_hcd 53: 0 0 0 0 0 0 0 0 PCI-MSI-edge xhci_hcd 54: 0 0 0 0 0 0 0 0 PCI-MSI-edge xhci_hcd 55: 0 0 0 0 0 0 0 0 PCI-MSI-edge xhci_hcd 56: 1 0 0 0 0 0 0 0 PCI-MSI-edge xhci_hcd 57: 0 0 0 0 0 0 0 0 PCI-MSI-edge xhci_hcd 58: 0 0 0 0 0 0 0 0 PCI-MSI-edge xhci_hcd 59: 0 0 0 0 0 0 0 0 PCI-MSI-edge xhci_hcd 60: 0 0 0 0 0 0 0 0 PCI-MSI-edge xhci_hcd 61: 0 0 0 0 0 0 0 0 PCI-MSI-edge xhci_hcd 62: 0 0 0 0 0 0 0 0 PCI-MSI-edge xhci_hcd 63: 0 0 0 0 0 0 0 0 PCI-MSI-edge xhci_hcd 64: 173506 0 0 0 0 0 0 0 PCI-MSI-edge hda_intel NMI: 482 89 25 13 277 24 11 10 Non-maskable interrupts LOC: 783857 194752 114133 70577 372438 179065 117179 162016 Local timer interrupts SPU: 0 0 0 0 0 0 0 0 Spurious interrupts PMI: 482 89 25 13 277 24 11 10 Performance monitoring interrupts IWI: 0 0 0 0 0 0 0 0 IRQ work interrupts RES: 131917 46750 7432 3291 150003 9576 3435 3067 Rescheduling interrupts CAL: 2759 6563 7150 6997 5387 7140 7269 6678 Function call interrupts TLB: 4396 2038 1336 492 5434 1896 1121 606 TLB shootdowns TRM: 0 0 0 0 0 0 0 0 Thermal event interrupts THR: 0 0 0 0 0 0 0 0 Threshold APIC interrupts MCE: 0 0 0 0 0 0 0 0 Machine check exceptions MCP: 37 37 37 37 37 37 37 37 Machine check polls ERR: 0 MIS: 0 Last but not least, right after boot-up those lines are usually present in dmesg: [ 18.367094] hda-intel: IRQ timing workaround is activated for card #1. Suggest a bigger bdl_pos_adj. [ 18.458859] hda-intel: IRQ timing workaround is activated for card #2. Suggest a bigger bdl_pos_adj. I'm not sure if it's related or a symptom of a bigger problem so I'm posting it just in case. I don't really know what other information might be of relevance here. Don't hesitate to ask for more in the comments.

    Read the article

  • More interruptions than cpu context switches

    - by Christopher Valles
    I have a machine running Debian GNU/Linux 5.0.8 (lenny) 8 cores and 12Gb of RAM. We have one core permanently around 40% ~ 60% wait time and trying to spot what is happening I realized that we have more interruptions than cpu context switches. I found that the normal ratio between context switch and interruptions is around 10x more context switching than interruptions but on my server the values are completely different. backend1:~# vmstat -s 12330788 K total memory 12221676 K used memory 3668624 K active memory 6121724 K inactive memory 109112 K free memory 3929400 K buffer memory 4095536 K swap cache 4194296 K total swap 7988 K used swap 4186308 K free swap 44547459 non-nice user cpu ticks 702408 nice user cpu ticks 13346333 system cpu ticks 1607583668 idle cpu ticks 374043393 IO-wait cpu ticks 4144149 IRQ cpu ticks 3994255 softirq cpu ticks 0 stolen cpu ticks 4445557114 pages paged in 2910596714 pages paged out 128642 pages swapped in 267400 pages swapped out 3519307319 interrupts 2464686911 CPU context switches 1306744317 boot time 11555115 forks Any ideas if that is an issue? And in that case, how can I spot the cause and fix it? Update Following the instructions of the comments and focusing on the core stuck in wait I checked the processes attached to that core and below you can find the list: PID USER PR NI VIRT RES SHR S %CPU %MEM TIME+ P COMMAND 24 root RT -5 0 0 0 S 0 0.0 0:03.42 7 migration/7 25 root 15 -5 0 0 0 S 0 0.0 0:04.78 7 ksoftirqd/7 26 root RT -5 0 0 0 S 0 0.0 0:00.00 7 watchdog/7 34 root 15 -5 0 0 0 S 0 0.0 1:18.90 7 events/7 83 root 15 -5 0 0 0 S 0 0.0 1:10.68 7 kblockd/7 291 root 15 -5 0 0 0 S 0 0.0 0:00.00 7 aio/7 569 root 15 -5 0 0 0 S 0 0.0 0:00.00 7 ata/7 1545 root 15 -5 0 0 0 S 0 0.0 0:00.00 7 ksnapd 1644 root 15 -5 0 0 0 S 0 0.0 0:36.73 7 kjournald 1725 root 16 -4 16940 1152 488 S 0 0.0 0:00.00 7 udevd 2342 root 20 0 8828 1140 956 S 0 0.0 0:00.00 7 sh 2375 root 20 0 8848 1220 1016 S 0 0.0 0:00.00 7 locate 2421 root 30 10 8896 1268 1016 S 0 0.0 0:00.00 7 updatedb.findut 2430 root 30 10 58272 49m 616 S 0 0.4 0:17.44 7 sort 2431 root 30 10 3792 448 360 S 0 0.0 0:00.00 7 frcode 2682 root 15 -5 0 0 0 S 0 0.0 3:25.98 7 kjournald 2683 root 15 -5 0 0 0 S 0 0.0 0:00.64 7 kjournald 2687 root 15 -5 0 0 0 S 0 0.0 1:31.30 7 kjournald 3261 root 15 -5 0 0 0 S 0 0.0 2:30.56 7 kondemand/7 3364 root 20 0 3796 596 476 S 0 0.0 0:00.00 7 acpid 3575 root 20 0 8828 1140 956 S 0 0.0 0:00.00 7 sh 3597 root 20 0 8848 1216 1016 S 0 0.0 0:00.00 7 locate 3603 root 30 10 8896 1268 1016 S 0 0.0 0:00.00 7 updatedb.findut 3612 root 30 10 58272 49m 616 S 0 0.4 0:27.04 7 sort 3655 root 20 0 11056 2852 516 S 0 0.0 5:36.46 7 redis-server 3706 root 20 0 19832 1056 816 S 0 0.0 0:01.64 7 cron 3746 root 20 0 3796 580 484 S 0 0.0 0:00.00 7 getty 3748 root 20 0 3796 580 484 S 0 0.0 0:00.00 7 getty 7674 root 20 0 28376 1000 736 S 0 0.0 0:00.00 7 cron 7675 root 20 0 8828 1140 956 S 0 0.0 0:00.00 7 sh 7708 root 30 10 58272 49m 616 S 0 0.4 0:03.36 7 sort 22049 root 20 0 8828 1136 956 S 0 0.0 0:00.00 7 sh 22095 root 20 0 8848 1220 1016 S 0 0.0 0:00.00 7 locate 22099 root 30 10 8896 1264 1016 S 0 0.0 0:00.00 7 updatedb.findut 22108 root 30 10 58272 49m 616 S 0 0.4 0:44.55 7 sort 22109 root 30 10 3792 452 360 S 0 0.0 0:00.00 7 frcode 26927 root 20 0 8828 1140 956 S 0 0.0 0:00.00 7 sh 26947 root 20 0 8848 1216 1016 S 0 0.0 0:00.00 7 locate 26951 root 30 10 8896 1268 1016 S 0 0.0 0:00.00 7 updatedb.findut 26960 root 30 10 58272 49m 616 S 0 0.4 0:10.24 7 sort 26961 root 30 10 3792 452 360 S 0 0.0 0:00.00 7 frcode 27952 root 20 0 65948 3028 2400 S 0 0.0 0:00.00 7 sshd 30731 root 20 0 0 0 0 S 0 0.0 0:01.34 7 pdflush 31204 root 20 0 0 0 0 S 0 0.0 0:00.24 7 pdflush 21857 deploy 20 0 1227m 2240 868 S 0 0.0 2:44.22 7 nginx 21858 deploy 20 0 1228m 2784 868 S 0 0.0 2:42.45 7 nginx 21862 deploy 20 0 1228m 2732 868 S 0 0.0 2:43.90 7 nginx 21869 deploy 20 0 1228m 2840 868 S 0 0.0 2:44.14 7 nginx 27994 deploy 20 0 19372 2216 1380 S 0 0.0 0:00.00 7 bash 28493 deploy 20 0 331m 32m 16m S 4 0.3 0:00.40 7 apache2 21856 deploy 20 0 1228m 2844 868 S 0 0.0 2:43.64 7 nginx 3622 nobody 30 10 21156 10m 916 D 0 0.1 4:42.31 7 find 7716 nobody 30 10 12268 1280 888 D 0 0.0 0:43.50 7 find 22116 nobody 30 10 12612 1696 916 D 0 0.0 6:32.26 7 find 26968 nobody 30 10 12268 1284 888 D 0 0.0 1:56.92 7 find Update As suggested I take a look at /proc/interrupts and below the info there: CPU0 CPU1 CPU2 CPU3 CPU4 CPU5 CPU6 CPU7 0: 35 0 0 1469085485 0 0 0 0 IO-APIC-edge timer 1: 0 0 0 8 0 0 0 0 IO-APIC-edge i8042 8: 0 0 0 1 0 0 0 0 IO-APIC-edge rtc0 9: 0 0 0 0 0 0 0 0 IO-APIC-fasteoi acpi 12: 0 0 0 105 0 0 0 0 IO-APIC-edge i8042 16: 0 0 0 0 0 0 0 580212114 IO-APIC-fasteoi 3w-9xxx, uhci_hcd:usb1 18: 0 0 142 0 0 0 0 0 IO-APIC-fasteoi uhci_hcd:usb6, ehci_hcd:usb7 19: 9 0 0 0 0 0 0 0 IO-APIC-fasteoi uhci_hcd:usb3, uhci_hcd:usb5 21: 0 0 0 0 0 0 0 0 IO-APIC-fasteoi uhci_hcd:usb2 23: 0 0 0 0 0 0 0 0 IO-APIC-fasteoi uhci_hcd:usb4, ehci_hcd:usb8 1273: 0 0 1600400502 0 0 0 0 0 PCI-MSI-edge eth0 1274: 0 0 0 0 0 0 0 0 PCI-MSI-edge ahci NMI: 0 0 0 0 0 0 0 0 Non-maskable interrupts LOC: 214252181 69439018 317298553 21943690 72562482 56448835 137923978 407514738 Local timer interrupts RES: 27516446 16935944 26430972 44957009 24935543 19881887 57746906 24298747 Rescheduling interrupts CAL: 10655 10705 10685 10567 10689 10669 10667 396 function call interrupts TLB: 529548 462587 801138 596193 922202 747313 2027966 946594 TLB shootdowns TRM: 0 0 0 0 0 0 0 0 Thermal event interrupts THR: 0 0 0 0 0 0 0 0 Threshold APIC interrupts SPU: 0 0 0 0 0 0 0 0 Spurious interrupts ERR: 0 All the values seems more or less the same for all the cores but this one IO-APIC-fasteoi 3w-9xxx, uhci_hcd:usb1 only affects to the core 7 (the same with the wait time of 40% ~ 60%) could be something attached to the usb port causing the issue? Thanks in advanced

    Read the article

  • Mandatory profile on Terminal server fails to load. Userenv.log debug

    - by Datapimp23
    Hi, We're having a lot of corrupted profiles lately on our profile share. At the moment I have no clue why, but I decided to switch to one mandatory profile since the users can all use the same and there is no need to have seperate profiles for each user. Here's what I did. I logged into the Terminal server with a new user and configured some stuff (imported certificates and a few files). Then I logged out. Later as admin I copied the profile to another server and renamed it to bsilo. I made sure the user hive settings were adjusted. Everyone had access to the hive. I shared the bsilo folder with full access for everyone. I set the NTFS permissions to read, read & execute, list folder contents for domain users. I also renamed NTUSER.DAT to NTUSER.MAN. Now I set a env variable %manprofile% on the Terminal server that points to \server\bsilo\ntuser.man I set the env var as terminal services profile path for a test user. When I log in I as the user get the following output The system cannot find the path specified. Can somebody point me in the right direction. Thanks USERENV(1774.d18) 15:52:39:724 InitializePolicyProcessing: Initialised Machine Mutex/Events USERENV(1774.d18) 15:52:39:724 InitializePolicyProcessing: Initialised User Mutex/Events USERENV(1774.d18) 15:52:39:724 LibMain: Process Name: \??\C:\WINDOWS\system32\winlogon.exe USERENV(1774.d18) 15:52:48:005 LoadUserProfile: Yes, we can impersonate the user. Running as self USERENV(1774.d18) 15:52:48:005 ========================================================= USERENV(1774.d18) 15:52:48:005 LoadUserProfile: Entering, hToken = <0x340, lpProfileInfo = 0x6e5d8 USERENV(1774.d18) 15:52:48:005 LoadUserProfile: lpProfileInfo-dwFlags = <0x0 USERENV(1774.d18) 15:52:48:005 LoadUserProfile: lpProfileInfo-lpUserName = USERENV(1774.d18) 15:52:48:005 LoadUserProfile: lpProfileInfo-lpProfilePath = <\server\bsilo\ntuser.man USERENV(1774.d18) 15:52:48:005 LoadUserProfile: lpProfileInfo-lpDefaultPath = <\BDPINF5\netlogon\Default User USERENV(1774.d18) 15:52:48:005 LoadUserProfile: NULL server name USERENV(1774.d18) 15:52:48:005 LoadUserProfile: no thread token found, impersonating self. USERENV(1774.d18) 15:52:48:005 GetInterface: Returning rpc binding handle USERENV(218.2f94) 15:52:48:005 IProfileSecurityCallBack: client authenticated. USERENV(218.2f94) 15:52:48:005 DropClientContext: Got client token 000009B4, sid = S-1-5-18 USERENV(218.2f94) 15:52:48:005 MIDL_user_allocate enter USERENV(218.2f94) 15:52:48:005 DropClientContext: load profile object successfully made USERENV(218.2f94) 15:52:48:005 DropClientContext: Returning 0 USERENV(1774.d18) 15:52:48:005 LoadUserProfile: Calling DropClientToken (as self) succeeded USERENV(1774.d18) 15:52:48:005 CProfileDialog::Initialize : Cookie generated USERENV(1774.d18) 15:52:48:005 CProfileDialog::Initialize : Endpoint generated USERENV(218.1f38) 15:52:48:005 IProfileSecurityCallBack: client authenticated. USERENV(218.1f38) 15:52:48:020 LoadUserProfileI: RPC end point IProfileDialog_9D36D6DD48F0578A2A41B23D7A982E63 USERENV(218.1f38) 15:52:48:020 In LoadUserProfileP USERENV(218.1f38) 15:52:48:020 LoadUserProfile: Running as client, sid = S-1-5-18 USERENV(218.1f38) 15:52:48:020 ========================================================= USERENV(218.1f38) 15:52:48:020 LoadUserProfile: Entering, hToken = <0x98c, lpProfileInfo = 0x9c940 USERENV(218.1f38) 15:52:48:020 LoadUserProfile: lpProfileInfo-dwFlags = <0x0 USERENV(218.1f38) 15:52:48:020 LoadUserProfile: lpProfileInfo-lpUserName = USERENV(218.1f38) 15:52:48:020 LoadUserProfile: lpProfileInfo-lpProfilePath = <\server\bsilo\ntuser.man USERENV(218.1f38) 15:52:48:020 LoadUserProfile: lpProfileInfo-lpDefaultPath = <\BDPINF5\netlogon\Default User USERENV(218.1f38) 15:52:48:020 LoadUserProfile: NULL server name USERENV(218.1f38) 15:52:48:020 LoadUserProfile: User sid: S-1-5-21-807756564-1922302612-1565739477-22627 USERENV(218.1f38) 15:52:48:020 CSyncManager::EnterLock USERENV(218.1f38) 15:52:48:020 CSyncManager::EnterLock: No existing entry found USERENV(218.1f38) 15:52:48:020 CSyncManager::EnterLock: New entry created USERENV(218.1f38) 15:52:48:020 CHashTable::HashAdd: S-1-5-21-807756564-1922302612-1565739477-22627 added in bucket 11 USERENV(218.1f38) 15:52:48:020 LoadUserProfile: Wait succeeded. In critical section. USERENV(218.1f38) 15:52:48:864 GetOldSidString: Failed to open profile profile guid key with error 2 USERENV(218.1f38) 15:52:48:864 GetProfileSid: No Guid - Sid Mapping available USERENV(218.1f38) 15:52:48:864 TestIfUserProfileLoaded: return with error 2. USERENV(218.1f38) 15:52:48:864 GetOldSidString: Failed to open profile profile guid key with error 2 USERENV(218.1f38) 15:52:48:864 GetProfileSid: No Guid - Sid Mapping available USERENV(218.1f38) 15:52:48:864 LoadUserProfile: Expanded profile path is \server\bsilo\ntuser.man USERENV(218.1f38) 15:52:48:880 ParseProfilePath: Entering, lpProfilePath = <\server\bsilo\ntuser.man USERENV(218.1f38) 15:52:48:880 CheckXForestLogon: checking x-forest logon, user handle = 2444 USERENV(218.1f38) 15:52:48:880 CheckXForestLogon: policy set to disable XForest check USERENV(218.1f38) 15:52:48:880 ParseProfilePath: Mandatory profile (.man extension) USERENV(218.1f38) 15:52:49:239 AbleToBypassCSC: Try to bypass CSC USERENV(218.1f38) 15:52:49:239 AbleToBypassCSC: tried NPAddConnection3ForCSCAgent. Error 2109 USERENV(218.1f38) 15:52:49:239 AbleToBypassCSC: Share \server\bsilo mapped to drive E. Returned Path E:\ntuser.man USERENV(218.1f38) 15:52:49:239 ParseProfilePath: CSC bypassed. Profile path E:\ntuser.man USERENV(218.1f38) 15:52:49:255 ParseProfilePath: Tick Count = 0 USERENV(218.1f38) 15:52:49:255 ParseProfilePath: GetFileAttributes found something with attributes <0x2022 USERENV(218.1f38) 15:52:49:255 ParseProfilePath: Found a file USERENV(218.1f38) 15:52:49:255 ReportError: Impersonating user. USERENV(218.1f38) 15:52:49:255 ReportError: Logging Error DETAIL - The system cannot find the path specified. USERENV(218.1f38) 15:52:49:255 GetInterface: Returning rpc binding handle USERENV(218.1f38) 15:52:49:255 ReportError: RPC End point IProfileDialog_9D36D6DD48F0578A2A41B23D7A982E63 USERENV(218.1f38) 15:52:49:255 ReportError: waiting on rpc async event USERENV(1774.2398) 15:52:49:255 ErrorDialogEx: Calling DialogBoxParam USERENV(1774.2398) 15:52:49:270 ErrorDlgProc:: DialogBoxParam USERENV(218.1f38) 15:52:52:177 RpcAsyncCompleteCall finished, status = 0 USERENV(218.1f38) 15:52:52:177 ReleaseInterface: Releasing rpc binding handle USERENV(218.1f38) 15:52:52:177 LoadUserProfile: ParseProfilePath returned FALSE USERENV(218.1f38) 15:52:52:177 CancelCSCBypassedConnection: Cancelling connection of E: USERENV(218.1f38) 15:52:52:177 CancelCSCBypassedConnection: Connection deleted. USERENV(218.1f38) 15:52:52:177 CSyncManager::LeaveLock USERENV(218.1f38) 15:52:52:192 CSyncManager::LeaveLock: Lock released USERENV(218.1f38) 15:52:52:192 CHashTable::HashDelete: S-1-5-21-807756564-1922302612-1565739477-22627 deleted USERENV(218.1f38) 15:52:52:192 CSyncManager::LeaveLock: Lock deleted USERENV(218.1f38) 15:52:52:192 LoadUserProfile: 003 About Reverted back to user <00000000 USERENV(218.1f38) 15:52:52:192 LoadUserProfile: Leaving with a value of 0. USERENV(218.1f38) 15:52:52:192 ========================================================= USERENV(218.1f38) 15:52:52:192 LoadUserProfileI: LoadUserProfileP failed with 3 USERENV(218.1f38) 15:52:52:192 LoadUserProfileI: returning 3 USERENV(1774.d18) 15:52:52:192 LoadUserProfile: Running as self USERENV(1774.d18) 15:52:52:192 LoadUserProfile: Calling LoadUserProfileI failed. err = 3 USERENV(218.200c) 15:52:52:192 IProfileSecurityCallBack: client authenticated. USERENV(218.200c) 15:52:52:192 ReleaseClientContext: Releasing context USERENV(218.200c) 15:52:52:192 ReleaseClientContext_s: Releasing context USERENV(218.200c) 15:52:52:192 MIDL_user_free enter USERENV(1774.d18) 15:52:52:192 ReleaseInterface: Releasing rpc binding handle USERENV(1774.d18) 15:52:52:192 LoadUserProfile: Returning FALSE. Error = 3

    Read the article

  • How to display different value with ComboBoxTableCell?

    - by Philippe Jean
    I try to use ComboxBoxTableCell without success. The content of the cell display the right value for the attribute of an object. But when the combobox is displayed, all items are displayed with the toString object method and not the attribute. I tryed to override updateItem of ComboBoxTableCell or to provide a StringConverter but nothing works. Do you have some ideas to custom comboxbox list display in a table cell ? I put a short example below to see quickly the problem. Execute the app and click in the cell, you will see the combobox with toString value of the object. package javafx2; import javafx.application.Application; import javafx.beans.property.adapter.JavaBeanObjectPropertyBuilder; import javafx.beans.value.ObservableValue; import javafx.collections.FXCollections; import javafx.collections.ObservableList; import javafx.scene.Scene; import javafx.scene.control.TableCell; import javafx.scene.control.TableColumn; import javafx.scene.control.TableColumn.CellDataFeatures; import javafx.scene.control.TableView; import javafx.scene.control.cell.ComboBoxTableCell; import javafx.stage.Stage; import javafx.util.Callback; import javafx.util.StringConverter; public class ComboBoxTableCellTest extends Application { public class Product { private String name; public Product(String name) { this.name = name; } public String getName() { return name; } public void setName(String name) { this.name = name; } } public class Command { private Integer quantite; private Product product; public Command(Product product, Integer quantite) { this.product = product; this.quantite = quantite; } public Integer getQuantite() { return quantite; } public void setQuantite(Integer quantite) { this.quantite = quantite; } public Product getProduct() { return product; } public void setProduct(Product product) { this.product = product; } } public static void main(String[] args) { launch(args); } @Override public void start(Stage stage) throws Exception { Product p1 = new Product("Product 1"); Product p2 = new Product("Product 2"); final ObservableList<Product> products = FXCollections.observableArrayList(p1, p2); ObservableList<Command> commands = FXCollections.observableArrayList(new Command(p1, 20)); TableView<Command> tv = new TableView<Command>(); tv.setItems(commands); TableColumn<Command, Product> tc = new TableColumn<Command, Product>("Product"); tc.setMinWidth(140); tc.setCellValueFactory(new Callback<TableColumn.CellDataFeatures<Command,Product>, ObservableValue<Product>>() { @Override public ObservableValue<Product> call(CellDataFeatures<Command, Product> cdf) { try { JavaBeanObjectPropertyBuilder<Product> jbdpb = JavaBeanObjectPropertyBuilder.create(); jbdpb.bean(cdf.getValue()); jbdpb.name("product"); return (ObservableValue) jbdpb.build(); } catch (NoSuchMethodException e) { System.err.println(e.getMessage()); } return null; } }); final StringConverter<Product> converter = new StringConverter<ComboBoxTableCellTest.Product>() { @Override public String toString(Product p) { return p.getName(); } @Override public Product fromString(String s) { // TODO Auto-generated method stub return null; } }; tc.setCellFactory(new Callback<TableColumn<Command,Product>, TableCell<Command,Product>>() { @Override public TableCell<Command, Product> call(TableColumn<Command, Product> tc) { return new ComboBoxTableCell<Command, Product>(converter, products) { @Override public void updateItem(Product product, boolean empty) { super.updateItem(product, empty); if (product != null) { setText(product.getName()); } } }; } }); tv.getColumns().add(tc); tv.setEditable(true); Scene scene = new Scene(tv, 140, 200); stage.setScene(scene); stage.show(); } }

    Read the article

  • Java invalid stream header Problem

    - by David zsl
    Hi all, im writen a client-server app, and now i´m facing a problem that I dont know how to solve: This is the client: try { Socket socket = new Socket(ip, port); ObjectOutputStream ooos = new ObjectOutputStream(socket .getOutputStream()); SendMessage message = new SendMessage(); message.numDoc = value.numDoc; message.docFreq = value.docFreq; message.queryTerms = query; message.startIndex = startIndex; message.count = count; message.multiple = false; message.ips = null; message.ports = null; message.value = true; message.docFreq = value.docFreq; message.numDoc = value.numDoc; ooos.writeObject(message); ObjectInputStream ois = new ObjectInputStream(socket .getInputStream()); ComConstants mensajeRecibido; Object mensajeAux; String mensa = null; byte[] by = null; do { mensajeAux = ois.readObject(); if (mensajeAux instanceof ComConstants) { System.out.println("Thread by Thread has Search Results"); String test; ByteArrayOutputStream testo = new ByteArrayOutputStream(); mensajeRecibido = (ComConstants) mensajeAux; byte[] wag; testo.write( mensajeRecibido.fileContent, 0, mensajeRecibido.okBytes); wag = testo.toByteArray(); if (by == null) { by = wag; } else { int size = wag.length; System.arraycopy(wag, 0, by, 0, size); } } else { System.err.println("Mensaje no esperado " + mensajeAux.getClass().getName()); break; } } while (!mensajeRecibido.lastMessage); //ByteArrayInputStream bs = new ByteArrayInputStream(by.toByteArray()); // bytes es el byte[] ByteArrayInputStream bs = new ByteArrayInputStream(by); ObjectInputStream is = new ObjectInputStream(bs); QueryWithResult[] unObjetoSerializable = (QueryWithResult[])is.readObject(); is.close(); //AQUI TOCARIA METER EL QUICKSORT XmlConverter xce = new XmlConverter(unObjetoSerializable, startIndex, count); String serializedd = xce.runConverter(); tempFinal = serializedd; ois.close(); socket.close(); } catch (Exception e) { e.printStackTrace(); } i++; } And this is the sender: try { QueryWithResult[] outputLine; Operations op = new Operations(); boolean enviadoUltimo=false; ComConstants mensaje = new ComConstants(); mensaje.queryTerms = query; outputLine = op.processInput(query, value); //String c = new String(); //c = outputLine.toString(); //StringBuffer swa = sw.getBuffer(); ByteArrayOutputStream bs= new ByteArrayOutputStream(); ObjectOutputStream os = new ObjectOutputStream (bs); os.writeObject(outputLine); os.close(); byte[] mybytearray = bs.toByteArray(); ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(mybytearray); BufferedInputStream bis = new BufferedInputStream(byteArrayInputStream); int readed = bis.read(mensaje.fileContent,0,4000); while (readed > -1) { mensaje.okBytes = readed; if (readed < ComConstants.MAX_LENGTH) { mensaje.lastMessage = true; enviadoUltimo=true; } else mensaje.lastMessage = false; oos.writeObject(mensaje); if (mensaje.lastMessage) break; mensaje = new ComConstants(); mensaje.queryTerms = query; readed = bis.read(mensaje.fileContent); } if (enviadoUltimo==false) { mensaje.lastMessage=true; mensaje.okBytes=0; oos.writeObject(mensaje); } oos.close(); } catch (Exception e) { e.printStackTrace(); } } And this is the error log: Thread by Thread has Search Results java.io.StreamCorruptedException: invalid stream header: 20646520 at java.io.ObjectInputStream.readStreamHeader(Unknown Source) at java.io.ObjectInputStream.<init>(Unknown Source) at org.tockit.comunication.ServerThread.enviaFicheroMultiple(ServerThread.java:747) at org.tockit.comunication.ServerThread.run(ServerThread.java:129) at java.lang.Thread.run(Unknown Source) Where at org.tockit.comunication.ServerThread.enviaFicheroMultiple(ServerThread.java:747) is this line ObjectInputStream is = new ObjectInputStream(bs); on the 1st code just after while (!mensajeRecibido.lastMessage); Any ideas?

    Read the article

  • Hibernate unknown entity (not missing @Entity or import javax.persistence.Entity )

    - by david99world
    I've got a really simple class... import javax.persistence.Column; import javax.persistence.Entity; import javax.persistence.GeneratedValue; import javax.persistence.GenerationType; import javax.persistence.Id; import javax.persistence.Table; @Entity @Table(name = "users") public class User { @Column(name = "firstName") private String firstName; @Column(name = "lastName") private String lastName; @Column(name = "email") private String email; @Id @GeneratedValue(strategy=GenerationType.AUTO) @Column(name = "id") private long id; public String getFirstName() { return firstName; } public void setFirstName(String firstName) { this.firstName = firstName; } public String getLastName() { return lastName; } public void setLastName(String lastName) { this.lastName = lastName; } public String getEmail() { return email; } public void setEmail(String email) { this.email = email; } public long getId() { return id; } public void setId(long id) { this.id = id; } } I call it using... public class Main { /** * @param args */ public static void main(String[] args) { // TODO Auto-generated method stub HibernateUtil.buildSessionFactory(); Session session = HibernateUtil.getSessionFactory().getCurrentSession(); session.beginTransaction(); User u = new User(); u.setEmail("[email protected]"); u.setFirstName("David"); u.setLastName("Gray"); session.save(u); session.getTransaction().commit(); System.out.println("Record committed"); session.close(); } } I keep getting... Exception in thread "main" org.hibernate.MappingException: Unknown entity: org.assessme.com.entity.User at org.hibernate.internal.SessionFactoryImpl.getEntityPersister(SessionFactoryImpl.java:1172) at org.hibernate.internal.SessionImpl.getEntityPersister(SessionImpl.java:1316) at org.hibernate.event.internal.AbstractSaveEventListener.saveWithGeneratedId(AbstractSaveEventListener.java:117) at org.hibernate.event.internal.DefaultSaveOrUpdateEventListener.saveWithGeneratedOrRequestedId(DefaultSaveOrUpdateEventListener.java:204) at org.hibernate.event.internal.DefaultSaveEventListener.saveWithGeneratedOrRequestedId(DefaultSaveEventListener.java:55) at org.hibernate.event.internal.DefaultSaveOrUpdateEventListener.entityIsTransient(DefaultSaveOrUpdateEventListener.java:189) at org.hibernate.event.internal.DefaultSaveEventListener.performSaveOrUpdate(DefaultSaveEventListener.java:49) at org.hibernate.event.internal.DefaultSaveOrUpdateEventListener.onSaveOrUpdate(DefaultSaveOrUpdateEventListener.java:90) at org.hibernate.internal.SessionImpl.fireSave(SessionImpl.java:670) at org.hibernate.internal.SessionImpl.save(SessionImpl.java:662) at org.hibernate.internal.SessionImpl.save(SessionImpl.java:658) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:57) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:43) at java.lang.reflect.Method.invoke(Method.java:601) at org.hibernate.context.internal.ThreadLocalSessionContext$TransactionProtectionWrapper.invoke(ThreadLocalSessionContext.java:352) at $Proxy4.save(Unknown Source) at Main.main(Main.java:20) hibernateUtil is... import org.hibernate.SessionFactory; import org.hibernate.cfg.Configuration; import org.hibernate.service.ServiceRegistry; import org.hibernate.service.ServiceRegistryBuilder; public class HibernateUtil { private static SessionFactory sessionFactory; private static ServiceRegistry serviceRegistry; public static SessionFactory buildSessionFactory() { try { // Create the SessionFactory from hibernate.cfg.xml Configuration configuration = new Configuration(); configuration.configure(); serviceRegistry = new ServiceRegistryBuilder().applySettings(configuration.getProperties()).buildServiceRegistry(); return new Configuration().configure().buildSessionFactory(serviceRegistry); } catch (Throwable ex) { // Make sure you log the exception, as it might be swallowed System.err.println("Initial SessionFactory creation failed." + ex); throw new ExceptionInInitializerError(ex); } } public static SessionFactory getSessionFactory() { sessionFactory = new Configuration().configure().buildSessionFactory(serviceRegistry); return sessionFactory; } } does anyone have any ideas as I've looked at so many duplicates but the resolutions don't appear to work for me. hibernate.cfg.xml shown below... <?xml version='1.0' encoding='utf-8'?> <!DOCTYPE hibernate-configuration PUBLIC "-//Hibernate/Hibernate Configuration DTD 3.0//EN" "http://hibernate.sourceforge.net/hibernate-configuration-3.0.dtd"> <hibernate-configuration> <session-factory> <!-- Database connection settings --> <property name="connection.driver_class">com.mysql.jdbc.Driver</property> <property name="connection.url">jdbc:mysql://localhost/ssme</property> <property name="connection.username">root</property> <property name="connection.password">mypassword</property> <!-- JDBC connection pool (use the built-in) --> <property name="connection.pool_size">1</property> <!-- SQL dialect --> <property name="dialect">org.hibernate.dialect.MySQLDialect</property> <!-- Enable Hibernate's automatic session context management --> <property name="current_session_context_class">thread</property> <!-- Disable the second-level cache --> <property name="cache.provider_class">org.hibernate.cache.NoCacheProvider</property> <!-- Echo all executed SQL to stdout --> <property name="show_sql">true</property> <!-- Drop and re-create the database schema on startup --> <property name="hbm2ddl.auto">update</property> </session-factory> </hibernate-configuration>

    Read the article

  • Why does ffmpeg stop randomly in the middle of a process?

    - by acidzombie24
    ffmpeg feels like its taking a long time. I then look at my output file and i see it stops between 6 and 8mbs. A fully encoded file is about 14mb. Why does ffmpeg stop? My code locks up on StandardOutput.ReadToEnd();. I had to kill the process (after seeing it not move for more then 10 seconds when i see it update every second previously) then i get the results of stdout and err. stdout is "" stderr is below. The output msg shows the filesize ended. I also see a drop in my CPU usage when it stops. I copyed the argument from visual studios. CD to the same working directory and ran the cmd (bin/ffmpeg) and pasted the argument. It was able to complete. int soundProcess(string infn, string outfn) { string aa, aa2; aa = aa2 = "DEAD"; var app = new Process(); app.StartInfo.UseShellExecute = false; app.StartInfo.RedirectStandardOutput = true; app.StartInfo.RedirectStandardError = true; //*/ app.StartInfo.FileName = @"bin\ffmpeg.exe"; app.StartInfo.Arguments = string.Format(@"-i ""{0}"" -ab 192k -y {2} ""{1}""", infn, outfn, param); app.Start(); try { app.PriorityClass = ProcessPriorityClass.BelowNormal; } catch (Exception ex) { if (!Regex.IsMatch(ex.Message, @"Cannot process request because the process .*has exited")) throw ex; } aa = app.StandardOutput.ReadToEnd(); aa2 = app.StandardError.ReadToEnd(); app.WaitForExit(); if (aa2.IndexOf("could not find codec parameters") != -1) return 1; else if (aa == "DEAD" || aa2 == "DEAD") return -1; else if (aa2.Length != 0) return -2; else return 0; } The output of stderr. stdout is empty. FFmpeg version SVN-r15815, Copyright (c) 2000-2008 Fabrice Bellard, et al. configuration: --enable-memalign-hack --enable-postproc --enable-swscale --enable-gpl --enable-libfaac --enable-libfaad --enable-libgsm --enable-libmp3lame --enable-libvorbis --enable-libtheora --enable-libx264 --enable-libxvid --disable-ffserver --disable-vhook --enable-avisynth --enable-pthreads libavutil 49.12. 0 / 49.12. 0 libavcodec 52. 3. 0 / 52. 3. 0 libavformat 52.23. 1 / 52.23. 1 libavdevice 52. 1. 0 / 52. 1. 0 libswscale 0. 6. 1 / 0. 6. 1 libpostproc 51. 2. 0 / 51. 2. 0 built on Nov 13 2008 10:28:29, gcc: 4.2.4 (TDM-1 for MinGW) Input #0, mov,mp4,m4a,3gp,3g2,mj2, from 'C:\dev\src\trunk\prjname\prjname\App_Data/temp/m/o/6304266424778814852': Duration: 00:12:53.36, start: 0.000000, bitrate: 154 kb/s Stream #0.0(und): Audio: aac, 44100 Hz, stereo, s16 Output #0, ipod, to 'C:\dev\src\trunk\prjname\prjname\App_Data\temp\m\o\2.m4a': Stream #0.0(und): Audio: libfaac, 44100 Hz, stereo, s16, 192 kb/s Stream mapping: Stream #0.0 -> #0.0 Press [q] to stop encoding size= 87kB time=4.74 bitrate= 150.7kbits/s size= 168kB time=9.06 bitrate= 151.9kbits/s size= 265kB time=14.28 bitrate= 151.8kbits/s size= 377kB time=20.29 bitrate= 152.1kbits/s size= 487kB time=26.22 bitrate= 152.1kbits/s size= 594kB time=32.02 bitrate= 152.1kbits/s size= 699kB time=37.64 bitrate= 152.1kbits/s size= 808kB time=43.54 bitrate= 152.0kbits/s size= 930kB time=50.09 bitrate= 152.2kbits/s size= 1058kB time=57.05 bitrate= 152.0kbits/s size= 1193kB time=64.23 bitrate= 152.1kbits/s size= 1329kB time=71.63 bitrate= 152.0kbits/s size= 1450kB time=78.16 bitrate= 152.0kbits/s size= 1578kB time=85.05 bitrate= 152.0kbits/s size= 1706kB time=92.00 bitrate= 152.0kbits/s size= 1836kB time=98.94 bitrate= 152.0kbits/s size= 1971kB time=106.25 bitrate= 151.9kbits/s size= 2107kB time=113.57 bitrate= 152.0kbits/s size= 2214kB time=119.33 bitrate= 152.0kbits/s size= 2345kB time=126.39 bitrate= 152.0kbits/s size= 2479kB time=133.56 bitrate= 152.0kbits/s size= 2611kB time=140.76 bitrate= 152.0kbits/s size= 2745kB time=147.91 bitrate= 152.1kbits/s size= 2880kB time=155.20 bitrate= 152.0kbits/s size= 3013kB time=162.40 bitrate= 152.0kbits/s size= 3146kB time=169.58 bitrate= 152.0kbits/s size= 3277kB time=176.61 bitrate= 152.0kbits/s size= 3412kB time=183.90 bitrate= 152.0kbits/s size= 3540kB time=190.80 bitrate= 152.0kbits/s size= 3670kB time=197.81 bitrate= 152.0kbits/s size= 3805kB time=205.08 bitrate= 152.0kbits/s size= 3932kB time=211.93 bitrate= 152.0kbits/s size= 4052kB time=218.38 bitrate= 152.0kbits/s size= 4171kB time=224.82 bitrate= 152.0kbits/s size= 4277kB time=230.55 bitrate= 152.0kbits/s size= 4378kB time=235.96 bitrate= 152.0kbits/s size= 4486kB time=241.79 bitrate= 152.0kbits/s size= 4592kB time=247.50 bitrate= 152.0kbits/s size= 4698kB time=253.21 bitrate= 152.0kbits/s size= 4804kB time=258.95 bitrate= 152.0kbits/s size= 4906kB time=264.41 bitrate= 152.0kbits/s size= 5012kB time=270.09 bitrate= 152.0kbits/s size= 5118kB time=275.85 bitrate= 152.0kbits/s size= 5234kB time=282.10 bitrate= 152.0kbits/s size= 5331kB time=287.39 bitrate= 151.9kbits/s size= 5445kB time=293.55 bitrate= 152.0kbits/s size= 5555kB time=299.40 bitrate= 152.0kbits/s size= 5665kB time=305.37 bitrate= 152.0kbits/s size= 5766kB time=310.80 bitrate= 152.0kbits/s size= 5876kB time=316.70 bitrate= 152.0kbits/s size= 5984kB time=322.50 bitrate= 152.0kbits/s size= 6094kB time=328.49 bitrate= 152.0kbits/s size= 6212kB time=334.76 bitrate= 152.0kbits/s size= 6327kB time=340.99 bitrate= 152.0kbits/s

    Read the article

  • How to customize the renders in prefuse. Problem in customize images in prefuse layout

    - by user324926
    HI all, I have written a java application to show the images in different layouts. I am able to show it different layout correctly but some times the images are overlapped. Can you please help me, how to solve this problem. My code is given below `import javax.swing.JFrame; import java.awt.image.BufferedImage; import javax.imageio.ImageIO; import java.util.; import java.io.; import java.awt.Font; import prefuse.Constants; import prefuse.Display; import prefuse.Visualization; import prefuse.action.ActionList; import prefuse.action.RepaintAction; import prefuse.action.assignment.ColorAction; import prefuse.action.assignment.FontAction; import prefuse.action.assignment.DataColorAction; import prefuse.action.layout.graph.ForceDirectedLayout; import prefuse.action.layout.graph.; import prefuse.action.layout.; import prefuse.activity.Activity; import prefuse.controls.DragControl; import prefuse.controls.PanControl; import prefuse.controls.ZoomControl; import prefuse.data.Graph; import prefuse.data.io.DataIOException; import prefuse.data.io.GraphMLReader; import prefuse.render.DefaultRendererFactory; import prefuse.render.LabelRenderer; import prefuse.util.ColorLib; import prefuse.visual.VisualItem; import prefuse.visual.*; import prefuse.util.FontLib; import prefuse.action.assignment.DataSizeAction; import prefuse.data.*; import prefuse.render.ImageFactory; public class LayoutExample { public static void main(String[] argv) throws Exception { Graph graph = null; try { graph = new GraphMLReader().readGraph("/graphs.xml"); } catch ( DataIOException e ) { e.printStackTrace(); System.err.println("Error loading graph. Exiting..."); System.exit(1); } ImageFactory imageFactory = new ImageFactory(100,100); try { //load images and construct imageFactory. String images[] = new String[3]; images[0] = "data/images/switch.png"; images[1] = "data/images/ip_network.png"; images[2] = "data/images/router.png"; String[] names = new String[] {"Switch","Network","Router"}; BufferedImage img = null; for(int i=0; i < images.length ; i++) { try { img = ImageIO.read(new File(images[i])); imageFactory.addImage(names[i],img); } catch (IOException e){ } } } catch(Exception exp) { } Visualization vis = new Visualization(); vis.add("graph", graph); LabelRenderer nodeRenderer = new LabelRenderer("name", "type"); nodeRenderer.setVerticalAlignment(Constants.BOTTOM); nodeRenderer.setHorizontalPadding(0); nodeRenderer.setVerticalPadding(0); nodeRenderer.setImagePosition(Constants.TOP); nodeRenderer.setMaxImageDimensions(100,100); DefaultRendererFactory drf = new DefaultRendererFactory(); drf.setDefaultRenderer(nodeRenderer); vis.setRendererFactory(drf); ColorAction nText = new ColorAction("graph.nodes", VisualItem.TEXTCOLOR); nText.setDefaultColor(ColorLib.gray(100)); ColorAction nEdges = new ColorAction("graph.edges", VisualItem.STROKECOLOR); nEdges.setDefaultColor(ColorLib.gray(100)); // bundle the color actions ActionList draw = new ActionList(); //MAD - changing the size of the nodes dependent on the weight of the people final DataSizeAction dsa = new DataSizeAction("graph.nodes","size"); draw.add(dsa); draw.add(nText); draw.add(new FontAction("graph.nodes", FontLib.getFont("Tahoma",Font.BOLD, 12))); draw.add(nEdges); vis.putAction("draw", draw); ActionList layout = new ActionList(Activity.DEFAULT_STEP_TIME); BalloonTreeLayout balloonlayout = new BalloonTreeLayout("graph",50); layout.add(balloonlayout); Display d = new Display(vis); vis.putAction("layout", layout); // start up the animated layout vis.run("draw"); vis.run("layout"); d.addControlListener(new DragControl()); // pan with left-click drag on background d.addControlListener(new PanControl()); // zoom with right-click drag d.addControlListener(new ZoomControl()); // -- 6. launch the visualization ------------------------------------- // create a new window to hold the visualization JFrame frame = new JFrame("prefuse example"); // ensure application exits when window is closed frame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); frame.add(d); frame.pack(); // layout components in window frame.setVisible(true); // show the window } } ` Can anyone please let me know how to customize the image sizes / renders insuch way that images won't overlapped. Thanks R.Ravikumar

    Read the article

  • Reading xml document in firefox

    - by Searock
    I am trying to read customers.xml using javascript. My professor has taught us to read xml using `ActiveXObjectand he has given us an assignment to create a sample login page which checks username and password by reading customers.xml. I am trying to use DOMParser so that it works with firefox. But when I click on Login button I get this error. Error: syntax error Source File: file:///C:/Users/Searock/Desktop/home/project/project/login.html Line: 1, Column: 1 Source Code: customers.xml Here's my code. login.js var xmlDoc = 0; function checkUser() { var user = document.login.txtLogin.value; var pass = document.login.txtPass.value; //xmlDoc = new ActiveXObject("Microsoft.XMLDOM"); /* xmlDoc = document.implementation.createDocument("","",null); xmlDoc.async = "false"; xmlDoc.onreadystatechange = redirectUser; xmlDoc.load("customers.xml"); */ var parser = new DOMParser(); xmlDoc = parser.parseFromString("customers.xml", "text/xml"); alert(xmlDoc.documentElement.nodeName); xmlDoc.async = "false"; xmlDoc.onreadystatechange = redirectUser; } function redirectUser() { alert(''); var user = document.login.txtLogin.value; var pass = document.login.txtPass.value; var log = 0; if(xmlDoc.readyState == 4) { xmlObj = xmlDoc.documentElement; var len = xmlObj.childNodes.length; for(i = 0; i < len; i++) { var nodeElement = xmlObj.childNodes[i]; var userXml = nodeElement.childNodes[0].firstChild.nodeValue; var passXml = nodeElement.childNodes[1].firstChild.nodeValue; var idXML = nodeElement.attributes[0].value if(userXml == user && passXml == pass) { log = 1; document.cookie = escape(idXML); document.login.submit(); } } } if(log == 0) { var divErr = document.getElementById('Error'); divErr.innerHTML = "<b>Login Failed</b>"; } } customers.xml <?xml version="1.0" encoding="UTF-8"?> <customers> <customer custid="CU101"> <user>jack</user> <pwd>PW101</pwd> <email>[email protected]</email> </customer> <customer custid="CU102"> <user>jill</user> <pwd>PW102</pwd> <email>[email protected]</email> </customer> <customer custid="CU103"> <user>john</user> <pwd>PW103</pwd> <email>[email protected]</email> </customer> <customer custid="CU104"> <user>jeff</user> <pwd>PW104</pwd> <email>[email protected]</email> </customer> </customers> I get parsererror message on line alert(xmlDoc.documentElement.nodeName); I don't know what's wrong with my code. Can some one point me in a right direction? Edit : Ok, I found a solution. var xmlDoc = 0; var xhttp = 0; function checkUser() { var user = document.login.txtLogin.value; var pass = document.login.txtPass.value; var err = ""; if(user == "" || pass == "") { if(user == "") { alert("Enter user name"); } if(pass == "") { alert("Enter Password"); } return; } if (window.XMLHttpRequest) { xhttp=new XMLHttpRequest(); } else // IE 5/6 { xhttp=new ActiveXObject("Microsoft.XMLHTTP"); } xhttp.onreadystatechange = redirectUser; xhttp.open("GET","customers.xml",true); xhttp.send(); } function redirectUser() { var log = 2; var user = document.login.txtLogin.value; var pass = document.login.txtPass.value; if (xhttp.readyState == 4) { log = 0; xmlDoc = xhttp.responseXML; var xmlUsers = xmlDoc.getElementsByTagName('user'); var xmlPasswords = xmlDoc.getElementsByTagName('pwd'); var userLen = xmlDoc.getElementsByTagName('customer').length; var xmlCustomers = xmlDoc.getElementsByTagName('customer'); for (var i = 0; i < userLen; i++) { var xmlUser = xmlUsers[i].childNodes[0].nodeValue; var xmlPass = xmlPasswords[i].childNodes[0].nodeValue; var xmlId = xmlCustomers.item(i).attributes[0].nodeValue; if(xmlUser == user && xmlPass == pass) { log = 1; document.cookie = xmlId; document.login.submit(); break; } } } if(log == 0) { alert("Login failed"); } } Thanks.

    Read the article

  • Flex/bison, error: undeclared

    - by Imran
    hallo, i have a problem, the followed program gives back an error, error:: Undeclared(first use in function), why this error appears all tokens are declared, but this error comes, can anyone help me, here are the lex and yac files.thanks lex: %{ int yylinenu= 1; int yycolno= 1; %} %x STR DIGIT [0-9] ALPHA [a-zA-Z] ID {ALPHA}(_?({ALPHA}|{DIGIT}))*_? GROUPED_NUMBER ({DIGIT}{1,3})(\.{DIGIT}{3})* SIMPLE_NUMBER {DIGIT}+ NUMMER {GROUPED_NUMBER}|{SIMPLE_NUMBER} %% <INITIAL>{ [\n] {++yylinenu ; yycolno=1;} [ ]+ {yycolno=yycolno+yyleng;} [\t]+ {yycolno=yycolno+(yyleng*8);} "*" {return MAL;} "+" {return PLUS;} "-" {return MINUS;} "/" {return SLASH;} "(" {return LINKEKLAMMER;} ")" {return RECHTEKLAMMER;} "{" {return LINKEGESCHWEIFTEKLAMMER;} "}" {return RECHTEGESCHEIFTEKLAMMER;} "=" {return GLEICH;} "==" {return GLEICHVERGLEICH;} "!=" {return UNGLEICH;} "<" {return KLEINER;} ">" {return GROSSER;} "<=" {return KLEINERGLEICH;} ">=" {return GROSSERGLEICH;} "while" {return WHILE;} "if" {return IF;} "else" {return ELSE;} "printf" {return PRINTF;} ";" {return SEMIKOLON;} \/\/[^\n]* { ;} {NUMMER} {return NUMBER;} {ID} {return IDENTIFIER;} \" {BEGIN(STR);} . {;} } <STR>{ \n {++yylinenu ;yycolno=1;} ([^\"\\]|"\\t"|"\\n"|"\\r"|"\\b"|"\\\"")+ {return STRING;} \" {BEGIN(INITIAL);} } %% yywrap() { } YACC: %{ #include stdio.h> #include string.h> #include "lex.yy.c" void yyerror(char *err); int error=0,linecnt=1; %} %token IDENTIFIER NUMBER STRING COMMENT PLUS MINUS MAL SLASH LINKEKLAMMER RECHTEKLAMMER LINKEGESCHWEIFTEKLAMMER RECHTEGESCHEIFTEKLAMMER GLEICH GLEICHVERGLEICH UNGLEICH GROSSER KLEINER GROSSERGLEICH KLEINERGLEICH IF ELSE WHILE PRINTF SEMIKOLON %start Stmts %% Stmts : Stmt {puts("\t\tStmts : Stmt");} |Stmt Stmts {puts("\t\tStmts : Stmt Stmts");} ; //NEUE REGEL---------------------------------------------- Stmt : LINKEGESCHWEIFTEKLAMMER Stmts RECHTEGESCHEIFTEKLAMMER {puts("\t\tStmt : '{' Stmts '}'");} |IF LINKEKLAMMER Cond RECHTEKLAMMER Stmt {puts("\t\tStmt : '(' Cond ')' Stmt");} |IF LINKEKLAMMER Cond RECHTEKLAMMER Stmt ELSE Stmt {puts("\t\tStmt : '(' Cond ')' Stmt 'ELSE' Stmt");} |WHILE LINKEKLAMMER Cond RECHTEKLAMMER Stmt {puts("\t\tStmt : 'PRINTF' Expr ';'");} |PRINTF Expr SEMIKOLON {puts("\t\tStmt : 'PRINTF' Expr ';'");} |IDENTIFIER GLEICH Expr SEMIKOLON {puts("\t\tStmt : 'IDENTIFIER' '=' Expr ';'");} |SEMIKOLON {puts("\t\tStmt : ';'");} ;//NEUE REGEL --------------------------------------------- Cond: Expr GLEICHVERGLEICH Expr {puts("\t\tCond : '==' Expr");} |Expr UNGLEICH Expr {puts("\t\tCond : '!=' Expr");} |Expr KLEINER Expr {puts("\t\tCond : '<' Expr");} |Expr KLEINERGLEICH Expr {puts("\t\tCond : '<=' Expr");} |Expr GROSSER Expr {puts("\t\tCond : '>' Expr");} |Expr GROSSERGLEICH Expr {puts("\t\tCond : '>=' Expr");} ;//NEUE REGEL -------------------------------------------- Expr:Term {puts("\t\tExpr : Term");} |Term PLUS Expr {puts("\t\tExpr : Term '+' Expr");} |Term MINUS Expr {puts("\t\tExpr : Term '-' Expr");} ;//NEUE REGEL -------------------------------------------- Term:Factor {puts("\t\tTerm : Factor");} |Factor MAL Term {puts("\t\tTerm : Factor '*' Term");} |Factor SLASH Term {puts("\t\tTerm : Factor '/' Term");} ;//NEUE REGEL -------------------------------------------- Factor:SimpleExpr {puts("\t\tFactor : SimpleExpr");} |MINUS SimpleExpr {puts("\t\tFactor : '-' SimpleExpr");} ;//NEUE REGEL -------------------------------------------- SimpleExpr:LINKEKLAMMER Expr RECHTEKLAMMER {puts("\t\tSimpleExpr : '(' Expr ')'");} |IDENTIFIER {puts("\t\tSimpleExpr : 'IDENTIFIER'");} |NUMBER {puts("\t\tSimpleExpr : 'NUMBER'");} |STRING {puts("\t\tSimpleExpr : 'String'");} ;//ENDE ------------------------------------------------- %% void yyerror(char *msg) { error=1; printf("Line: %d , Column: %d : %s \n", yylinenu, yycolno,yytext, msg); } int main(int argc, char *argv[]) { int val; while(yylex()) { printf("\n",yytext); } return yyparse(); }

    Read the article

  • How do I add the j2ee.jar to a Java2WSDL ant script programmatically?

    - by Marcus
    I am using IBM's Rational Application Developer. I have an ant script that contains the Java2WSDL task. When I run it via IBM, it gives compiler errors unless I include the j2ee.jar file in the classpath via the run tool (it does not pick up the jar files in the classpath in the script). However, I need to be able to call this script programmatically, and it is giving me this error: "java.lang.NoClassDefFoundError: org.eclipse.core.runtime.CoreException" I'm not sure which jars need to be added or where? Since a simple echo script runs, I assume that it is the j2ee.jar or another ant jar that needs to be added. I've added it to the project's buildpath, but that doesn't help. (I also have ant.jar, wsanttasks.jar, all the ant jars from the plugin, tools.jar, remoteAnt.jar, and the swt - all which are included in the buildpath when you run the script by itself.) Script: <?xml version="1.0" encoding="UTF-8"?> <project default="build" basedir="."> <path id="lib.path"> <fileset dir="C:\Program Files\IBM\WebSphere\AppServer\lib" includes="*.jar"/> <!-- Adding these does not help. <fileset dir="C:\Program Files\IBM\SDP70Shared\plugins\org.apache.ant_1.6.5\lib" includes="*.jar"/> <fileset dir="C:\Program Files\IBM\SDP70\jdk\lib" includes="*.jar"/> <fileset dir="C:\Program Files\IBM\SDP70\configuration\org.eclipse.osgi\bundles\1139\1\.cp\lib" includes="*.jar"/> <fileset dir="C:\Program Files\IBM\SDP70Shared\plugins" includes="*.jar"/> --> </path> <taskdef name="java2wsdl" classname="com.ibm.websphere.ant.tasks.Java2WSDL"> <classpath refid="lib.path"/> </taskdef> <target name="build"> <echo message="Beginning build"/> <javac srcdir="C:\J2W_Test\Java2Wsdl_Example" destdir="C:\J2W_Test\Java2Wsdl_Example"> <classpath refid="lib.path"/> <include name="WSExample.java"/> </javac> <echo message="Set up javac"/> <echo message="Running java2wsdl"/> <java2wsdl output="C:\J2W_Test\Java2Wsdl_Example\example\META-INF\wsdl\WSExample.wsdl" classpath="C:\J2W_Test\Java2Wsdl_Example" className= "example.WSExample" namespace="http://example" namespaceImpl="http://example" location="http://localhost:9080/example/services/WSExample" style="document" use="literal"> <mapping namespace="http://example" package="example"/> </java2wsdl> <echo message="Complete"/> </target> </project> Code: File buildFile = new File("build.xml"); Project p = new Project(); p.setUserProperty("ant.file", buildFile.getAbsolutePath()); DefaultLogger consoleLogger = new DefaultLogger(); consoleLogger.setErrorPrintStream(System.err); consoleLogger.setOutputPrintStream(System.out); consoleLogger.setMessageOutputLevel(Project.MSG_INFO); p.addBuildListener(consoleLogger); try { p.fireBuildStarted(); p.init(); ProjectHelper helper = ProjectHelper.getProjectHelper(); p.addReference("ant.projectHelper", helper); helper.parse(p, buildFile); p.executeTarget(p.getDefaultTarget()); p.fireBuildFinished(null); } catch (BuildException e) { p.fireBuildFinished(e); } Error: [java2wsdl] java.lang.NoClassDefFoundError: org.eclipse.core.runtime.CoreException [java2wsdl] at java.lang.J9VMInternals.verifyImpl(Native Method) [java2wsdl] at java.lang.J9VMInternals.verify(J9VMInternals.java:68) [java2wsdl] at java.lang.J9VMInternals.initialize(J9VMInternals.java:129) [java2wsdl] at com.ibm.ws.webservices.multiprotocol.discovery.ServiceProviderManager.getDiscoveredServiceProviders(ServiceProviderManager.java:378) [java2wsdl] at com.ibm.ws.webservices.multiprotocol.discovery.ServiceProviderManager.getAllServiceProviders(ServiceProviderManager.java:214) [java2wsdl] at com.ibm.ws.webservices.wsdl.fromJava.Emitter.initPluggableBindings(Emitter.java:2704) [java2wsdl] at com.ibm.ws.webservices.wsdl.fromJava.Emitter.<init>(Emitter.java:389) [java2wsdl] at com.ibm.ws.webservices.tools.ant.Java2WSDL.execute(Java2WSDL.java:122) [java2wsdl] at org.apache.tools.ant.UnknownElement.execute(UnknownElement.java:275) [java2wsdl] at org.apache.tools.ant.Task.perform(Task.java:364) [java2wsdl] at org.apache.tools.ant.Target.execute(Target.java:341) [java2wsdl] at org.apache.tools.ant.Target.performTasks(Target.java:369) [java2wsdl] at org.apache.tools.ant.Project.executeSortedTargets(Project.java:1216) [java2wsdl] at org.apache.tools.ant.Project.executeTarget(Project.java:1185) [java2wsdl] at att.ant.RunAnt.main(RunAnt.java:32)

    Read the article

  • Hibernate error: cannot resolve table

    - by Roman
    I'm trying to make work the example from hibernate reference. I've got simple table Pupil with id, name and age fields. I've created correct (as I think) java-class for it according to all java-beans rules. I've created configuration file - hibernate.cfg.xml, just like in the example from reference. I've created hibernate mapping for one class Pupil, and here is the error occured. <hibernate-mapping> <class name="Pupil" table="pupils"> ... </class> </hibernate-mapping> table="pupils" is red in my IDE and I see message "cannot resolve table pupils". I've also founded very strange note in reference which says that most users fail with the same problem trying to run the example. Ah.. I'm very angry with this example.. IMHO if authors know that there is such problem they should add some information about it. But, how should I fix it? I don't want to deal with Ant here and with other instruments used in example. I'm using MySql 5.0, but I think it doesn't matter. UPD: source code Pupil.java - my persistent class package domain; public class Pupil { private Integer id; private String name; private Integer age; protected Pupil () { } public Pupil (String name, int age) { this.age = age; this.name = name; } public Integer getId () { return id; } public void setId (Integer id) { this.id = id; } public String getName () { return name; } public void setName (String name) { this.name = name; } public Integer getAge () { return age; } public void setAge (Integer age) { this.age = age; } public String toString () { return "Pupil [ name = " + name + ", age = " + age + " ]"; } } Pupil.hbm.xml is mapping for this class <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="domain" > <class name="Pupil" table="pupils"> <id name="id"> <generator class="native" /> </id> <property name="name" not-null="true"/> <property name="age"/> </class> </hibernate-mapping> hibernate.cfg.xml - configuration for hibernate <hibernate-configuration> <session-factory> <!-- Database connection settings --> <property name="connection.driver_class">com.mysql.jdbc.Driver</property> <property name="connection.url">jdbc:mysql://localhost/hbm_test</property> <property name="connection.username">root</property> <property name="connection.password">root</property> <property name="connection.pool_size">1</property> <property name="dialect">org.hibernate.dialect.MySQL5Dialect</property> <property name="current_session_context_class">thread</property> <property name="show_sql">true</property> <mapping resource="domain/Pupil.hbm.xml"/> </session-factory> </hibernate-configuration> HibernateUtils.java package utils; import org.hibernate.SessionFactory; import org.hibernate.HibernateException; import org.hibernate.cfg.Configuration; public class HibernateUtils { private static final SessionFactory sessionFactory; static { try { sessionFactory = new Configuration ().configure ().buildSessionFactory (); } catch (HibernateException he) { System.err.println (he); throw new ExceptionInInitializerError (he); } } public static SessionFactory getSessionFactory () { return sessionFactory; } } Runner.java - class for testing hibernate import org.hibernate.Session; import java.util.*; import utils.HibernateUtils; import domain.Pupil; public class Runner { public static void main (String[] args) { Session s = HibernateUtils.getSessionFactory ().getCurrentSession (); s.beginTransaction (); List pups = s.createQuery ("from Pupil").list (); for (Object obj : pups) { System.out.println (obj); } s.getTransaction ().commit (); HibernateUtils.getSessionFactory ().close (); } } My libs: antlr-2.7.6.jar, asm.jar, asm-attrs.jar, cglib-2.1.3.jar, commons-collections-2.1.1.jar, commons-logging-1.0.4.jar, dom4j-1.6.1.jar, hibernate3.jar, jta.jar, log4j-1.2.11.jar, mysql-connector-java-5.1.7-bin.jar Compile error: cannot resolve table pupils

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Java Client-Server problem when sending multiple files

    - by Jim
    Client public void transferImage() { File file = new File(ServerStats.clientFolder); String[] files = file.list(); int numFiles = files.length; boolean done = false; BufferedInputStream bis; BufferedOutputStream bos; int num; byte[] byteArray; long count; long len; Socket socket = null ; while (!done){ try{ socket = new Socket(ServerStats.imgServerName,ServerStats.imgServerPort) ; InputStream inStream = socket.getInputStream() ; OutputStream outStream = socket.getOutputStream() ; System.out.println("Connected to : " + ServerStats.imgServerName); BufferedReader inm = new BufferedReader(new InputStreamReader(inStream)); PrintWriter out = new PrintWriter(outStream, true /* autoFlush */); for (int itor = 0; itor < numFiles; itor++) { String fileName = files[itor]; System.out.println("transfer: " + fileName); File sentFile = new File(fileName); len = sentFile.length(); len++; System.out.println(len); out.println(len); out.println(sentFile); //SENDFILE bis = new BufferedInputStream(new FileInputStream(fileName)); bos = new BufferedOutputStream(socket.getOutputStream( )); byteArray = new byte[1000000]; count = 0; while ( count < len ){ num = bis.read(byteArray); bos.write(byteArray,0,num); count++; } bos.close(); bis.close(); System.out.println("file done: " + itor); } done = true; }catch (Exception e) { System.err.println(e) ; } } } Server public static void main(String[] args) { BufferedInputStream bis; BufferedOutputStream bos; int num; File file = new File(ServerStats.serverFolder); if (!(file.exists())){ file.mkdir(); } try { int i = 1; ServerSocket socket = new ServerSocket(ServerStats.imgServerPort); Socket incoming = socket.accept(); System.out.println("Spawning " + i); try { try{ if (!(file.exists())){ file.mkdir(); } InputStream inStream = incoming.getInputStream(); OutputStream outStream = incoming.getOutputStream(); BufferedReader inm = new BufferedReader(new InputStreamReader(inStream)); PrintWriter out = new PrintWriter(outStream, true /* autoFlush */); String length2 = inm.readLine(); System.out.println(length2); String filename = inm.readLine(); System.out.println("Filename = " + filename); out.println("ACK: Filename received = " + filename); //RECIEVE and WRITE FILE byte[] receivedData = new byte[1000000]; bis = new BufferedInputStream(incoming.getInputStream()); bos = new BufferedOutputStream(new FileOutputStream(ServerStats.serverFolder + "/" + filename)); long length = (long)Integer.parseInt(length2); length++; long counter = 0; while (counter < length){ num = bis.read(receivedData); bos.write(receivedData,0,num); counter ++; } System.out.println(counter); bos.close(); bis.close(); File receivedFile = new File(filename); long receivedLen = receivedFile.length(); out.println("ACK: Length of received file = " + receivedLen); } finally { incoming.close(); } } catch (IOException e){ e.printStackTrace(); } } catch (IOException e1){ e1.printStackTrace(); } } The code is some I found, and I have slightly modified it, but I am having problems transferring multiple images over the server. Output on Client: run ServerQueue.Client Connected to : localhost transfer: Picture 012.jpg 1312743 java.lang.ArrayIndexOutOfBoundsException Connected to : localhost transfer: Picture 012.jpg 1312743 Cant seem to get it to transfer multiple images. But bothsides I think crash or something because the file never finishes transfering

    Read the article

  • Java programming accessing object variables

    - by Haxed
    Helo, there are 3 files, CustomerClient.java, CustomerServer.java and Customer.java PROBLEM: In the CustomerServer.java file, i get an error when I compile the CustomerServer.java at line : System.out.println(a[k].getName()); ERROR: init: deps-jar: Compiling 1 source file to C:\Documents and Settings\TLNA\My Documents\NetBeansProjects\Server\build\classes C:\Documents and Settings\TLNA\My Documents\NetBeansProjects\Server\src\CustomerServer.java:44: cannot find symbol symbol : method getName() location: class Customer System.out.println(a[k].getName()); 1 error BUILD FAILED (total time: 0 seconds) CustomerClient.java import java.io.*; import java.net.*; import java.awt.*; import java.awt.event.*; import javax.swing.*; import javax.swing.border.*; public class CustomerClient extends JApplet { private JTextField jtfName = new JTextField(32); private JTextField jtfSeatNo = new JTextField(32); // Button for sending a student to the server private JButton jbtRegister = new JButton("Register to the Server"); // Indicate if it runs as application private boolean isStandAlone = false; // Host name or ip String host = "localhost"; public void init() { JPanel p1 = new JPanel(); p1.setLayout(new GridLayout(2, 1)); p1.add(new JLabel("Name")); p1.add(jtfName); p1.add(new JLabel("Seat No.")); p1.add(jtfSeatNo); add(p1, BorderLayout.CENTER); add(jbtRegister, BorderLayout.SOUTH); // Register listener jbtRegister.addActionListener(new ButtonListener()); // Find the IP address of the Web server if (!isStandAlone) { host = getCodeBase().getHost(); } } /** Handle button action */ private class ButtonListener implements ActionListener { public void actionPerformed(ActionEvent e) { try { // Establish connection with the server Socket socket = new Socket(host, 8000); // Create an output stream to the server ObjectOutputStream toServer = new ObjectOutputStream(socket.getOutputStream()); // Get text field String name = jtfName.getText().trim(); String seatNo = jtfSeatNo.getText().trim(); // Create a Student object and send to the server Customer s = new Customer(name, seatNo); toServer.writeObject(s); } catch (IOException ex) { System.err.println(ex); } } } /** Run the applet as an application */ public static void main(String[] args) { // Create a frame JFrame frame = new JFrame("Register Student Client"); // Create an instance of the applet CustomerClient applet = new CustomerClient(); applet.isStandAlone = true; // Get host if (args.length == 1) { applet.host = args[0]; // Add the applet instance to the frame } frame.add(applet, BorderLayout.CENTER); // Invoke init() and start() applet.init(); applet.start(); // Display the frame frame.pack(); frame.setVisible(true); } } CustomerServer.java import java.io.*; import java.net.*; public class CustomerServer { private String name; private int i; private ObjectOutputStream outputToFile; private ObjectInputStream inputFromClient; public static void main(String[] args) { new CustomerServer(); } public CustomerServer() { Customer[] a = new Customer[30]; try { // Create a server socket ServerSocket serverSocket = new ServerSocket(8000); System.out.println("Server started "); // Create an object ouput stream outputToFile = new ObjectOutputStream( new FileOutputStream("student.dat", true)); while (true) { // Listen for a new connection request Socket socket = serverSocket.accept(); // Create an input stream from the socket inputFromClient = new ObjectInputStream(socket.getInputStream()); // Read from input //Object object = inputFromClient.readObject(); for (int k = 0; k <= 2; k++) { if (a[k] == null) { a[k] = (Customer) inputFromClient.readObject(); // Write to the file outputToFile.writeObject(a[k]); //System.out.println("A new student object is stored"); System.out.println(a[k].getName()); break; } if (k == 2) { //fully booked outputToFile.writeObject("All seats are booked"); break; } } } } catch (ClassNotFoundException ex) { ex.printStackTrace(); } catch (IOException ex) { ex.printStackTrace(); } finally { try { inputFromClient.close(); outputToFile.close(); } catch (Exception ex) { ex.printStackTrace(); } } } } Customer.java public class Customer implements java.io.Serializable { private String name; private String seatno; public Customer(String name, String seatno) { this.name = name; this.seatno = seatno; } public String getName() { return name; } public String getSeatNo() { return seatno; } }

    Read the article

  • spring mvc forward to jsp

    - by jerluc
    I currently have my web.xml configured to catch 404s and send them to my spring controller which will perform a search given the original URL request. The functionality is all there as far as the catch and search go, however the trouble begins to arise when I try to return a view. <bean class="org.springframework.web.servlet.view.ContentNegotiatingViewResolver" p:order="1"> <property name="mediaTypes"> <map> <entry key="json" value="application/json" /> <entry key="jsp" value="text/html" /> </map> </property> <property name="defaultContentType" value="application/json" /> <property name="favorPathExtension" value="true" /> <property name="viewResolvers"> <list> <bean class="org.springframework.web.servlet.view.BeanNameViewResolver" /> <bean id="viewResolver" class="org.springframework.web.servlet.view.InternalResourceViewResolver"> <property name="prefix" value="/WEB-INF/jsp/" /> <property name="suffix" value="" /> </bean> </list> </property> <property name="defaultViews"> <list> <bean class="org.springframework.web.servlet.view.json.MappingJacksonJsonView" /> </list> </property> <property name="ignoreAcceptHeader" value="true" /> </bean> This is a snippet from my MVC config file. The problem lies in resolving the view's path to the /WEB-INF/jsp/ directory. Using a logger in my JBoss setup, I can see that when I test this search controller by going to a non-existent page, the following occurs: Server can't find the request Request is sent to 404 error page (in this case my search controller) Search controller performs search Search controller returns view name (for this illustration, we'll assume test.jsp is returned) Based off of server logger, I can see that org.springframework.web.servlet.view.JstlView is initialized once my search controller returns the view name (so I can assume it is being picked up correctly by the InternalResourceViewResolver) Server attempts to return content to browser resulting in a 404! A couple things confuse me about this: I'm not 100% sure why this isn't resolving when test.jsp clearly exists under the /WEB-INF/jsp/ directory. Even if there was some other problem, why would this result in a 404? Shouldn't a 404 error page that results in another 404 theoretically create an infinite loop? Thanks for any help or pointers! Controller class [incomplete]: @Controller public class SiteMapController { //-------------------------------------------------------------------------------------- @Autowired(required=true) private SearchService search; @Autowired(required=true) private CatalogService catalog; //-------------------------------------------------------------------------------------- @RequestMapping(value = "/sitemap", method = RequestMethod.GET) public String sitemap (HttpServletRequest request, HttpServletResponse response) { String forwardPath = ""; try { long startTime = System.nanoTime() / 1000000; String pathQuery = (String) request.getAttribute("javax.servlet.error.request_uri"); Scanner pathScanner = new Scanner(pathQuery).useDelimiter("\\/"); String context = pathScanner.next(); List<ProductLightDTO> results = new ArrayList<ProductLightDTO>(); StringBuilder query = new StringBuilder(); String currentValue; while (pathScanner.hasNext()) { currentValue = pathScanner.next().toLowerCase(); System.out.println(currentValue); if (query.length() > 0) query.append(" AND "); if (currentValue.contains("-")) { query.append("\""); query.append(currentValue.replace("-", " ")); query.append("\""); } else { query.append(currentValue + "*"); } } //results.addAll(this.doSearch(query.toString())); System.out.println("Request: " + pathQuery); System.out.println("Built Query:" + query.toString()); //System.out.println("Result size: " + results.size()); long totalTime = (System.nanoTime() / 1000000) - startTime; System.out.println("Total TTP: " + totalTime + "ms"); if (results == null || results.size() == 0) { forwardPath = "home.jsp"; } else if (results.size() == 1) { forwardPath = "product.jsp"; } else { forwardPath = "category.jsp"; } } catch (Exception ex) { System.err.println(ex); } System.out.println("Returning view: " + forwardPath); return forwardPath; } }

    Read the article

  • Java Program Compiles and Runs, but doesn't work

    - by Richard Long
    When I run this program I enter information in a text box, push the search button, but nothing happens. The program just sits there until I press Cntrl C to break it. It looks like it should work, but I can't figure out what is hanging the program up. Here is the code: First class: import java.io.*; import java.awt.*; import javax.swing.*; import java.awt.event.*; import java.util.*; public class NameGameFrame extends JFrame { public static String name; static JTextField textfield = new JTextField(20); static JTextArea textarea = new JTextArea(30,30); public static String num; public static String [] fields; public static int [] yearRank; public static boolean match; public static int getInts, marker, year, max; public static void main( String[] args) { JFrame frame = new JFrame(); frame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); frame.setTitle("Name Game"); frame.setLocation(500,400); frame.setSize(800,800); JPanel panel = new JPanel(new GridBagLayout()); GridBagConstraints c = new GridBagConstraints(); JLabel label = new JLabel("Enter the Name or Partial Name to search:"); c.gridx = 0; c.gridy = 0; c.insets = new Insets(2,2,2,2); panel.add(label,c); c.gridx = 0; c.gridy = 1; panel.add(textarea,c); JButton button = new JButton("Search"); c.gridx = 1; c.gridy = 1; panel.add(button,c); c.gridx = 1; c.gridy = 0; panel.add(textfield,c); frame.getContentPane().add(panel, BorderLayout.NORTH); frame.pack(); frame.setVisible(true); button.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent ae) { name = textfield.getText(); java.io.File file = new java.io.File("namesdata.txt"); try { Scanner input = new Scanner(file); num = input.nextLine(); NameRecord nr = new NameRecord(name); while (input.hasNext()) { if(match = num.toLowerCase().contains(name.toLowerCase())) { nr.getRank(); nr.getBestYear(marker); } } } catch(FileNotFoundException e) { System.err.format("File does not exist\n"); } textarea.setText(fields[0]); } }); } } This is the second class: import java.io.*; import java.util.*; public class NameRecord { public NameRecord( String name) { } public static int getBestYear(int marker) { switch (marker) { case 1: year = 1900; break; case 2: year = 1910; break; case 3: year = 1920; break; case 4: year = 1930; break; case 5: year = 1940; break; case 6: year = 1950; break; case 7: year = 1960; break; case 8: year = 1970; break; case 9: year = 1980; break; case 10: year = 1990; break; case 11: year = 2000; break; } return year; } public static int getRank() { fields = num.split(" "); max = 0; for (int i = 1; i<12; i++) { getInts = Integer.parseInt(fields[i]); if(getInts>max) { max = getInts; marker = i; } } return max; } }

    Read the article

  • Swap image with jquery and show zoom image

    - by Neil Bradley
    Hi there, On my site I have 4 thumbnail product images that when clicked on swap the main image. This part is working okay. However, on the main image I'm also trying to use the jQZoom script. The zoom script works for the most part, except that the zoomed image always displays the zoom of the first image, rather than the one selected. This can be seen in action here; http://www.wearecapital.com/productdetails-new.asp?id=6626 I was wondering if someone might be able to suggest a solution? My code for the page is here; <% if session("qstring") = "" then session("qstring") = "&amp;rf=latest" maxProducts = 6 prodID = request("id") if prodID = "" or not isnumeric(prodid) then response.Redirect("listproducts.asp?err=1" & session("qstring")) else prodId = cint(prodId) end if SQL = "Select * from products,subcategories,labels where subcat_id = prod_subcategory and label_id = prod_label and prod_id = " & prodID set conn = server.CreateObject("ADODB.connection") conn.Open(Application("DATABASE")) set rs = conn.Execute(SQL) if rs.eof then ' product is not valid name = "Error - product id " & prodID & " is not available" else image1 = rs.fields("prod_image1") image1Desc = rs.fields("prod_image1Desc") icon = rs.fields("prod_icon") subcat = rs.fields("prod_subcategory") image2 = rs.fields("prod_image2") image2Desc = rs.fields("prod_image2Desc") image3 = rs.fields("prod_image3") image3Desc = rs.fields("prod_image3Desc") image4 = rs.fields("prod_image4") image4Desc = rs.fields("prod_image4Desc") zoomimg = rs.Fields("prod_zoomimg") zoomimg2 = rs.Fields("prod_zoomimg2") zoomimg3 = rs.Fields("prod_zoomimg3") zoomimg4 = rs.Fields("prod_zoomimg4") thumb1 = rs.fields("prod_preview1").value thumb2 = rs.fields("prod_preview2").value thumb3 = rs.fields("prod_preview3").value thumb4 = rs.fields("prod_preview4").value end if set rs = nothing conn.Close set conn = nothing %> <!-- #include virtual="/includes/head-product.asp" --> <body id="detail"> <!-- #include virtual="/includes/header.asp" --> <script type="text/javascript" language="javascript"> function switchImg(imgName) { var ImgX = document.getElementById("mainimg"); ImgX.src="/images/products/" + imgName; } </script> <script type="text/javascript"> $(document).ready(function(){ var options = { zoomWidth: 466, zoomHeight: 260, xOffset: 34, yOffset: 0, title: false, position: "right" //and MORE OPTIONS }; $(".MYCLASS").jqzoom(options); }); </script> <!-- #include virtual="/includes/nav.asp" --> <div id="column-left"> <div id="main-image"> <% if oldie = false then %><a href="/images/products/<%=zoomimg%>" class="MYCLASS" title="MYTITLE"><img src="/images/products/<%=image1%>" title="IMAGE TITLE" name="mainimg" id="mainimg" style="width:425px; height:638px;" ></a><% end if %> </div> </div> <div id="column-right"> <div id="altviews"> <h3 class="altviews">Alternative Views</h3> <ul> <% if oldie = false then writeThumb thumb1,image1,zoomimg,image1desc writeThumb thumb2,image2,zoomimg2,image2desc writeThumb thumb3,image3,zoomimg3,image3desc writeThumb thumb4,image4,zoomimg4,image4desc end if %> </ul> </div> </div> <!-- #include virtual="/includes/footer-test.asp" --> <% sub writeThumb(thumbfile, imgfile, zoomfile, thumbdesc) response.Write "<li>" if thumbfile <> "65/default_preview.jpg" and thumbfile <> "" and not isnull(thumbfile) then if imgFile <> "" and not isnull(imgfile) then rimgfile = replace(imgfile,"/","//") else rimgfile = "" if thumbdesc <> "" and not isnull(thumbdesc) then rDescription = replace(thumbdesc,"""","&quot;") else rDescription = "" response.write "<img src=""/images/products/"& thumbfile &""" style=""cursor: pointer"" border=""0"" style=""width:65px; height:98px;"" title="""& rDescription &""" onclick=""switchImg('" & rimgfile & "')"" />" & vbcrlf else response.write "<img src=""/images/products/65/default_preview.jpg"" alt="""" />" & vbCrLF end if response.write "</li>" & vbCrLF end sub %>

    Read the article

  • files get uploaded just before they get cancelled

    - by user1763986
    Got a little situation here where I am trying to cancel a file's upload. What I have done is stated that if the user clicks on the "Cancel" button, then it will simply remove the iframe so that it does not go to the page where it uploads the files into the server and inserts data into the database. Now this works fine if the user clicks on the "Cancel" button in quickish time the problem I have realised though is that if the user clicks on the "Cancel" button very late, it sometimes doesn't remove the iframe in time meaning that the file has just been uploaded just before the user has clicked on the "Cancel" button. So my question is that is there a way that if the file does somehow get uploaded before the user clicks on the "Cancel" button, that it deletes the data in the database and removes the file from the server? Below is the image upload form: <form action="imageupload.php" method="post" enctype="multipart/form-data" target="upload_target_image" onsubmit="return imageClickHandler(this);" class="imageuploadform" > <p class="imagef1_upload_process" align="center"> Loading...<br/> <img src="Images/loader.gif" /> </p> <p class="imagef1_upload_form" align="center"> <br/> <span class="imagemsg"></span> <label>Image File: <input name="fileImage" type="file" class="fileImage" /></label><br/> <br/> <label class="imagelbl"><input type="submit" name="submitImageBtn" class="sbtnimage" value="Upload" /></label> </p> <p class="imagef1_cancel" align="center"> <input type="reset" name="imageCancel" class="imageCancel" value="Cancel" /> </p> <iframe class="upload_target_image" name="upload_target_image" src="#" style="width:0px;height:0px;border:0px;solid;#fff;"></iframe> </form> Below is the jquery function which controls the "Cancel" button: $(imageuploadform).find(".imageCancel").on("click", function(event) { $('.upload_target_image').get(0).contentwindow $("iframe[name='upload_target_image']").attr("src", "javascript:'<html></html>'"); return stopImageUpload(2); }); Below is the php code where it uploads the files and inserts the data into the database. The form above posts to this php page "imageupload.php": <body> <?php include('connect.php'); session_start(); $result = 0; //uploads file move_uploaded_file($_FILES["fileImage"]["tmp_name"], "ImageFiles/" . $_FILES["fileImage"]["name"]); $result = 1; //set up the INSERT SQL query command to insert the name of the image file into the "Image" Table $imagesql = "INSERT INTO Image (ImageFile) VALUES (?)"; //prepare the above SQL statement if (!$insert = $mysqli->prepare($imagesql)) { // Handle errors with prepare operation here } //bind the parameters (these are the values that will be inserted) $insert->bind_param("s",$img); //Assign the variable of the name of the file uploaded $img = 'ImageFiles/'.$_FILES['fileImage']['name']; //execute INSERT query $insert->execute(); if ($insert->errno) { // Handle query error here } //close INSERT query $insert->close(); //Retrieve the ImageId of the last uploded file $lastID = $mysqli->insert_id; //Insert into Image_Question Table (be using last retrieved Image id in order to do this) $imagequestionsql = "INSERT INTO Image_Question (ImageId, SessionId, QuestionId) VALUES (?, ?, ?)"; //prepare the above SQL statement if (!$insertimagequestion = $mysqli->prepare($imagequestionsql)) { // Handle errors with prepare operation here echo "Prepare statement err imagequestion"; } //Retrieve the question number $qnum = (int)$_POST['numimage']; //bind the parameters (these are the values that will be inserted) $insertimagequestion->bind_param("isi",$lastID, 'Exam', $qnum); //execute INSERT query $insertimagequestion->execute(); if ($insertimagequestion->errno) { // Handle query error here } //close INSERT query $insertimagequestion->close(); ?> <!--Javascript which will output the message depending on the status of the upload (successful, failed or cancelled)--> <script> window.top.stopImageUpload(<?php echo $result; ?>, '<?php echo $_FILES['fileImage']['name'] ?>'); </script> </body> UPDATE: Below is the php code "cancelimage.php" where I want to delete the cancelled file from the server and delete the record from the database. It is set up but not finished, can somebody finish it off so I can retrieve the name of the file and it's id using $_SESSION? <?php // connect to the database include('connect.php'); /* check connection */ if (mysqli_connect_errno()) { printf("Connect failed: %s\n", mysqli_connect_error()); die(); } //remove file from server unlink("ImageFiles/...."); //need to retrieve file name here where the ... line is //DELETE query statement where it will delete cancelled file from both Image and Image Question Table $imagedeletesql = " DELETE img, img_q FROM Image AS img LEFT JOIN Image_Question AS img_q ON img_q.ImageId = img.ImageId WHERE img.ImageFile = ?"; //prepare delete query if (!$delete = $mysqli->prepare($imagedeletesql)) { // Handle errors with prepare operation here } //Dont pass data directly to bind_param store it in a variable $delete->bind_param("s",$img); //execute DELETE query $delete->execute(); if ($delete->errno) { // Handle query error here } //close query $delete->close(); ?> Can you please provide an sample code in your answer to make it easier for me. Thank you

    Read the article

  • C#/.NET Little Wonders: The Generic Func Delegates

    - by James Michael Hare
    Once again, in this series of posts I look at the parts of the .NET Framework that may seem trivial, but can help improve your code by making it easier to write and maintain. The index of all my past little wonders posts can be found here. Back in one of my three original “Little Wonders” Trilogy of posts, I had listed generic delegates as one of the Little Wonders of .NET.  Later, someone posted a comment saying said that they would love more detail on the generic delegates and their uses, since my original entry just scratched the surface of them. Last week, I began our look at some of the handy generic delegates built into .NET with a description of delegates in general, and the Action family of delegates.  For this week, I’ll launch into a look at the Func family of generic delegates and how they can be used to support generic, reusable algorithms and classes. Quick Delegate Recap Delegates are similar to function pointers in C++ in that they allow you to store a reference to a method.  They can store references to either static or instance methods, and can actually be used to chain several methods together in one delegate. Delegates are very type-safe and can be satisfied with any standard method, anonymous method, or a lambda expression.  They can also be null as well (refers to no method), so care should be taken to make sure that the delegate is not null before you invoke it. Delegates are defined using the keyword delegate, where the delegate’s type name is placed where you would typically place the method name: 1: // This delegate matches any method that takes string, returns nothing 2: public delegate void Log(string message); This delegate defines a delegate type named Log that can be used to store references to any method(s) that satisfies its signature (whether instance, static, lambda expression, etc.). Delegate instances then can be assigned zero (null) or more methods using the operator = which replaces the existing delegate chain, or by using the operator += which adds a method to the end of a delegate chain: 1: // creates a delegate instance named currentLogger defaulted to Console.WriteLine (static method) 2: Log currentLogger = Console.Out.WriteLine; 3:  4: // invokes the delegate, which writes to the console out 5: currentLogger("Hi Standard Out!"); 6:  7: // append a delegate to Console.Error.WriteLine to go to std error 8: currentLogger += Console.Error.WriteLine; 9:  10: // invokes the delegate chain and writes message to std out and std err 11: currentLogger("Hi Standard Out and Error!"); While delegates give us a lot of power, it can be cumbersome to re-create fairly standard delegate definitions repeatedly, for this purpose the generic delegates were introduced in various stages in .NET.  These support various method types with particular signatures. Note: a caveat with generic delegates is that while they can support multiple parameters, they do not match methods that contains ref or out parameters. If you want to a delegate to represent methods that takes ref or out parameters, you will need to create a custom delegate. We’ve got the Func… delegates Just like it’s cousin, the Action delegate family, the Func delegate family gives us a lot of power to use generic delegates to make classes and algorithms more generic.  Using them keeps us from having to define a new delegate type when need to make a class or algorithm generic. Remember that the point of the Action delegate family was to be able to perform an “action” on an item, with no return results.  Thus Action delegates can be used to represent most methods that take 0 to 16 arguments but return void.  You can assign a method The Func delegate family was introduced in .NET 3.5 with the advent of LINQ, and gives us the power to define a function that can be called on 0 to 16 arguments and returns a result.  Thus, the main difference between Action and Func, from a delegate perspective, is that Actions return nothing, but Funcs return a result. The Func family of delegates have signatures as follows: Func<TResult> – matches a method that takes no arguments, and returns value of type TResult. Func<T, TResult> – matches a method that takes an argument of type T, and returns value of type TResult. Func<T1, T2, TResult> – matches a method that takes arguments of type T1 and T2, and returns value of type TResult. Func<T1, T2, …, TResult> – and so on up to 16 arguments, and returns value of type TResult. These are handy because they quickly allow you to be able to specify that a method or class you design will perform a function to produce a result as long as the method you specify meets the signature. For example, let’s say you were designing a generic aggregator, and you wanted to allow the user to define how the values will be aggregated into the result (i.e. Sum, Min, Max, etc…).  To do this, we would ask the user of our class to pass in a method that would take the current total, the next value, and produce a new total.  A class like this could look like: 1: public sealed class Aggregator<TValue, TResult> 2: { 3: // holds method that takes previous result, combines with next value, creates new result 4: private Func<TResult, TValue, TResult> _aggregationMethod; 5:  6: // gets or sets the current result of aggregation 7: public TResult Result { get; private set; } 8:  9: // construct the aggregator given the method to use to aggregate values 10: public Aggregator(Func<TResult, TValue, TResult> aggregationMethod = null) 11: { 12: if (aggregationMethod == null) throw new ArgumentNullException("aggregationMethod"); 13:  14: _aggregationMethod = aggregationMethod; 15: } 16:  17: // method to add next value 18: public void Aggregate(TValue nextValue) 19: { 20: // performs the aggregation method function on the current result and next and sets to current result 21: Result = _aggregationMethod(Result, nextValue); 22: } 23: } Of course, LINQ already has an Aggregate extension method, but that works on a sequence of IEnumerable<T>, whereas this is designed to work more with aggregating single results over time (such as keeping track of a max response time for a service). We could then use this generic aggregator to find the sum of a series of values over time, or the max of a series of values over time (among other things): 1: // creates an aggregator that adds the next to the total to sum the values 2: var sumAggregator = new Aggregator<int, int>((total, next) => total + next); 3:  4: // creates an aggregator (using static method) that returns the max of previous result and next 5: var maxAggregator = new Aggregator<int, int>(Math.Max); So, if we were timing the response time of a web method every time it was called, we could pass that response time to both of these aggregators to get an idea of the total time spent in that web method, and the max time spent in any one call to the web method: 1: // total will be 13 and max 13 2: int responseTime = 13; 3: sumAggregator.Aggregate(responseTime); 4: maxAggregator.Aggregate(responseTime); 5:  6: // total will be 20 and max still 13 7: responseTime = 7; 8: sumAggregator.Aggregate(responseTime); 9: maxAggregator.Aggregate(responseTime); 10:  11: // total will be 40 and max now 20 12: responseTime = 20; 13: sumAggregator.Aggregate(responseTime); 14: maxAggregator.Aggregate(responseTime); The Func delegate family is useful for making generic algorithms and classes, and in particular allows the caller of the method or user of the class to specify a function to be performed in order to generate a result. What is the result of a Func delegate chain? If you remember, we said earlier that you can assign multiple methods to a delegate by using the += operator to chain them.  So how does this affect delegates such as Func that return a value, when applied to something like the code below? 1: Func<int, int, int> combo = null; 2:  3: // What if we wanted to aggregate the sum and max together? 4: combo += (total, next) => total + next; 5: combo += Math.Max; 6:  7: // what is the result? 8: var comboAggregator = new Aggregator<int, int>(combo); Well, in .NET if you chain multiple methods in a delegate, they will all get invoked, but the result of the delegate is the result of the last method invoked in the chain.  Thus, this aggregator would always result in the Math.Max() result.  The other chained method (the sum) gets executed first, but it’s result is thrown away: 1: // result is 13 2: int responseTime = 13; 3: comboAggregator.Aggregate(responseTime); 4:  5: // result is still 13 6: responseTime = 7; 7: comboAggregator.Aggregate(responseTime); 8:  9: // result is now 20 10: responseTime = 20; 11: comboAggregator.Aggregate(responseTime); So remember, you can chain multiple Func (or other delegates that return values) together, but if you do so you will only get the last executed result. Func delegates and co-variance/contra-variance in .NET 4.0 Just like the Action delegate, as of .NET 4.0, the Func delegate family is contra-variant on its arguments.  In addition, it is co-variant on its return type.  To support this, in .NET 4.0 the signatures of the Func delegates changed to: Func<out TResult> – matches a method that takes no arguments, and returns value of type TResult (or a more derived type). Func<in T, out TResult> – matches a method that takes an argument of type T (or a less derived type), and returns value of type TResult(or a more derived type). Func<in T1, in T2, out TResult> – matches a method that takes arguments of type T1 and T2 (or less derived types), and returns value of type TResult (or a more derived type). Func<in T1, in T2, …, out TResult> – and so on up to 16 arguments, and returns value of type TResult (or a more derived type). Notice the addition of the in and out keywords before each of the generic type placeholders.  As we saw last week, the in keyword is used to specify that a generic type can be contra-variant -- it can match the given type or a type that is less derived.  However, the out keyword, is used to specify that a generic type can be co-variant -- it can match the given type or a type that is more derived. On contra-variance, if you are saying you need an function that will accept a string, you can just as easily give it an function that accepts an object.  In other words, if you say “give me an function that will process dogs”, I could pass you a method that will process any animal, because all dogs are animals.  On the co-variance side, if you are saying you need a function that returns an object, you can just as easily pass it a function that returns a string because any string returned from the given method can be accepted by a delegate expecting an object result, since string is more derived.  Once again, in other words, if you say “give me a method that creates an animal”, I can pass you a method that will create a dog, because all dogs are animals. It really all makes sense, you can pass a more specific thing to a less specific parameter, and you can return a more specific thing as a less specific result.  In other words, pay attention to the direction the item travels (parameters go in, results come out).  Keeping that in mind, you can always pass more specific things in and return more specific things out. For example, in the code below, we have a method that takes a Func<object> to generate an object, but we can pass it a Func<string> because the return type of object can obviously accept a return value of string as well: 1: // since Func<object> is co-variant, this will access Func<string>, etc... 2: public static string Sequence(int count, Func<object> generator) 3: { 4: var builder = new StringBuilder(); 5:  6: for (int i=0; i<count; i++) 7: { 8: object value = generator(); 9: builder.Append(value); 10: } 11:  12: return builder.ToString(); 13: } Even though the method above takes a Func<object>, we can pass a Func<string> because the TResult type placeholder is co-variant and accepts types that are more derived as well: 1: // delegate that's typed to return string. 2: Func<string> stringGenerator = () => DateTime.Now.ToString(); 3:  4: // This will work in .NET 4.0, but not in previous versions 5: Sequence(100, stringGenerator); Previous versions of .NET implemented some forms of co-variance and contra-variance before, but .NET 4.0 goes one step further and allows you to pass or assign an Func<A, BResult> to a Func<Y, ZResult> as long as A is less derived (or same) as Y, and BResult is more derived (or same) as ZResult. Sidebar: The Func and the Predicate A method that takes one argument and returns a bool is generally thought of as a predicate.  Predicates are used to examine an item and determine whether that item satisfies a particular condition.  Predicates are typically unary, but you may also have binary and other predicates as well. Predicates are often used to filter results, such as in the LINQ Where() extension method: 1: var numbers = new[] { 1, 2, 4, 13, 8, 10, 27 }; 2:  3: // call Where() using a predicate which determines if the number is even 4: var evens = numbers.Where(num => num % 2 == 0); As of .NET 3.5, predicates are typically represented as Func<T, bool> where T is the type of the item to examine.  Previous to .NET 3.5, there was a Predicate<T> type that tended to be used (which we’ll discuss next week) and is still supported, but most developers recommend using Func<T, bool> now, as it prevents confusion with overloads that accept unary predicates and binary predicates, etc.: 1: // this seems more confusing as an overload set, because of Predicate vs Func 2: public static SomeMethod(Predicate<int> unaryPredicate) { } 3: public static SomeMethod(Func<int, int, bool> binaryPredicate) { } 4:  5: // this seems more consistent as an overload set, since just uses Func 6: public static SomeMethod(Func<int, bool> unaryPredicate) { } 7: public static SomeMethod(Func<int, int, bool> binaryPredicate) { } Also, even though Predicate<T> and Func<T, bool> match the same signatures, they are separate types!  Thus you cannot assign a Predicate<T> instance to a Func<T, bool> instance and vice versa: 1: // the same method, lambda expression, etc can be assigned to both 2: Predicate<int> isEven = i => (i % 2) == 0; 3: Func<int, bool> alsoIsEven = i => (i % 2) == 0; 4:  5: // but the delegate instances cannot be directly assigned, strongly typed! 6: // ERROR: cannot convert type... 7: isEven = alsoIsEven; 8:  9: // however, you can assign by wrapping in a new instance: 10: isEven = new Predicate<int>(alsoIsEven); 11: alsoIsEven = new Func<int, bool>(isEven); So, the general advice that seems to come from most developers is that Predicate<T> is still supported, but we should use Func<T, bool> for consistency in .NET 3.5 and above. Sidebar: Func as a Generator for Unit Testing One area of difficulty in unit testing can be unit testing code that is based on time of day.  We’d still want to unit test our code to make sure the logic is accurate, but we don’t want the results of our unit tests to be dependent on the time they are run. One way (of many) around this is to create an internal generator that will produce the “current” time of day.  This would default to returning result from DateTime.Now (or some other method), but we could inject specific times for our unit testing.  Generators are typically methods that return (generate) a value for use in a class/method. For example, say we are creating a CacheItem<T> class that represents an item in the cache, and we want to make sure the item shows as expired if the age is more than 30 seconds.  Such a class could look like: 1: // responsible for maintaining an item of type T in the cache 2: public sealed class CacheItem<T> 3: { 4: // helper method that returns the current time 5: private static Func<DateTime> _timeGenerator = () => DateTime.Now; 6:  7: // allows internal access to the time generator 8: internal static Func<DateTime> TimeGenerator 9: { 10: get { return _timeGenerator; } 11: set { _timeGenerator = value; } 12: } 13:  14: // time the item was cached 15: public DateTime CachedTime { get; private set; } 16:  17: // the item cached 18: public T Value { get; private set; } 19:  20: // item is expired if older than 30 seconds 21: public bool IsExpired 22: { 23: get { return _timeGenerator() - CachedTime > TimeSpan.FromSeconds(30.0); } 24: } 25:  26: // creates the new cached item, setting cached time to "current" time 27: public CacheItem(T value) 28: { 29: Value = value; 30: CachedTime = _timeGenerator(); 31: } 32: } Then, we can use this construct to unit test our CacheItem<T> without any time dependencies: 1: var baseTime = DateTime.Now; 2:  3: // start with current time stored above (so doesn't drift) 4: CacheItem<int>.TimeGenerator = () => baseTime; 5:  6: var target = new CacheItem<int>(13); 7:  8: // now add 15 seconds, should still be non-expired 9: CacheItem<int>.TimeGenerator = () => baseTime.AddSeconds(15); 10:  11: Assert.IsFalse(target.IsExpired); 12:  13: // now add 31 seconds, should now be expired 14: CacheItem<int>.TimeGenerator = () => baseTime.AddSeconds(31); 15:  16: Assert.IsTrue(target.IsExpired); Now we can unit test for 1 second before, 1 second after, 1 millisecond before, 1 day after, etc.  Func delegates can be a handy tool for this type of value generation to support more testable code.  Summary Generic delegates give us a lot of power to make truly generic algorithms and classes.  The Func family of delegates is a great way to be able to specify functions to calculate a result based on 0-16 arguments.  Stay tuned in the weeks that follow for other generic delegates in the .NET Framework!   Tweet Technorati Tags: .NET, C#, CSharp, Little Wonders, Generics, Func, Delegates

    Read the article

  • Oracle HRMS API – Update Employee Assignment

    - by PRajkumar
    To Update Supervisor, Manager Flag, Bargaining Unit, Labour Union Member Flag, Gre, Time Card, Work Schedule, Normal Hours, Frequency, Time Normal Finish, Time Normal Start, Default Code Combination, Set of Books Id API -- hr_assignment_api.update_emp_asg   To Update Grade, Location, Job, Payroll, Organization, Employee Category, People Group API -- hr_assignment_api.update_emp_asg_criteria   Example --   DECLARE    -- Local Variables    -- -----------------------    lc_dt_ud_mode           VARCHAR2(100)    := NULL;    ln_assignment_id       NUMBER                  := 33561;    ln_supervisor_id        NUMBER                  := 2;    ln_object_number       NUMBER                  := 1;    ln_people_group_id  NUMBER                  := 1;      -- Out Variables for Find Date Track Mode API    -- -----------------------------------------------------------------    lb_correction                           BOOLEAN;    lb_update                                 BOOLEAN;    lb_update_override              BOOLEAN;    lb_update_change_insert   BOOLEAN;       -- Out Variables for Update Employee Assignment API    -- ----------------------------------------------------------------------------    ln_soft_coding_keyflex_id       HR_SOFT_CODING_KEYFLEX.SOFT_CODING_KEYFLEX_ID%TYPE;    lc_concatenated_segments       VARCHAR2(2000);    ln_comment_id                             PER_ALL_ASSIGNMENTS_F.COMMENT_ID%TYPE;    lb_no_managers_warning        BOOLEAN;  -- Out Variables for Update Employee Assgment Criteria  -- -------------------------------------------------------------------------------  ln_special_ceiling_step_id                    PER_ALL_ASSIGNMENTS_F.SPECIAL_CEILING_STEP_ID%TYPE;  lc_group_name                                          VARCHAR2(30);  ld_effective_start_date                             PER_ALL_ASSIGNMENTS_F.EFFECTIVE_START_DATE%TYPE;  ld_effective_end_date                              PER_ALL_ASSIGNMENTS_F.EFFECTIVE_END_DATE%TYPE;  lb_org_now_no_manager_warning   BOOLEAN;  lb_other_manager_warning                  BOOLEAN;  lb_spp_delete_warning                          BOOLEAN;  lc_entries_changed_warning                VARCHAR2(30);  lb_tax_district_changed_warn             BOOLEAN;   BEGIN    -- Find Date Track Mode    -- --------------------------------    dt_api.find_dt_upd_modes    (    p_effective_date                  => TO_DATE('12-JUN-2011'),         p_base_table_name            => 'PER_ALL_ASSIGNMENTS_F',         p_base_key_column           => 'ASSIGNMENT_ID',         p_base_key_value               => ln_assignment_id,          -- Output data elements          -- --------------------------------          p_correction                          => lb_correction,          p_update                                => lb_update,          p_update_override              => lb_update_override,          p_update_change_insert   => lb_update_change_insert      );      IF ( lb_update_override = TRUE OR lb_update_change_insert = TRUE )    THEN        -- UPDATE_OVERRIDE        -- ---------------------------------        lc_dt_ud_mode := 'UPDATE_OVERRIDE';    END IF;     IF ( lb_correction = TRUE )   THEN       -- CORRECTION       -- ----------------------      lc_dt_ud_mode := 'CORRECTION';   END IF;     IF ( lb_update = TRUE )   THEN       -- UPDATE       -- --------------       lc_dt_ud_mode := 'UPDATE';    END IF;     -- Update Employee Assignment   -- ---------------------------------------------  hr_assignment_api.update_emp_asg  ( -- Input data elements   -- ------------------------------   p_effective_date                              => TO_DATE('12-JUN-2011'),   p_datetrack_update_mode         => lc_dt_ud_mode,   p_assignment_id                            => ln_assignment_id,   p_supervisor_id                              => NULL,   p_change_reason                           => NULL,   p_manager_flag                              => 'N',   p_bargaining_unit_code              => NULL,   p_labour_union_member_flag   => NULL,   p_segment1                                       => 204,   p_segment3                                       => 'N',   p_normal_hours                              => 10,   p_frequency                                       => 'W',   -- Output data elements   -- -------------------------------   p_object_version_number             => ln_object_number,   p_soft_coding_keyflex_id              => ln_soft_coding_keyflex_id,   p_concatenated_segments             => lc_concatenated_segments,   p_comment_id                                   => ln_comment_id,   p_effective_start_date                      => ld_effective_start_date,   p_effective_end_date                        => ld_effective_end_date,   p_no_managers_warning               => lb_no_managers_warning,   p_other_manager_warning            => lb_other_manager_warning  );    -- Find Date Track Mode for Second API   -- ------------------------------------------------------   dt_api.find_dt_upd_modes   (  p_effective_date                   => TO_DATE('12-JUN-2011'),      p_base_table_name            => 'PER_ALL_ASSIGNMENTS_F',      p_base_key_column           => 'ASSIGNMENT_ID',      p_base_key_value               => ln_assignment_id,      -- Output data elements      -- -------------------------------      p_correction                           => lb_correction,      p_update                                 => lb_update,      p_update_override               => lb_update_override,      p_update_change_insert    => lb_update_change_insert   );     IF ( lb_update_override = TRUE OR lb_update_change_insert = TRUE )   THEN     -- UPDATE_OVERRIDE     -- --------------------------------     lc_dt_ud_mode := 'UPDATE_OVERRIDE';   END IF;      IF ( lb_correction = TRUE )    THEN      -- CORRECTION      -- ----------------------      lc_dt_ud_mode := 'CORRECTION';   END IF;      IF ( lb_update = TRUE )    THEN      -- UPDATE      -- --------------      lc_dt_ud_mode := 'UPDATE';    END IF;    -- Update Employee Assgment Criteria  -- -----------------------------------------------------  hr_assignment_api.update_emp_asg_criteria  ( -- Input data elements   -- ------------------------------   p_effective_date                                   => TO_DATE('12-JUN-2011'),   p_datetrack_update_mode               => lc_dt_ud_mode,   p_assignment_id                                 => ln_assignment_id,   p_location_id                                        => 204,   p_grade_id                                             => 29,   p_job_id                                                  => 16,   p_payroll_id                                          => 52,   p_organization_id                               => 239,   p_employment_category                    => 'FR',   -- Output data elements   -- -------------------------------   p_people_group_id                              => ln_people_group_id,   p_object_version_number                   => ln_object_number,   p_special_ceiling_step_id                  => ln_special_ceiling_step_id,   p_group_name                                        => lc_group_name,   p_effective_start_date                           => ld_effective_start_date,   p_effective_end_date                             => ld_effective_end_date,   p_org_now_no_manager_warning  => lb_org_now_no_manager_warning,   p_other_manager_warning                 => lb_other_manager_warning,   p_spp_delete_warning                         => lb_spp_delete_warning,   p_entries_changed_warning              => lc_entries_changed_warning,   p_tax_district_changed_warning     => lb_tax_district_changed_warn  );    COMMIT; EXCEPTION          WHEN OTHERS THEN                       ROLLBACK;                       dbms_output.put_line(SQLERRM); END; / SHOW ERR;    

    Read the article

  • Use Glassfish JMS from remote client

    - by James
    Hi, I have glassfish installed on a server with a JMS ConnectionFactory set up jms/MyConnectionFactory with a resource type or javax.jms.ConnectionFactory. I now want to access this from a client application on my local machine for this I have the following: public static void main(String[] args) { try{ Properties env = new Properties(); env.setProperty("java.naming.factory.initial", "com.sun.enterprise.naming.SerialInitContextFactory"); env.setProperty("java.naming.factory.url.pkgs", "com.sun.enterprise.naming"); env.setProperty("java.naming.factory.state", "com.sun.corba.ee.impl.presentation.rmi.JNDIStateFactoryImpl"); env.setProperty("org.omg.CORBA.ORBInitialHost", "10.97.3.74"); env.setProperty("org.omg.CORBA.ORBInitialPort", "3700"); InitialContext initialContext = new InitialContext(env); ConnectionFactory connectionFactory = null; try { connectionFactory = (ConnectionFactory) initialContext.lookup("jms/MyConnectionFactory"); } catch (Exception e) { System.out.println("JNDI API lookup failed: " + e.toString()); e.printStackTrace(); System.exit(1); } }catch(Exception e){ e.printStackTrace(System.err); } } When I run my client I get the following output: INFO: Using com.sun.enterprise.transaction.jts.JavaEETransactionManagerJTSDelegate as the delegate {org.omg.CORBA.ORBInitialPort=3700, java.naming.factory.initial=com.sun.enterprise.naming.SerialInitContextFactory, org.omg.CORBA.ORBInitialHost=10.97.3.74, java.naming.factory.state=com.sun.corba.ee.impl.presentation.rmi.JNDIStateFactoryImpl, java.naming.factory.url.pkgs=com.sun.enterprise.naming} 19-Mar-2010 16:09:13 org.hibernate.validator.util.Version <clinit> INFO: Hibernate Validator bean-validator-3.0-JBoss-4.0.2 19-Mar-2010 16:09:13 org.hibernate.validator.engine.resolver.DefaultTraversableResolver detectJPA INFO: Instantiated an instance of org.hibernate.validator.engine.resolver.JPATraversableResolver. 19-Mar-2010 16:09:13 com.sun.messaging.jms.ra.ResourceAdapter start INFO: MQJMSRA_RA1101: SJSMQ JMS Resource Adapter starting: REMOTE 19-Mar-2010 16:09:13 com.sun.messaging.jms.ra.ResourceAdapter start INFO: MQJMSRA_RA1101: SJSMQ JMSRA Started:REMOTE 19-Mar-2010 16:09:13 com.sun.enterprise.naming.impl.SerialContext lookup SEVERE: enterprise_naming.serialctx_communication_exception 19-Mar-2010 16:09:13 com.sun.enterprise.naming.impl.SerialContext lookup SEVERE: java.lang.RuntimeException: com.sun.appserv.connectors.internal.api.ConnectorRuntimeException: This pool is not bound in JNDI : jms/MyConnectionFactory at com.sun.enterprise.resource.naming.ConnectorObjectFactory.getObjectInstance(ConnectorObjectFactory.java:159) at javax.naming.spi.NamingManager.getObjectInstance(NamingManager.java:304) at com.sun.enterprise.naming.impl.SerialContext.getObjectInstance(SerialContext.java:472) at com.sun.enterprise.naming.impl.SerialContext.lookup(SerialContext.java:437) at javax.naming.InitialContext.lookup(InitialContext.java:392) at simpleproducerclient.Main.main(Main.java:89) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.glassfish.appclient.client.acc.AppClientContainer.launch(AppClientContainer.java:424) at org.glassfish.appclient.client.AppClientFacade.main(AppClientFacade.java:134) Caused by: com.sun.appserv.connectors.internal.api.ConnectorRuntimeException: This pool is not bound in JNDI : jms/MyConnectionFactory at com.sun.enterprise.connectors.service.ConnectorConnectionPoolAdminServiceImpl.obtainManagedConnectionFactory(ConnectorConnectionPoolAdminServiceImpl.java:1017) at com.sun.enterprise.connectors.ConnectorRuntime.obtainManagedConnectionFactory(ConnectorRuntime.java:375) at com.sun.enterprise.resource.naming.ConnectorObjectFactory.getObjectInstance(ConnectorObjectFactory.java:124) ... 11 more Caused by: javax.naming.NamingException: Lookup failed for '__SYSTEM/pools/jms/MyConnectionFactory' in SerialContext targetHost=localhost,targetPort=3700,orb'sInitialHost=ithfdv01,orb'sInitialPort=3700 [Root exception is javax.naming.NameNotFoundException: pools] at com.sun.enterprise.naming.impl.SerialContext.lookup(SerialContext.java:442) at javax.naming.InitialContext.lookup(InitialContext.java:392) at com.sun.enterprise.connectors.service.ConnectorConnectionPoolAdminServiceImpl.getConnectorConnectionPool(ConnectorConnectionPoolAdminServiceImpl.java:804) at com.sun.enterprise.connectors.service.ConnectorConnectionPoolAdminServiceImpl.obtainManagedConnectionFactory(ConnectorConnectionPoolAdminServiceImpl.java:932) ... 13 more Caused by: javax.naming.NameNotFoundException: pools at com.sun.enterprise.naming.impl.TransientContext.resolveContext(TransientContext.java:252) at com.sun.enterprise.naming.impl.TransientContext.lookup(TransientContext.java:171) at com.sun.enterprise.naming.impl.TransientContext.lookup(TransientContext.java:172) at com.sun.enterprise.naming.impl.SerialContextProviderImpl.lookup(SerialContextProviderImpl.java:58) at com.sun.enterprise.naming.impl.RemoteSerialContextProviderImpl.lookup(RemoteSerialContextProviderImpl.java:89) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at com.sun.corba.ee.impl.presentation.rmi.ReflectiveTie.dispatchToMethod(ReflectiveTie.java:146) at com.sun.corba.ee.impl.presentation.rmi.ReflectiveTie._invoke(ReflectiveTie.java:176) at com.sun.corba.ee.impl.protocol.CorbaServerRequestDispatcherImpl.dispatchToServant(CorbaServerRequestDispatcherImpl.java:682) at com.sun.corba.ee.impl.protocol.CorbaServerRequestDispatcherImpl.dispatch(CorbaServerRequestDispatcherImpl.java:216) at com.sun.corba.ee.impl.protocol.CorbaMessageMediatorImpl.handleRequestRequest(CorbaMessageMediatorImpl.java:1841) at com.sun.corba.ee.impl.protocol.CorbaMessageMediatorImpl.handleRequest(CorbaMessageMediatorImpl.java:1695) at com.sun.corba.ee.impl.protocol.CorbaMessageMediatorImpl.handleInput(CorbaMessageMediatorImpl.java:1078) at com.sun.corba.ee.impl.protocol.giopmsgheaders.RequestMessage_1_2.callback(RequestMessage_1_2.java:221) at com.sun.corba.ee.impl.protocol.CorbaMessageMediatorImpl.handleRequest(CorbaMessageMediatorImpl.java:797) at com.sun.corba.ee.impl.protocol.CorbaMessageMediatorImpl.dispatch(CorbaMessageMediatorImpl.java:561) JNDI API lookup failed: javax.naming.CommunicationException: Communication exception for SerialContext targetHost=10.97.3.74,targetPort=3700,orb'sInitialHost=ithfdv01,orb'sInitialPort=3700 [Root exception is java.lang.RuntimeException: com.sun.appserv.connectors.internal.api.ConnectorRuntimeException: This pool is not bound in JNDI : jms/MyConnectionFactory] at com.sun.corba.ee.impl.protocol.CorbaMessageMediatorImpl.doWork(CorbaMessageMediatorImpl.java:2558) at com.sun.corba.ee.impl.orbutil.threadpool.ThreadPoolImpl$WorkerThread.performWork(ThreadPoolImpl.java:492) at com.sun.corba.ee.impl.orbutil.threadpool.ThreadPoolImpl$WorkerThread.run(ThreadPoolImpl.java:528) javax.naming.CommunicationException: Communication exception for SerialContext targetHost=10.97.3.74,targetPort=3700,orb'sInitialHost=ithfdv01,orb'sInitialPort=3700 [Root exception is java.lang.RuntimeException: com.sun.appserv.connectors.internal.api.ConnectorRuntimeException: This pool is not bound in JNDI : jms/MyConnectionFactory] at com.sun.enterprise.naming.impl.SerialContext.lookup(SerialContext.java:461) at javax.naming.InitialContext.lookup(InitialContext.java:392) at simpleproducerclient.Main.main(Main.java:89) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.glassfish.appclient.client.acc.AppClientContainer.launch(AppClientContainer.java:424) at org.glassfish.appclient.client.AppClientFacade.main(AppClientFacade.java:134) Caused by: java.lang.RuntimeException: com.sun.appserv.connectors.internal.api.ConnectorRuntimeException: This pool is not bound in JNDI : jms/MyConnectionFactory at com.sun.enterprise.resource.naming.ConnectorObjectFactory.getObjectInstance(ConnectorObjectFactory.java:159) at javax.naming.spi.NamingManager.getObjectInstance(NamingManager.java:304) at com.sun.enterprise.naming.impl.SerialContext.getObjectInstance(SerialContext.java:472) at com.sun.enterprise.naming.impl.SerialContext.lookup(SerialContext.java:437) ... 8 more Caused by: com.sun.appserv.connectors.internal.api.ConnectorRuntimeException: This pool is not bound in JNDI : jms/MyConnectionFactory at com.sun.enterprise.connectors.service.ConnectorConnectionPoolAdminServiceImpl.obtainManagedConnectionFactory(ConnectorConnectionPoolAdminServiceImpl.java:1017) at com.sun.enterprise.connectors.ConnectorRuntime.obtainManagedConnectionFactory(ConnectorRuntime.java:375) at com.sun.enterprise.resource.naming.ConnectorObjectFactory.getObjectInstance(ConnectorObjectFactory.java:124) ... 11 more Caused by: javax.naming.NamingException: Lookup failed for '__SYSTEM/pools/jms/MyConnectionFactory' in SerialContext targetHost=localhost,targetPort=3700,orb'sInitialHost=ithfdv01,orb'sInitialPort=3700 [Root exception is javax.naming.NameNotFoundException: pools] at com.sun.enterprise.naming.impl.SerialContext.lookup(SerialContext.java:442) at javax.naming.InitialContext.lookup(InitialContext.java:392) at com.sun.enterprise.connectors.service.ConnectorConnectionPoolAdminServiceImpl.getConnectorConnectionPool(ConnectorConnectionPoolAdminServiceImpl.java:804) at com.sun.enterprise.connectors.service.ConnectorConnectionPoolAdminServiceImpl.obtainManagedConnectionFactory(ConnectorConnectionPoolAdminServiceImpl.java:932) ... 13 more Caused by: javax.naming.NameNotFoundException: pools at com.sun.enterprise.naming.impl.TransientContext.resolveContext(TransientContext.java:252) at com.sun.enterprise.naming.impl.TransientContext.lookup(TransientContext.java:171) at com.sun.enterprise.naming.impl.TransientContext.lookup(TransientContext.java:172) at com.sun.enterprise.naming.impl.SerialContextProviderImpl.lookup(SerialContextProviderImpl.java:58) at com.sun.enterprise.naming.impl.RemoteSerialContextProviderImpl.lookup(RemoteSerialContextProviderImpl.java:89) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at com.sun.corba.ee.impl.presentation.rmi.ReflectiveTie.dispatchToMethod(ReflectiveTie.java:146) at com.sun.corba.ee.impl.presentation.rmi.ReflectiveTie._invoke(ReflectiveTie.java:176) at com.sun.corba.ee.impl.protocol.CorbaServerRequestDispatcherImpl.dispatchToServant(CorbaServerRequestDispatcherImpl.java:682) at com.sun.corba.ee.impl.protocol.CorbaServerRequestDispatcherImpl.dispatch(CorbaServerRequestDispatcherImpl.java:216) at com.sun.corba.ee.impl.protocol.CorbaMessageMediatorImpl.handleRequestRequest(CorbaMessageMediatorImpl.java:1841) at com.sun.corba.ee.impl.protocol.CorbaMessageMediatorImpl.handleRequest(CorbaMessageMediatorImpl.java:1695) at com.sun.corba.ee.impl.protocol.CorbaMessageMediatorImpl.handleInput(CorbaMessageMediatorImpl.java:1078) at com.sun.corba.ee.impl.protocol.giopmsgheaders.RequestMessage_1_2.callback(RequestMessage_1_2.java:221) at com.sun.corba.ee.impl.protocol.CorbaMessageMediatorImpl.handleRequest(CorbaMessageMediatorImpl.java:797) at com.sun.corba.ee.impl.protocol.CorbaMessageMediatorImpl.dispatch(CorbaMessageMediatorImpl.java:561) at com.sun.corba.ee.impl.protocol.CorbaMessageMediatorImpl.doWork(CorbaMessageMediatorImpl.java:2558) at com.sun.corba.ee.impl.orbutil.threadpool.ThreadPoolImpl$WorkerThread.performWork(ThreadPoolImpl.java:492) at com.sun.corba.ee.impl.orbutil.threadpool.ThreadPoolImpl$WorkerThread.run(ThreadPoolImpl.java:528) I have looked at a number of posts and have tried a number of things with no success. I can run the following commands on my server: ./asadmin list-jndi-entries UserTransaction: com.sun.enterprise.transaction.TransactionNamingProxy$UserTransactionProxy java:global: com.sun.enterprise.naming.impl.TransientContext jdbc: com.sun.enterprise.naming.impl.TransientContext ejb: com.sun.enterprise.naming.impl.TransientContext com.sun.enterprise.container.common.spi.util.InjectionManager: com.sun.enterprise.container.common.impl.util.InjectionManagerImpl jms: com.sun.enterprise.naming.impl.TransientContext Command list-jndi-entries executed successfully. ./asadmin list-jndi-entries --context jms MyTopic: org.glassfish.javaee.services.ResourceProxy MyConnectionFactory: org.glassfish.javaee.services.ResourceProxy MyQueue: org.glassfish.javaee.services.ResourceProxy Command list-jndi-entries executed successfully. Any help is greatly appreciated. Cheers, James

    Read the article

  • creating objects from trivial graph format text file. java. dijkstra algorithm.

    - by user560084
    i want to create objects, vertex and edge, from trivial graph format txt file. one of programmers here suggested that i use trivial graph format to store data for dijkstra algorithm. the problem is that at the moment all the information, e.g., weight, links, is in the sourcecode. i want to have a separate text file for that and read it into the program. i thought about using a code for scanning through the text file by using scanner. but i am not quite sure how to create different objects from the same file. could i have some help please? the file is v0 Harrisburg v1 Baltimore v2 Washington v3 Philadelphia v4 Binghamton v5 Allentown v6 New York # v0 v1 79.83 v0 v5 81.15 v1 v0 79.75 v1 v2 39.42 v1 v3 103.00 v2 v1 38.65 v3 v1 102.53 v3 v5 61.44 v3 v6 96.79 v4 v5 133.04 v5 v0 81.77 v5 v3 62.05 v5 v4 134.47 v5 v6 91.63 v6 v3 97.24 v6 v5 87.94 and the dijkstra algorithm code is Downloaded from: http://en.literateprograms.org/Special:Downloadcode/Dijkstra%27s_algorithm_%28Java%29 */ import java.util.PriorityQueue; import java.util.List; import java.util.ArrayList; import java.util.Collections; class Vertex implements Comparable<Vertex> { public final String name; public Edge[] adjacencies; public double minDistance = Double.POSITIVE_INFINITY; public Vertex previous; public Vertex(String argName) { name = argName; } public String toString() { return name; } public int compareTo(Vertex other) { return Double.compare(minDistance, other.minDistance); } } class Edge { public final Vertex target; public final double weight; public Edge(Vertex argTarget, double argWeight) { target = argTarget; weight = argWeight; } } public class Dijkstra { public static void computePaths(Vertex source) { source.minDistance = 0.; PriorityQueue<Vertex> vertexQueue = new PriorityQueue<Vertex>(); vertexQueue.add(source); while (!vertexQueue.isEmpty()) { Vertex u = vertexQueue.poll(); // Visit each edge exiting u for (Edge e : u.adjacencies) { Vertex v = e.target; double weight = e.weight; double distanceThroughU = u.minDistance + weight; if (distanceThroughU < v.minDistance) { vertexQueue.remove(v); v.minDistance = distanceThroughU ; v.previous = u; vertexQueue.add(v); } } } } public static List<Vertex> getShortestPathTo(Vertex target) { List<Vertex> path = new ArrayList<Vertex>(); for (Vertex vertex = target; vertex != null; vertex = vertex.previous) path.add(vertex); Collections.reverse(path); return path; } public static void main(String[] args) { Vertex v0 = new Vertex("Nottinghill_Gate"); Vertex v1 = new Vertex("High_Street_kensignton"); Vertex v2 = new Vertex("Glouchester_Road"); Vertex v3 = new Vertex("South_Kensignton"); Vertex v4 = new Vertex("Sloane_Square"); Vertex v5 = new Vertex("Victoria"); Vertex v6 = new Vertex("Westminster"); v0.adjacencies = new Edge[]{new Edge(v1, 79.83), new Edge(v6, 97.24)}; v1.adjacencies = new Edge[]{new Edge(v2, 39.42), new Edge(v0, 79.83)}; v2.adjacencies = new Edge[]{new Edge(v3, 38.65), new Edge(v1, 39.42)}; v3.adjacencies = new Edge[]{new Edge(v4, 102.53), new Edge(v2, 38.65)}; v4.adjacencies = new Edge[]{new Edge(v5, 133.04), new Edge(v3, 102.53)}; v5.adjacencies = new Edge[]{new Edge(v6, 81.77), new Edge(v4, 133.04)}; v6.adjacencies = new Edge[]{new Edge(v0, 97.24), new Edge(v5, 81.77)}; Vertex[] vertices = { v0, v1, v2, v3, v4, v5, v6 }; computePaths(v0); for (Vertex v : vertices) { System.out.println("Distance to " + v + ": " + v.minDistance); List<Vertex> path = getShortestPathTo(v); System.out.println("Path: " + path); } } } and the code for scanning file is import java.util.Scanner; import java.io.File; import java.io.FileNotFoundException; public class DataScanner1 { //private int total = 0; //private int distance = 0; private String vector; private String stations; private double [] Edge = new double []; /*public int getTotal(){ return total; } */ /* public void getMenuInput(){ KeyboardInput in = new KeyboardInput; System.out.println("Enter the destination? "); String val = in.readString(); return val; } */ public void readFile(String fileName) { try { Scanner scanner = new Scanner(new File(fileName)); scanner.useDelimiter (System.getProperty("line.separator")); while (scanner.hasNext()) { parseLine(scanner.next()); } scanner.close(); } catch (FileNotFoundException e) { e.printStackTrace(); } } public void parseLine(String line) { Scanner lineScanner = new Scanner(line); lineScanner.useDelimiter("\\s*,\\s*"); vector = lineScanner.next(); stations = lineScanner.next(); System.out.println("The current station is " + vector + " and the destination to the next station is " + stations + "."); //total += distance; //System.out.println("The total distance is " + total); } public static void main(String[] args) { /* if (args.length != 1) { System.err.println("usage: java TextScanner2" + "file location"); System.exit(0); } */ DataScanner1 scanner = new DataScanner1(); scanner.readFile(args[0]); //int total =+ distance; //System.out.println(""); //System.out.println("The total distance is " + scanner.getTotal()); } }

    Read the article

  • Unable to receive any emails using postfix, dovecot, mysql, and virtual domain/mailboxes

    - by stkdev248
    I have been working on configuring my mail server for the last couple of weeks using postfix, dovecot, and mysql. I have one virtual domain and a few virtual mailboxes. Using squirrelmail I have been able to log into my accounts and send emails out (e.g. I can send to googlemail just fine), however I am not able to receive any emails--not from the outside world nor from within my own network. I am able to telnet in using localhost, my private ip, and my public ip on port 25 without any problems (I've tried it from the server itself and from another computer on my network). This is what I get in my logs when I send an email from my googlemail account to my mail server: mail.log Apr 14 07:36:06 server1 postfix/qmgr[1721]: BE01B520538: from=, size=733, nrcpt=1 (queue active) Apr 14 07:36:06 server1 postfix/pipe[3371]: 78BC0520510: to=, relay=dovecot, delay=45421, delays=45421/0/0/0.13, dsn=4.3.0, status=deferred (temporary failure. Command output: Can't open log file /var/log/mail-dovecot.log: Permission denied) Apr 14 07:36:06 server1 postfix/pipe[3391]: 8261B520534: to=, relay=dovecot, delay=38036, delays=38036/0.06/0/0.12, dsn=4.3.0, status=deferred (temporary failure. Command output: Can't open log file /var/log/mail-dovecot.log: Permission denied ) Apr 14 07:36:06 server1 postfix/pipe[3378]: 63927520532: to=, relay=dovecot, delay=38105, delays=38105/0.02/0/0.17, dsn=4.3.0, status=deferred (temporary failure. Command output: Can't open log file /var/log/mail-dovecot.log: Permission denied ) Apr 14 07:36:06 server1 postfix/pipe[3375]: 07F65520522: to=, relay=dovecot, delay=39467, delays=39467/0.01/0/0.17, dsn=4.3.0, status=deferred (temporary failure. Command output: Can't open log file /var/log/mail-dovecot.log: Permission denied ) Apr 14 07:36:06 server1 postfix/pipe[3381]: EEDE9520527: to=, relay=dovecot, delay=38361, delays=38360/0.04/0/0.15, dsn=4.3.0, status=deferred (temporary failure. Command output: Can't open log file /var/log/mail-dovecot.log: Permission denied ) Apr 14 07:36:06 server1 postfix/pipe[3379]: 67DFF520517: to=, relay=dovecot, delay=40475, delays=40475/0.03/0/0.16, dsn=4.3.0, status=deferred (temporary failure. Command output: Can't open log file /var/log/mail-dovecot.log: Permission denied ) Apr 14 07:36:06 server1 postfix/pipe[3387]: 3C7A052052E: to=, relay=dovecot, delay=38259, delays=38259/0.05/0/0.13, dsn=4.3.0, status=deferred (temporary failure. Command output: Can't open log file /var/log/mail-dovecot.log: Permission denied ) Apr 14 07:36:06 server1 postfix/pipe[3394]: BE01B520538: to=, relay=dovecot, delay=37682, delays=37682/0.07/0/0.11, dsn=4.3.0, status=deferred (temporary failure. Command output: Can't open log file /var/log/mail-dovecot.log: Permission denied ) Apr 14 07:36:07 server1 postfix/pipe[3384]: 3C7A052052E: to=, relay=dovecot, delay=38261, delays=38259/0.04/0/1.3, dsn=4.3.0, status=deferred (temporary failure. Command output: Can't open log file /var/log/mail-dovecot.log: Permission denied ) Apr 14 07:39:23 server1 postfix/anvil[3368]: statistics: max connection rate 1/60s for (smtp:209.85.213.169) at Apr 14 07:35:32 Apr 14 07:39:23 server1 postfix/anvil[3368]: statistics: max connection count 1 for (smtp:209.85.213.169) at Apr 14 07:35:32 Apr 14 07:39:23 server1 postfix/anvil[3368]: statistics: max cache size 1 at Apr 14 07:35:32 Apr 14 07:41:06 server1 postfix/qmgr[1721]: ED6005203B7: from=, size=1463, nrcpt=1 (queue active) Apr 14 07:41:06 server1 postfix/pipe[4594]: ED6005203B7: to=, relay=dovecot, delay=334, delays=334/0.01/0/0.13, dsn=4.3.0, status=deferred (temporary failure. Command output: Can't open log file /var/log/mail-dovecot.log: Permission denied ) Apr 14 07:51:06 server1 postfix/qmgr[1721]: ED6005203B7: from=, size=1463, nrcpt=1 (queue active) Apr 14 07:51:06 server1 postfix/pipe[4604]: ED6005203B7: to=, relay=dovecot, delay=933, delays=933/0.02/0/0.12, dsn=4.3.0, status=deferred (temporary failure. Command output: Can't open log file /var/log/mail-dovecot.log: Permission denied ) mail-dovecot-log (the log I set for debugging): Apr 14 07:28:26 auth: Info: mysql(127.0.0.1): Connected to database postfixadmin Apr 14 07:28:26 auth: Debug: sql([email protected],127.0.0.1): query: SELECT password FROM mailbox WHERE username = '[email protected]' Apr 14 07:28:26 auth: Debug: client out: OK 1 [email protected] Apr 14 07:28:26 auth: Debug: master in: REQUEST 1809973249 3356 1 7cfb822db820fc5da67d0776b107cb3f Apr 14 07:28:26 auth: Debug: sql([email protected],127.0.0.1): SELECT '/home/vmail/mydomain.com/some.user1' as home, 5000 AS uid, 5000 AS gid FROM mailbox WHERE username = '[email protected]' Apr 14 07:28:26 auth: Debug: master out: USER 1809973249 [email protected] home=/home/vmail/mydomain.com/some.user1 uid=5000 gid=5000 Apr 14 07:28:26 imap-login: Info: Login: user=, method=PLAIN, rip=127.0.0.1, lip=127.0.0.1, mpid=3360, secured Apr 14 07:28:26 imap([email protected]): Debug: Effective uid=5000, gid=5000, home=/home/vmail/mydomain.com/some.user1 Apr 14 07:28:26 imap([email protected]): Debug: maildir++: root=/home/vmail/mydomain.com/some.user1/Maildir, index=/home/vmail/mydomain.com/some.user1/Maildir/indexes, control=, inbox=/home/vmail/mydomain.com/some.user1/Maildir Apr 14 07:48:31 imap([email protected]): Info: Disconnected: Logged out bytes=85/681 From the output above I'm pretty sure that my problems all stem from (temporary failure. Command output: Can't open log file /var/log/mail-dovecot.log: Permission denied ), but I have no idea why I'm getting that error. I've have the permissions to that log set just like the other mail logs: root@server1:~# ls -l /var/log/mail* -rw-r----- 1 syslog adm 196653 2012-04-14 07:58 /var/log/mail-dovecot.log -rw-r----- 1 syslog adm 62778 2012-04-13 21:04 /var/log/mail.err -rw-r----- 1 syslog adm 497767 2012-04-14 08:01 /var/log/mail.log Does anyone have any idea what I may be doing wrong? Here are my main.cf and master.cf files: main.cf: # See /usr/share/postfix/main.cf.dist for a commented, more complete version # Debian specific: Specifying a file name will cause the first # line of that file to be used as the name. The Debian default # is /etc/mailname. #myorigin = /etc/mailname smtpd_banner = $myhostname ESMTP $mail_name (Ubuntu) biff = no # appending .domain is the MUA's job. append_dot_mydomain = no # Uncomment the next line to generate "delayed mail" warnings #delay_warning_time = 4h readme_directory = no # TLS parameters smtpd_tls_cert_file=/etc/ssl/certs/ssl-cert-snakeoil.pem smtpd_tls_key_file=/etc/ssl/private/ssl-cert-snakeoil.key smtpd_use_tls=yes smtpd_tls_session_cache_database = btree:${data_directory}/smtpd_scache smtp_tls_session_cache_database = btree:${data_directory}/smtp_scache # See /usr/share/doc/postfix/TLS_README.gz in the postfix-doc package for # information on enabling SSL in the smtp client. myhostname = server1.mydomain.com alias_maps = hash:/etc/aliases alias_database = hash:/etc/aliases myorigin = /etc/mailname mydestination = relayhost = mynetworks = 127.0.0.0/8 [::ffff:127.0.0.0]/104 [::1]/128 mailbox_command = procmail -a "$EXTENSION" mailbox_size_limit = 0 recipient_delimiter = + inet_interfaces = all # Virtual Configs virtual_uid_maps = static:5000 virtual_gid_maps = static:5000 virtual_mailbox_base = /home/vmail virtual_mailbox_domains = mysql:/etc/postfix/mysql_virtual_mailbox_domains.cf virtual_mailbox_maps = mysql:/etc/postfix/mysql_virtual_mailbox_maps.cf virtual_alias_maps = mysql:/etc/postfix/mysql_virtual_alias_maps.cf relay_domains = mysql:/etc/postfix/mysql_relay_domains.cf smtpd_recipient_restrictions = permit_mynetworks, permit_sasl_authenticated, reject_non_fqdn_hostname, reject_non_fqdn_sender, reject_non_fqdn_recipient, reject_unauth_destination, reject_unauth_pipelining, reject_invalid_hostname smtpd_sasl_auth_enable = yes smtpd_sasl_security_options = noanonymous virtual_transport=dovecot dovecot_destination_recipient_limit = 1 master.cf: # # Postfix master process configuration file. For details on the format # of the file, see the master(5) manual page (command: "man 5 master"). # # Do not forget to execute "postfix reload" after editing this file. # # ========================================================================== # service type private unpriv chroot wakeup maxproc command + args # (yes) (yes) (yes) (never) (100) # ========================================================================== smtp inet n - - - - smtpd #smtp inet n - - - 1 postscreen #smtpd pass - - - - - smtpd #dnsblog unix - - - - 0 dnsblog #tlsproxy unix - - - - 0 tlsproxy #submission inet n - - - - smtpd # -o smtpd_tls_security_level=encrypt # -o smtpd_sasl_auth_enable=yes # -o smtpd_client_restrictions=permit_sasl_authenticated,reject # -o milter_macro_daemon_name=ORIGINATING #smtps inet n - - - - smtpd # -o smtpd_tls_wrappermode=yes # -o smtpd_sasl_auth_enable=yes # -o smtpd_client_restrictions=permit_sasl_authenticated,reject # -o milter_macro_daemon_name=ORIGINATING #628 inet n - - - - qmqpd pickup fifo n - - 60 1 pickup cleanup unix n - - - 0 cleanup qmgr fifo n - n 300 1 qmgr #qmgr fifo n - - 300 1 oqmgr tlsmgr unix - - - 1000? 1 tlsmgr rewrite unix - - - - - trivial-rewrite bounce unix - - - - 0 bounce defer unix - - - - 0 bounce trace unix - - - - 0 bounce verify unix - - - - 1 verify flush unix n - - 1000? 0 flush proxymap unix - - n - - proxymap proxywrite unix - - n - 1 proxymap smtp unix - - - - - smtp # When relaying mail as backup MX, disable fallback_relay to avoid MX loops relay unix - - - - - smtp -o smtp_fallback_relay= # -o smtp_helo_timeout=5 -o smtp_connect_timeout=5 showq unix n - - - - showq error unix - - - - - error retry unix - - - - - error discard unix - - - - - discard local unix - n n - - local virtual unix - n n - - virtual lmtp unix - - - - - lmtp anvil unix - - - - 1 anvil scache unix - - - - 1 scache # # ==================================================================== # Interfaces to non-Postfix software. Be sure to examine the manual # pages of the non-Postfix software to find out what options it wants. # # Many of the following services use the Postfix pipe(8) delivery # agent. See the pipe(8) man page for information about ${recipient} # and other message envelope options. # ==================================================================== # # maildrop. See the Postfix MAILDROP_README file for details. # Also specify in main.cf: maildrop_destination_recipient_limit=1 # maildrop unix - n n - - pipe flags=DRhu user=vmail argv=/usr/bin/maildrop -d ${recipient} # # ==================================================================== # # Recent Cyrus versions can use the existing "lmtp" master.cf entry. # # Specify in cyrus.conf: # lmtp cmd="lmtpd -a" listen="localhost:lmtp" proto=tcp4 # # Specify in main.cf one or more of the following: # mailbox_transport = lmtp:inet:localhost # virtual_transport = lmtp:inet:localhost # # ==================================================================== # # Cyrus 2.1.5 (Amos Gouaux) # Also specify in main.cf: cyrus_destination_recipient_limit=1 # #cyrus unix - n n - - pipe # user=cyrus argv=/cyrus/bin/deliver -e -r ${sender} -m ${extension} ${user} # # ==================================================================== # Old example of delivery via Cyrus. # #old-cyrus unix - n n - - pipe # flags=R user=cyrus argv=/cyrus/bin/deliver -e -m ${extension} ${user} # # ==================================================================== # # See the Postfix UUCP_README file for configuration details. # uucp unix - n n - - pipe flags=Fqhu user=uucp argv=uux -r -n -z -a$sender - $nexthop!rmail ($recipient) # # Other external delivery methods. # ifmail unix - n n - - pipe flags=F user=ftn argv=/usr/lib/ifmail/ifmail -r $nexthop ($recipient) bsmtp unix - n n - - pipe flags=Fq. user=bsmtp argv=/usr/lib/bsmtp/bsmtp -t$nexthop -f$sender $recipient scalemail-backend unix - n n - 2 pipe flags=R user=scalemail argv=/usr/lib/scalemail/bin/scalemail-store ${nexthop} ${user} ${extension} mailman unix - n n - - pipe flags=FR user=list argv=/usr/lib/mailman/bin/postfix-to-mailman.py ${nexthop} ${user} dovecot unix - n n - - pipe flags=DRhu user=vmail:vmail argv=/usr/lib/dovecot/deliver -d ${recipient}

    Read the article

< Previous Page | 47 48 49 50 51 52  | Next Page >