Search Results

Search found 13351 results on 535 pages for 'standard edition'.

Page 526/535 | < Previous Page | 522 523 524 525 526 527 528 529 530 531 532 533  | Next Page >

  • Repeating Group Messages in Quickfix C++

    - by Mark Jackson
    We cannot seem to process some group messages with QuickFix. I am trying to set up a connection with the ICE exchange using QuickFix (C++). I have created a custom data dictionary to handle ICE's non-standard messages. The first message to handle is a SecurityDefinition. The message contains about 13000 entries broken into blocks of 100. I attached the message below (the first two entries with CR/LF added for clarity). My question is in the data dictionary, I defined a group as part of the entry with all the fields they specify in the group. Yet the message is rejected before it gets to the cracker as having an invalid tag (tag = 305). Message 2 Rejected: Tag not defined for this message type:305 Does this dictionary entry look correct. Is there any documentation anywhere on how to handle group messages? Dictionary entry <message name='SecurityDefinition' msgcat='app' msgtype='d'> <field name='SecurityResponseID' required='Y' /> <field name='SecurityResponseType' required='Y' /> <field name='SecurityReqID' required='Y' /> <field name='TotNoRelatedSym' required='N' /> <field name='NoRpts' required='N' /> <field name='ListSeqNo' required='N' /> <group name='NoUnderlyings' required='N'> <field name='UnderlyingSymbol' required='N' /> <field name='UnderlyingSecurityID' required='N' /> <field name='UnderlyingSecurityIDSource' required='N' /> <field name='UnderlyingCFICode' required='N' /> <field name='UnderlyingSecurityDesc' required='N' /> <field name='UnderlyingMaturityDate' required='N' /> <field name='UnderlyingContractMultiplier' required='N' /> <field name='IncrementPrice' required='N' /> <field name='IncrementQty' required='N' /> <field name='LotSize' required='N' /> <field name='NumofCycles' required='N' /> <field name='LotSizeMultiplier' required='N' /> <field name='Clearable' required='N' /> <field name='StripId' required='N' /> <field name='StripType' required='N' /> <field name='StripName' required='N' /> <field name='HubId' required='N' /> <field name='HubName' required='N' /> <field name='HubAlias' required='N' /> <field name='UnderlyingUnitOfMeasure' required='N' /> <field name='PriceDenomination' required='N' /> <field name='PriceUnit' required='N' /> <field name='Granularity' required='N' /> <field name='NumOfDecimalPrice' required='N' /> <field name='NumOfDecimalQty' required='N' /> <field name='ProductId' required='N' /> <field name='ProductName' required='N' /> <field name='ProductDescription' required='N' /> <field name='TickValue' required='N' /> <field name='ImpliedType' required='N' /> <field name='PrimaryLegSymbol' required='N' /> <field name='SecondaryLegSymbol' required='N' /> <field name='IncrementStrike' required='N' /> <field name='MinStrike' required='N' /> <field name='MaxStrike' required='N' /> </group> </message> The actual message is 8=FIX.4.49=5004335=d49=ICE34=252=20121017-00:39:41.38556=600357=23322=3924323=4320=1393=1310382=13267=1711=100 311=1705282309=TEB SMG0013-TFL SMG0013305=8463=FXXXXX307=NG Basis Futures Spr - TETCO-ELA/TGP-500L - Feb13542=20130131436=1.09013=0.00059014=2500.09017=25009022=289024=19025=Y916=20130201917=201302289201=11969200=129202=Feb139300=60589301=Texas Eastern Transmission Corp. - East Louisiana Zone/Tennessee Gas Pipeline Co. - Zone L, 500 Leg Pool9302=TETCO-ELA/TGP-500L998=MMBtus9100=USD9101=USD / MMBtu9085=daily9083=49084=09061=4909062=NG Basis Futures Spr9063=Natural Gas Basis Futures Spread9032=1.259004=17051939005=1353778 311=1714677309=PGE SQF0014.H0014-SCB SQF0014.H0014305=8463=FXXXXX307=NG Basis Futures Spr - PG&E-Citygate/Socal-Citygate - Q1 14542=20131231436=1.09013=0.00059014=2500.09017=25009022=909024=19025=Y916=20140101917=201403319201=12339200=159202=Q1 149300=59979301=PG&E - Citygate/Socal - Citygate9302=PG&E-Citygate/Socal-Citygate998=MMBtus9100=USD9101=USD / MMBtu9085=daily9083=49084=09061=4909062=NG Basis Futures Spr9063=Natural Gas Basis Futures Spread9032=1.259004=13430529005=1344660

    Read the article

  • Problem measuring N times the execution time of a code block

    - by Nazgulled
    EDIT: I just found my problem after writing this long post explaining every little detail... If someone can give me a good answer on what I'm doing wrong and how can I get the execution time in seconds (using a float with 5 decimal places or so), I'll mark that as accepted. Hint: The problem was on how I interpreted the clock_getttime() man page. Hi, Let's say I have a function named myOperation that I need to measure the execution time of. To measure it, I'm using clock_gettime() as it was recommend here in one of the comments. My teacher recommends us to measure it N times so we can get an average, standard deviation and median for the final report. He also recommends us to execute myOperation M times instead of just one. If myOperation is a very fast operation, measuring it M times allow us to get a sense of the "real time" it takes; cause the clock being used might not have the required precision to measure such operation. So, execution myOperation only one time or M times really depends if the operation itself takes long enough for the clock precision we are using. I'm having trouble dealing with that M times execution. Increasing M decreases (a lot) the final average value. Which doesn't make sense to me. It's like this, on average you take 3 to 5 seconds to travel from point A to B. But then you go from A to B and back to A 5 times (which makes it 10 times, cause A to B is the same as B to A) and you measure that. Than you divide by 10, the average you get is supposed to be the same average you take traveling from point A to B, which is 3 to 5 seconds. This is what I want my code to do, but it's not working. If I keep increasing the number of times I go from A to B and back A, the average will be lower and lower each time, it makes no sense to me. Enough theory, here's my code: #include <stdio.h> #include <time.h> #define MEASUREMENTS 1 #define OPERATIONS 1 typedef struct timespec TimeClock; TimeClock diffTimeClock(TimeClock start, TimeClock end) { TimeClock aux; if((end.tv_nsec - start.tv_nsec) < 0) { aux.tv_sec = end.tv_sec - start.tv_sec - 1; aux.tv_nsec = 1E9 + end.tv_nsec - start.tv_nsec; } else { aux.tv_sec = end.tv_sec - start.tv_sec; aux.tv_nsec = end.tv_nsec - start.tv_nsec; } return aux; } int main(void) { TimeClock sTime, eTime, dTime; int i, j; for(i = 0; i < MEASUREMENTS; i++) { printf(" » MEASURE %02d\n", i+1); clock_gettime(CLOCK_REALTIME, &sTime); for(j = 0; j < OPERATIONS; j++) { myOperation(); } clock_gettime(CLOCK_REALTIME, &eTime); dTime = diffTimeClock(sTime, eTime); printf(" - NSEC (TOTAL): %ld\n", dTime.tv_nsec); printf(" - NSEC (OP): %ld\n\n", dTime.tv_nsec / OPERATIONS); } return 0; } Notes: The above diffTimeClock function is from this blog post. I replaced my real operation with myOperation() because it doesn't make any sense to post my real functions as I would have to post long blocks of code, you can easily code a myOperation() with whatever you like to compile the code if you wish. As you can see, OPERATIONS = 1 and the results are: » MEASURE 01 - NSEC (TOTAL): 27456580 - NSEC (OP): 27456580 For OPERATIONS = 100 the results are: » MEASURE 01 - NSEC (TOTAL): 218929736 - NSEC (OP): 2189297 For OPERATIONS = 1000 the results are: » MEASURE 01 - NSEC (TOTAL): 862834890 - NSEC (OP): 862834 For OPERATIONS = 10000 the results are: » MEASURE 01 - NSEC (TOTAL): 574133641 - NSEC (OP): 57413 Now, I'm not a math wiz, far from it actually, but this doesn't make any sense to me whatsoever. I've already talked about this with a friend that's on this project with me and he also can't understand the differences. I don't understand why the value is getting lower and lower when I increase OPERATIONS. The operation itself should take the same time (on average of course, not the exact same time), no matter how many times I execute it. You could tell me that that actually depends on the operation itself, the data being read and that some data could already be in the cache and bla bla, but I don't think that's the problem. In my case, myOperation is reading 5000 lines of text from an CSV file, separating the values by ; and inserting those values into a data structure. For each iteration, I'm destroying the data structure and initializing it again. Now that I think of it, I also that think that there's a problem measuring time with clock_gettime(), maybe I'm not using it right. I mean, look at the last example, where OPERATIONS = 10000. The total time it took was 574133641ns, which would be roughly 0,5s; that's impossible, it took a couple of minutes as I couldn't stand looking at the screen waiting and went to eat something.

    Read the article

  • How to determine whether a class has a particular templated member function?

    - by Aozine
    I was wondering if it's possible to extend the SFINAE approach to detecting whether a class has a certain member function (as discussed here: "Is there a Technique in C++ to know if a class has a member function of a given signature?" http://stackoverflow.com/questions/87372/is-there-a-technique-in-c-to-know-if-a-class-has-a-member-function-of-a-given-s ) to support templated member functions? E.g. to be able to detect the function foo in the following class: struct some_class { template < int _n > void foo() { } }; I thought it might be possible to do this for a particular instantiation of foo, (e.g. check to see if void foo< 5 >() is a member) as follows: template < typename _class, int _n > class foo_int_checker { template < typename _t, void (_t::*)() > struct sfinae { }; template < typename _t > static big test( sfinae< _t, &_t::foo< _n > > * ); template < typename _t > static small test( ... ); public: enum { value = sizeof( test< _class >( 0 ) ) == sizeof( big ) }; }; Then do foo_int_checker< some_class, 5 >::value to check whether some_class has the member void foo< 5 >(). However on MSVC++ 2008 this always returns false while g++ gives the following syntax errors at the line test( sfinae< _t, &_t::foo< _n > > ); test.cpp:24: error: missing `>' to terminate the template argument list test.cpp:24: error: template argument 2 is invalid test.cpp:24: error: expected unqualified-id before '<' token test.cpp:24: error: expected `,' or `...' before '<' token test.cpp:24: error: ISO C++ forbids declaration of `parameter' with no type Both seem to fail because I'm trying to get the address of a template function instantiation from a type that is itself a template parameter. Does anyone know whether this is possible or if it's disallowed by the standard for some reason? EDIT: It seems that I missed out the ::template syntax to get g++ to compile the above code correctly. If I change the bit where I get the address of the function to &_t::template foo< _n > then the program compiles, but I get the same behaviour as MSVC++ (value is always set to false). If I comment out the ... overload of test to force the compiler to pick the other one, I get the following compiler error in g++: test.cpp: In instantiation of `foo_int_checker<A, 5>': test.cpp:40: instantiated from here test.cpp:32: error: invalid use of undefined type `class foo_int_checker<A, 5>' test.cpp:17: error: declaration of `class foo_int_checker<A, 5>' test.cpp:32: error: enumerator value for `value' not integer constant where line 32 is the enum { value = sizeof( test< _class >( 0 ) ) == sizeof( big ) }; line. Unfortunately this doesn't seem to help me diagnose the problem :(. MSVC++ gives a similar nondescript error: error C2770: invalid explicit template argument(s) for 'clarity::meta::big checker<_checked_type>::test(checker<_checked_type>::sfinae<_t,&_t::template foo<5>> *)' on the same line. What's strange is that if I get the address from a specific class and not a template parameter (i.e. rather than &_t::template foo< _n > I do &some_class::template foo< _n >) then I get the correct result, but then my checker class is limited to checking a single class (some_class) for the function. Also, if I do the following: template < typename _t, void (_t::*_f)() > void f0() { } template < typename _t > void f1() { f0< _t, &_t::template foo< 5 > >(); } and call f1< some_class >() then I DON'T get a compile error on &_t::template foo< 5 >. This suggests that the problem only arises when getting the address of a templated member function from a type that is itself a template parameter while in a SFINAE context. Argh!

    Read the article

  • adjust selected File to FileFilter in a JFileChooser

    - by amarillion
    I'm writing a diagram editor in java. This app has the option to export to various standard image formats such as .jpg, .png etc. When the user clicks File-Export, you get a JFileChooser which has a number of FileFilters in it, for .jpg, .png etc. Now here is my question: Is there a way to have the extension of the default adjust to the selected file filter? E.g. if the document is named "lolcat" then the default option should be "lolcat.png" when the png filter is selected, and when the user selects the jpg file filter, the default should change to "lolcat.jpg" automatically. Is this possible? How can I do it? edit: Based on the answer below, I wrote some code. But it doesn't quite work yet. I've added a propertyChangeListener to the FILE_FILTER_CHANGED_PROPERTY, but it seems that within this method getSelectedFile() returns null. Here is the code. package nl.helixsoft; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.beans.PropertyChangeEvent; import java.beans.PropertyChangeListener; import java.io.File; import java.util.ArrayList; import java.util.List; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.filechooser.FileFilter; public class JFileChooserTest { public class SimpleFileFilter extends FileFilter { private String desc; private List<String> extensions; private boolean showDirectories; /** * @param name example: "Data files" * @param glob example: "*.txt|*.csv" */ public SimpleFileFilter (String name, String globs) { extensions = new ArrayList<String>(); for (String glob : globs.split("\\|")) { if (!glob.startsWith("*.")) throw new IllegalArgumentException("expected list of globs like \"*.txt|*.csv\""); // cut off "*" // store only lower case (make comparison case insensitive) extensions.add (glob.substring(1).toLowerCase()); } desc = name + " (" + globs + ")"; } public SimpleFileFilter(String name, String globs, boolean showDirectories) { this(name, globs); this.showDirectories = showDirectories; } @Override public boolean accept(File file) { if(showDirectories && file.isDirectory()) { return true; } String fileName = file.toString().toLowerCase(); for (String extension : extensions) { if (fileName.endsWith (extension)) { return true; } } return false; } @Override public String getDescription() { return desc; } /** * @return includes '.' */ public String getFirstExtension() { return extensions.get(0); } } void export() { String documentTitle = "lolcat"; final JFileChooser jfc = new JFileChooser(); jfc.setDialogTitle("Export"); jfc.setDialogType(JFileChooser.SAVE_DIALOG); jfc.setSelectedFile(new File (documentTitle)); jfc.addChoosableFileFilter(new SimpleFileFilter("JPEG", "*.jpg")); jfc.addChoosableFileFilter(new SimpleFileFilter("PNG", "*.png")); jfc.addPropertyChangeListener(JFileChooser.FILE_FILTER_CHANGED_PROPERTY, new PropertyChangeListener() { public void propertyChange(PropertyChangeEvent arg0) { System.out.println ("Property changed"); String extold = null; String extnew = null; if (arg0.getOldValue() == null || !(arg0.getOldValue() instanceof SimpleFileFilter)) return; if (arg0.getNewValue() == null || !(arg0.getNewValue() instanceof SimpleFileFilter)) return; SimpleFileFilter oldValue = ((SimpleFileFilter)arg0.getOldValue()); SimpleFileFilter newValue = ((SimpleFileFilter)arg0.getNewValue()); extold = oldValue.getFirstExtension(); extnew = newValue.getFirstExtension(); String filename = "" + jfc.getSelectedFile(); System.out.println ("file: " + filename + " old: " + extold + ", new: " + extnew); if (filename.endsWith(extold)) { filename.replace(extold, extnew); } else { filename += extnew; } jfc.setSelectedFile(new File (filename)); } }); jfc.showDialog(frame, "export"); } JFrame frame; void run() { frame = new JFrame(); JButton btn = new JButton ("export"); frame.add (btn); btn.addActionListener (new ActionListener() { public void actionPerformed(ActionEvent ae) { export(); } }); frame.setSize (300, 300); frame.pack(); frame.setVisible(true); } public static void main(String[] args) { javax.swing.SwingUtilities.invokeLater(new Runnable() { public void run() { JFileChooserTest x = new JFileChooserTest(); x.run(); } }); } }

    Read the article

  • How do I make a simple image-based button with visual states in Silverlight 3?

    - by Jacob
    At my previous company, we created our RIAs using Flex with graphical assets created in Flash. In Flash, you could simply lay out your graphics for different states, i.e. rollover, disabled. Now, I'm working on a Silverlight 3 project. I've been given a bunch of images that need to serve as the graphics for buttons that have a rollover, pressed, and normal state. I cannot figure out how to simply create buttons with different images for different visual states in Visual Studio 2008 or Expression Blend 3. Here's where I am currently. My button is defined like this in the XAML: <Button Style="{StaticResource MyButton}"/> The MyButton style appears as follows: <Style x:Key="MyButton" TargetType="Button"> <Setter Property="Template"> <Setter.Value> <ControlTemplate TargetType="Button"> <Image Source="/Assets/Graphics/mybtn_up.png" Width="54" Height="24"> <VisualStateManager.VisualStateGroups> <VisualStateGroup x:Name="FocusStates"> <VisualState x:Name="Focused"/> <VisualState x:Name="Unfocused"/> </VisualStateGroup> <VisualStateGroup x:Name="CommonStates"> <VisualState x:Name="Normal"/> <VisualState x:Name="MouseOver"/> <VisualState x:Name="Pressed"/> <VisualState x:Name="Disabled"/> </VisualStateGroup> </VisualStateManager.VisualStateGroups> </Image> </ControlTemplate> </Setter.Value> </Setter> </Style> I cannot figure out how to assign a different template to different states, nor how to change the image's source based on which state I'm in. How do I do this? Also, if you know of any good documentation that describes how styles work in Silverlight, that would be great. All of the search results I can come up with are frustratingly unhelpful. Edit: I found a way to change the image via storyboards like this: <Style x:Key="MyButton" TargetType="Button"> <Setter Property="Template"> <Setter.Value> <ControlTemplate TargetType="Button"> <Image Source="/Assets/Graphics/mybtn_up.png" Width="54" Height="24" x:Name="Image"> <VisualStateManager.VisualStateGroups> <VisualStateGroup x:Name="FocusStates"> <VisualState x:Name="Focused"/> <VisualState x:Name="Unfocused"/> </VisualStateGroup> <VisualStateGroup x:Name="CommonStates"> <VisualState x:Name="Normal"/> <VisualState x:Name="MouseOver"> <Storyboard Storyboard.TargetName="Image" Storyboard.TargetProperty="Source"> <ObjectAnimationUsingKeyFrames> <DiscreteObjectKeyFrame KeyTime="0" Value="/Assets/Graphics/mybtn_over.png"/> </ObjectAnimationUsingKeyFrames> </Storyboard> </VisualState> <VisualState x:Name="Pressed"> <Storyboard Storyboard.TargetName="Image" Storyboard.TargetProperty="Source"> <ObjectAnimationUsingKeyFrames> <DiscreteObjectKeyFrame KeyTime="0" Value="/Assets/Graphics/mybtn_active.png"/> </ObjectAnimationUsingKeyFrames> </Storyboard> </VisualState> <VisualState x:Name="Disabled"/> </VisualStateGroup> </VisualStateManager.VisualStateGroups> </Image> </ControlTemplate> </Setter.Value> </Setter> </Style> However, this seems like a strange way of doing things to me. Is there a more standard way of accomplishing this?

    Read the article

  • Completing install of ruby 1.9.3 with Ruby for for Mac OS X 10.7.5 Leopard, Xcode 4.5.2 -- problems with rvm pkg install openssl

    - by user1848361
    First, many thanks in advance for any help. I'm a complete novice with programming and I'm trying to get started with this Ruby on Rails tutorial (http://ruby.railstutorial.org/ruby-on-rails-tutorial-book?version=3.2) I have been trying figure this out for about 7 hours now and since I don't have any hair left to pull out I'm turning to these hallowed pages. I have searched for solutions here again and again. System: Mac OS X 10.7.5 Leopard, Xcode 4.5.2 I installed homebrew and have updated it multiple times I used homebrew to install rvm and have updated it multiple times I installed git The standard ruby on the system (checking with $ ruby -v) is 1.8.7 My problem is that every time I try to use rvm to install a new version of Ruby ($ rvm install 1.9.3) I get the following error: Ruby (and needed base gems) for your selection will be installed shortly. Before it happens, please read and execute the instructions below. Please use a separate terminal to execute any additional commands. Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: : I have performed $ brew install libksba and when I try to do it again it tells me that libksba is installed already. When I type "$ rvm requirements" I get: Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: Right now Ruby requires gcc to compile, but Xcode 4.2 and later no longer ship with gcc. Instead they ship with llvm-gcc (to which gcc is a symlink) and clang, neither of which are supported for building Ruby. Xcode 4.1 was the last version to ship gcc, which was /usr/bin/gcc-4.2. Xcode 4.1 and earlier: - Ruby will build fine. Xcode 4.2 and later (including Command Line Tools for Xcode): - If you have gcc-4.2 (and friends) from an earlier Xcode version, Ruby will build fine. - If you don't have gcc-4.2, you have two options to get it: * Install apple-gcc42 from Homebrew * Install osx-gcc-installer Homebrew: If you are using Homebrew, you can install the apple-gcc42 and required libraries from homebrew/dupes: brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Xcode 4.2+ install or/and Command Line Tools for Xcode is required to provide make and other tools. osx-gcc-installer: If you don't use Homebrew, you can download and install osx-gcc-installer: https://github.com/kennethreitz/osx-gcc-installer. Warning: Installing osx-gcc-installer on top of a recent Xcode is known to cause problems, so you must uninstall Xcode before installing osx-gcc-installer. Afterwards you may install Xcode 4.2+ or Command Line Tools for Xcode if you desire. ** NOTE: Currently, Node.js is having issues building with osx-gcc-installer. The only fix is to install Xcode over osx-gcc-installer. So I assume I have to do something with brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Everything seemed to work fine until "$ rvm pkg install openssl", which returns: Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log Johns-MacBook-Pro:~ thierinvestmentservices$ rvm pkg install openssl Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log make.log reads "[2012-11-23 13:15:28] make /Users/thierinvestmentservices/.rvm/scripts/functions/utility: line 116: make: command not found" and openssl.certs.log reads "[2012-11-23 14:04:04] update_openssl_certs update_openssl_certs () { ( chpwd_functions="" builtin cd $rvm_usr_path/ssl && command curl -O http://curl.haxx.se/ca/cacert.pem && mv cacert.pem cert.pem ) } current path: /Users/thierinvestmentservices command(1): update_openssl_certs /Users/thierinvestmentservices/.rvm/scripts/functions/pkg: line 205: cd: /Users/thierinvestmentservices/.rvm/usr/ssl: No such file or directory" At this point the letters might as well be wingdings I have no idea what is going on. I have tried to install rvm make with something I saw on one forum post but I got a bunch of warnings. If anyone has any suggestions I would be deeply grateful, I am completely in over my head,

    Read the article

  • Scrollbar still is painted after it should be removed

    - by Walter Williams
    I have the following custom control and can place on a form (with AutoScroll set to true and the control anchored left, top and right). If the form is too short for the control, the form correctly resizes the control (to make room for the scroll) and displays the scroll bar. When the control is closed using the close glyph, the control is resized and the scroll bar is removed, but occasionally the scroll bar appears to remain painted. If the form is minimized or moved off-screen, the leftover paint is removed. I've tried Parent.Invalidate and have toyed with it in many ways but to no avail. Any suggestions? (Using VS 2008 Standard) using System; using System.ComponentModel; using System.Drawing; using System.Drawing.Drawing2D; using System.Windows.Forms; namespace GroupPanelTest { public class GroupPanel : GroupBox { #region Members private const Int32 iHeaderHeight = 20; private Int32 iFullHeight = 200; private Boolean bClosed = false; private Rectangle rectCloseGlyphBounds = Rectangle.Empty; private Boolean bIsMoveOverCloseGlyph = false; #endregion #region Properties [DefaultValue(false)] public Boolean Closed { get { return (this.bClosed); } set { if (this.bClosed != value) { this.bClosed = value; if (this.bClosed) { this.iFullHeight = base.Height; base.Height = GroupPanel.iHeaderHeight; } else { base.Height = this.iFullHeight; } foreach (Control con in base.Controls) con.Visible = !this.bClosed; this.Invalidate(); } } } public new Int32 Height { get { return (base.Height); } set { if (value != base.Height) { if (this.Closed) { this.iFullHeight = value; } else { Int32 iOldHeight = base.Height; base.Height = value; } } } } [DefaultValue(typeof(Size), "350,200")] public new Size Size { get { return (base.Size); } set { if (base.Size != value) { base.Size = value; if (!this.Closed) this.iFullHeight = value.Height; } } } [DefaultValue(typeof(Padding), "0,7,0,0")] public new Padding Padding { get { return (base.Padding); } set { base.Padding = value; } } #endregion #region Construction public GroupPanel () { SetStyle(ControlStyles.UserPaint, true); SetStyle(ControlStyles.ResizeRedraw, true); SetStyle(ControlStyles.AllPaintingInWmPaint, true); SetStyle(ControlStyles.OptimizedDoubleBuffer, true); SetStyle(ControlStyles.Selectable, true); this.Size = new Size(350, 200); this.Padding = new Padding(0, 7, 0, 0); // the groupbox will add to that this.rectCloseGlyphBounds = new Rectangle(base.ClientSize.Width - 24, 2, 16, 16); } #endregion #region Overrides protected override void OnSizeChanged (EventArgs e) { this.rectCloseGlyphBounds = new Rectangle(base.ClientSize.Width - 24, 2, 16, 16); base.OnSizeChanged(e); } protected override void OnPaint (PaintEventArgs e) { base.OnPaint(e); // we want all the delegates to receive the events, but we do this first so we can paint over it Graphics g = e.Graphics; g.FillRectangle(SystemBrushes.Window, this.ClientRectangle); Rectangle rectTitle = new Rectangle(0, 0, this.ClientRectangle.Width, GroupPanel.iHeaderHeight); g.FillRectangle(SystemBrushes.Control, rectTitle); g.DrawString(this.Text, this.Font, SystemBrushes.ControlText, new PointF(5.0f, 3.0f)); if (this.bIsMoveOverCloseGlyph) { g.FillRectangle(SystemBrushes.ButtonHighlight, this.rectCloseGlyphBounds); Rectangle rectBorder = this.rectCloseGlyphBounds; rectBorder.Inflate(-1, -1); g.DrawRectangle(SystemPens.Highlight, rectBorder); } using (Pen pen = new Pen(SystemColors.ControlText, 1.6f)) { if (this.Closed) { g.DrawLine(pen, this.rectCloseGlyphBounds.Left + 3, this.rectCloseGlyphBounds.Top + 3, this.rectCloseGlyphBounds.Left + 8, this.rectCloseGlyphBounds.Top + 8); g.DrawLine(pen, this.rectCloseGlyphBounds.Left + 13, this.rectCloseGlyphBounds.Top + 3, this.rectCloseGlyphBounds.Left + 8, this.rectCloseGlyphBounds.Top + 8); g.DrawLine(pen, this.rectCloseGlyphBounds.Left + 3, this.rectCloseGlyphBounds.Top + 7, this.rectCloseGlyphBounds.Left + 8, this.rectCloseGlyphBounds.Top + 12); g.DrawLine(pen, this.rectCloseGlyphBounds.Left + 13, this.rectCloseGlyphBounds.Top + 7, this.rectCloseGlyphBounds.Left + 8, this.rectCloseGlyphBounds.Top + 12); } else { g.DrawLine(pen, this.rectCloseGlyphBounds.Left + 3, this.rectCloseGlyphBounds.Top + 8, this.rectCloseGlyphBounds.Left + 8, this.rectCloseGlyphBounds.Top + 3); g.DrawLine(pen, this.rectCloseGlyphBounds.Left + 13, this.rectCloseGlyphBounds.Top + 8, this.rectCloseGlyphBounds.Left + 8, this.rectCloseGlyphBounds.Top + 3); g.DrawLine(pen, this.rectCloseGlyphBounds.Left + 3, this.rectCloseGlyphBounds.Top + 12, this.rectCloseGlyphBounds.Left + 8, this.rectCloseGlyphBounds.Top + 7); g.DrawLine(pen, this.rectCloseGlyphBounds.Left + 13, this.rectCloseGlyphBounds.Top + 12, this.rectCloseGlyphBounds.Left + 8, this.rectCloseGlyphBounds.Top + 7); } } } protected override void OnMouseDown (MouseEventArgs e) { if (e.Button == MouseButtons.Left && this.rectCloseGlyphBounds.Contains(e.Location)) this.Closed = !this.Closed; // close will call invalidate base.OnMouseDown(e); } protected override void OnMouseMove (MouseEventArgs e) { this.bIsMoveOverCloseGlyph = this.rectCloseGlyphBounds.Contains(e.Location); this.Invalidate(this.rectCloseGlyphBounds); base.OnMouseMove(e); } #endregion } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Saving to SharedPreferences from custom DialogPreference

    - by Ronnie
    I've currently got a preferences screen, and I've created a custom class that extends DialogPreference and is called from within my Preferences. My preferences data seems store/retrieve from SharedPreferences without an issue, but I'm trying to add 2 more sets of settings from the DialogPreference. Basically I have two issues that I have not been able to find. Every site I've seen gives me the same standard info to save/restore data and I'm still having problems. Firstly I'm trying to save a username and password to my SharedPreferences (visible in the last block of code) and if possibly I'd like to be able to do it in the onClick(). My preferences XML that calls my DialogPreference: <?xml version="1.0" encoding="utf-8"?> <PreferenceScreen xmlns:android="http://schemas.android.com/apk/res/android"> <PreferenceCategory> <com.rone.optusmon.AccDialog android:key="AccSettings" android:title="Account Settings" android:negativeButtonText="Cancel" android:positiveButtonText="Save" /> </PreferenceCategory> </PreferenceScreen> My Preference Activity Class: package com.rone.optusmon; import android.app.AlertDialog; import android.content.Context; import android.content.DialogInterface; import android.os.Bundle; import android.preference.Preference; import android.preference.Preference.OnPreferenceClickListener; import android.preference.PreferenceActivity; import android.view.KeyEvent; public class EditPreferences extends PreferenceActivity { Context context = this; @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); addPreferencesFromResource(R.xml.preferences); } } My Custom DialogPreference Class file: package com.rone.optusmon; import android.content.Context; import android.content.DialogInterface; import android.content.SharedPreferences; import android.preference.DialogPreference; import android.preference.PreferenceManager; import android.text.method.PasswordTransformationMethod; import android.util.AttributeSet; import android.view.View; import android.widget.CheckBox; import android.widget.CompoundButton; import android.widget.CompoundButton.OnCheckedChangeListener; import android.widget.EditText; import android.widget.LinearLayout; import android.widget.TextView; import android.widget.Toast; public class AccDialog extends DialogPreference implements DialogInterface.OnClickListener { private TextView mUsername, mPassword; private EditText mUserbox, mPassbox; CharSequence mPassboxdata, mUserboxdata; private CheckBox mShowchar; private Context mContext; private int mWhichButtonClicked; public AccDialog(Context context, AttributeSet attrs) { super(context, attrs); mContext = context; } @Override protected View onCreateDialogView() { @SuppressWarnings("unused") LinearLayout.LayoutParams params; LinearLayout layout = new LinearLayout(mContext); layout.setOrientation(LinearLayout.VERTICAL); layout.setPadding(10, 10, 10, 10); layout.setBackgroundColor(0xFF000000); mUsername = new TextView(mContext); mUsername.setText("Username:"); mUsername.setTextColor(0xFFFFFFFF); mUsername.setPadding(0, 8, 0, 3); mUserbox = new EditText(mContext); mUserbox.setSingleLine(true); mUserbox.setSelectAllOnFocus(true); mPassword = new TextView(mContext); mPassword.setText("Password:"); mPassword.setTextColor(0xFFFFFFFF); mPassbox = new EditText(mContext); mPassbox.setSingleLine(true); mPassbox.setSelectAllOnFocus(true); mShowchar = new CheckBox(mContext); mShowchar.setOnCheckedChangeListener(mShowchar_listener); mShowchar.setText("Show Characters"); mShowchar.setTextColor(0xFFFFFFFF); mShowchar.setChecked(false); if(!mShowchar.isChecked()) { mPassbox.setTransformationMethod(new PasswordTransformationMethod()); } layout.addView(mUsername); layout.addView(mUserbox); layout.addView(mPassword); layout.addView(mPassbox); layout.addView(mShowchar); return layout; // Access default SharedPreferences SharedPreferences settings = PreferenceManager.getDefaultSharedPreferences(this); } public void onClick(DialogInterface dialog, int which) { mWhichButtonClicked = which; // if statement to set save/cancel button roles if (mWhichButtonClicked == -1) { Toast.makeText(mContext, "Save was clicked", Toast.LENGTH_SHORT).show(); mUserboxdata = mUserbox.getText(); mPassboxdata = mPassbox.getText(); // Save user preferences SharedPreferences settings = getDefaultSharedPreferences(this); SharedPreferences.Editor editor = settings.edit(); editor.putString("usernamekey", (String) mUserboxdata); editor.putString("passwordkey", (String) mPassboxdata); } else { Toast.makeText(mContext, "Cancel was clicked", Toast.LENGTH_SHORT).show(); } } } In my SharedPreferences settings = PreferenceManager.getDefaultSharedPreferences(this); line, Eclipse says "The method getDefaultSharedPreferences(AccDialog) is undefined for the type AccDialog". I've attempted to change the context to my preferences class, use a blank context and I've also tried naming my SharedPrefs and using "getSharedPreferences()" as well. I'm just not sure exactly what I'm doing here. As I'm quite new to Java/Android/coding in general, could you please be as detailed as possible with any help, eg. which of my files I need to write the code in and whereabouts in that file should I write it (i.e. onCreate(), onClick(), etc) Edit: I will need to the preferences to be Application-wide accessible, not activity-wide. Thanks

    Read the article

  • Is there a better way to avoid an infinite loop using winforms?

    - by Hamish Grubijan
    I am using .Net 3.5 for now. Right now I am using a using trick to disable and enable events around certain sections of code. The user can change either days, hours, minutes or total minutes, and that should not cause an infinite cascade of events (e.g. minutes changing total, total changing minutes, etc.) While the code does what I want, there might be a better / more straight-forward way. Do you know of any? For brawny points: This control will be used by multiple teams - I do not want to make it embarrassing. I suspect that I do not need to reinvent the wheel when defining hours in a day, days in week, etc. Some other standard .Net library out there must have it. Any other remarks regarding code? This using (EventHacker.DisableEvents(this)) business - that must be a common pattern in .Net ... changing the setting temporarily. What is the name of it? I'd like to be able to refer to it in a comment and also read up more on current implementations. In the general case not only a handle to the thing being changed needs to be remembered, but also the previous state (in this case previous state does not matter - events are turned on and off unconditionally). Then there is also a possibility of multi-threaded hacking. One could also utilize generics to make the code arguably cleaner. Figuring all this out can lead to a multi-page blog post. I'd be happy to hear some of the answers. P.S. Does it seem like I suffer from obsessive compulsive disorder? Some people like to get things finished and move on; I like to keep them open ... there is always a better way. // Corresponding Designer class is omitted. using System; using System.Windows.Forms; namespace XYZ // Real name masked { interface IEventHackable { void EnableEvents(); void DisableEvents(); } public partial class PollingIntervalGroupBox : GroupBox, IEventHackable { private const int DAYS_IN_WEEK = 7; private const int MINUTES_IN_HOUR = 60; private const int HOURS_IN_DAY = 24; private const int MINUTES_IN_DAY = MINUTES_IN_HOUR * HOURS_IN_DAY; private const int MAX_TOTAL_DAYS = 100; private static readonly decimal MIN_TOTAL_NUM_MINUTES = 1; // Anything faster than once per minute can bog down our servers. private static readonly decimal MAX_TOTAL_NUM_MINUTES = (MAX_TOTAL_DAYS * MINUTES_IN_DAY) - 1; // 99 days should be plenty. // The value above was chosen so to not cause an overflow exception. // Watch out for it - numericUpDownControls each have a MaximumValue setting. public PollingIntervalGroupBox() { InitializeComponent(); InitializeComponentCustom(); } private void InitializeComponentCustom() { this.m_upDownDays.Maximum = MAX_TOTAL_DAYS - 1; this.m_upDownHours.Maximum = HOURS_IN_DAY - 1; this.m_upDownMinutes.Maximum = MINUTES_IN_HOUR - 1; this.m_upDownTotalMinutes.Maximum = MAX_TOTAL_NUM_MINUTES; this.m_upDownTotalMinutes.Minimum = MIN_TOTAL_NUM_MINUTES; } private void m_upDownTotalMinutes_ValueChanged(object sender, EventArgs e) { setTotalMinutes(this.m_upDownTotalMinutes.Value); } private void m_upDownDays_ValueChanged(object sender, EventArgs e) { updateTotalMinutes(); } private void m_upDownHours_ValueChanged(object sender, EventArgs e) { updateTotalMinutes(); } private void m_upDownMinutes_ValueChanged(object sender, EventArgs e) { updateTotalMinutes(); } private void updateTotalMinutes() { this.setTotalMinutes( MINUTES_IN_DAY * m_upDownDays.Value + MINUTES_IN_HOUR * m_upDownHours.Value + m_upDownMinutes.Value); } public decimal TotalMinutes { get { return m_upDownTotalMinutes.Value; } set { m_upDownTotalMinutes.Value = value; } } public decimal TotalHours { set { setTotalMinutes(value * MINUTES_IN_HOUR); } } public decimal TotalDays { set { setTotalMinutes(value * MINUTES_IN_DAY); } } public decimal TotalWeeks { set { setTotalMinutes(value * DAYS_IN_WEEK * MINUTES_IN_DAY); } } private void setTotalMinutes(decimal nTotalMinutes) { if (nTotalMinutes < MIN_TOTAL_NUM_MINUTES) { setTotalMinutes(MIN_TOTAL_NUM_MINUTES); return; // Must be carefull with recursion. } if (nTotalMinutes > MAX_TOTAL_NUM_MINUTES) { setTotalMinutes(MAX_TOTAL_NUM_MINUTES); return; // Must be carefull with recursion. } using (EventHacker.DisableEvents(this)) { // First set the total minutes this.m_upDownTotalMinutes.Value = nTotalMinutes; // Then set the rest this.m_upDownDays.Value = (int)(nTotalMinutes / MINUTES_IN_DAY); nTotalMinutes = nTotalMinutes % MINUTES_IN_DAY; // variable reuse. this.m_upDownHours.Value = (int)(nTotalMinutes / MINUTES_IN_HOUR); nTotalMinutes = nTotalMinutes % MINUTES_IN_HOUR; this.m_upDownMinutes.Value = nTotalMinutes; } } // Event magic public void EnableEvents() { this.m_upDownTotalMinutes.ValueChanged += this.m_upDownTotalMinutes_ValueChanged; this.m_upDownDays.ValueChanged += this.m_upDownDays_ValueChanged; this.m_upDownHours.ValueChanged += this.m_upDownHours_ValueChanged; this.m_upDownMinutes.ValueChanged += this.m_upDownMinutes_ValueChanged; } public void DisableEvents() { this.m_upDownTotalMinutes.ValueChanged -= this.m_upDownTotalMinutes_ValueChanged; this.m_upDownDays.ValueChanged -= this.m_upDownDays_ValueChanged; this.m_upDownHours.ValueChanged -= this.m_upDownHours_ValueChanged; this.m_upDownMinutes.ValueChanged -= this.m_upDownMinutes_ValueChanged; } // We give as little info as possible to the 'hacker'. private sealed class EventHacker : IDisposable { IEventHackable _hackableHandle; public static IDisposable DisableEvents(IEventHackable hackableHandle) { return new EventHacker(hackableHandle); } public EventHacker(IEventHackable hackableHandle) { this._hackableHandle = hackableHandle; this._hackableHandle.DisableEvents(); } public void Dispose() { this._hackableHandle.EnableEvents(); } } } }

    Read the article

  • EXC_BAD_ACCESS at UITableView on IOS

    - by Suprie
    Hi all, When scrolling through table, my application crash and console said it was EXC_BAD_ACCESS. I've look everywhere, and people suggest me to use NSZombieEnabled on my executables environment variables. I've set NSZombieEnabled, NSDebugEnabled, MallocStackLogging and MallocStackLoggingNoCompact to YES on my executables. But apparently i still can't figure out which part of my program that cause EXC_BAD_ACCESS. This is what my console said [Session started at 2010-12-21 21:11:21 +0700.] GNU gdb 6.3.50-20050815 (Apple version gdb-1510) (Wed Sep 22 02:45:02 UTC 2010) Copyright 2004 Free Software Foundation, Inc. GDB is free software, covered by the GNU General Public License, and you are welcome to change it and/or distribute copies of it under certain conditions. Type "show copying" to see the conditions. There is absolutely no warranty for GDB. Type "show warranty" for details. This GDB was configured as "x86_64-apple-darwin".sharedlibrary apply-load-rules all Attaching to process 9335. TwitterSearch(9335) malloc: recording malloc stacks to disk using standard recorder TwitterSearch(9335) malloc: process 9300 no longer exists, stack logs deleted from /tmp/stack-logs.9300.TwitterSearch.suirlR.index TwitterSearch(9335) malloc: stack logs being written into /tmp/stack- logs.9335.TwitterSearch.tQJAXk.index 2010-12-21 21:11:25.446 TwitterSearch[9335:207] View Did Load Program received signal: “EXC_BAD_ACCESS”. And this is when i tried to type backtrace on gdb : Program received signal: “EXC_BAD_ACCESS”. (gdb) backtrace #0 0x00f20a67 in objc_msgSend () #1 0x0565cd80 in ?? () #2 0x0033b7fa in -[UITableView(UITableViewInternal) _createPreparedCellForGlobalRow:withIndexPath:] () #3 0x0033177f in -[UITableView(UITableViewInternal) _createPreparedCellForGlobalRow:] () #4 0x00346450 in -[UITableView(_UITableViewPrivate) _updateVisibleCellsNow:] () #5 0x0033e538 in -[UITableView layoutSubviews] () #6 0x01ffc451 in -[CALayer layoutSublayers] () #7 0x01ffc17c in CALayerLayoutIfNeeded () #8 0x01ff537c in CA::Context::commit_transaction () #9 0x01ff50d0 in CA::Transaction::commit () #10 0x020257d5 in CA::Transaction::observer_callback () #11 0x00d9ffbb in __CFRUNLOOP_IS_CALLING_OUT_TO_AN_OBSERVER_CALLBACK_FUNCTION__ () #12 0x00d350e7 in __CFRunLoopDoObservers () #13 0x00cfdbd7 in __CFRunLoopRun () #14 0x00cfd240 in CFRunLoopRunSpecific () #15 0x00cfd161 in CFRunLoopRunInMode () #16 0x01a73268 in GSEventRunModal () #17 0x01a7332d in GSEventRun () #18 0x002d642e in UIApplicationMain () #19 0x00001d4e in main (argc=1, argv=0xbfffee34) at /Users/suprie/Documents/Projects/Self/cocoa/TwitterSearch/main.m:14 I really appreciate for any clue to help me debug my application. EDIT this is the Header file of table #import <UIKit/UIKit.h> @interface TwitterTableViewController : UITableViewController { NSMutableArray *twitters; } @property(nonatomic,retain) NSMutableArray *twitters; @end and the implementation file #import "TwitterTableViewController.h" @implementation TwitterTableViewController @synthesize twitters; #pragma mark - #pragma mark Table view data source - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { // Return the number of sections. return 1; } - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { // Return the number of rows in the section. return [twitters count]; } - (CGFloat)tableView:(UITableView *)tableView heightForRowAtIndexPath:(NSIndexPath *)indexPath { return 90.0f; } - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { const NSInteger TAG_IMAGE_VIEW = 1001; const NSInteger TAG_TWEET_VIEW = 1002; const NSInteger TAG_FROM_VIEW = 1003; static NSString *CellIdentifier = @"Cell"; UIImageView *imageView; UILabel *tweet; UILabel *from; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithStyle:UITableViewCellStyleDefault reuseIdentifier:CellIdentifier] autorelease]; // Image imageView = [[[[UIImageView alloc] initWithFrame:CGRectMake(5.0f, 5.0f, 60.0f, 60.0f)] autorelease] retain]; [cell.contentView addSubview:imageView]; imageView.tag = TAG_IMAGE_VIEW; // Tweet tweet = [[[UILabel alloc] initWithFrame:CGRectMake(105.0f, 5.0f, 200.0f, 50.0f)] autorelease]; [cell.contentView addSubview:tweet]; tweet.tag = TAG_TWEET_VIEW; tweet.numberOfLines = 2; tweet.font = [UIFont fontWithName:@"Helvetica" size:12]; tweet.textColor = [UIColor blackColor]; tweet.backgroundColor = [UIColor clearColor]; // From from = [[[UILabel alloc] initWithFrame:CGRectMake(105.0f, 55.0, 200.0f, 35.0f)] autorelease]; [cell.contentView addSubview:from]; from.tag = TAG_FROM_VIEW; from.numberOfLines = 1; from.font = [UIFont fontWithName:@"Helvetica" size:10]; from.textColor = [UIColor blackColor]; from.backgroundColor = [UIColor clearColor]; } // Configure the cell... NSMutableDictionary *twitter = [twitters objectAtIndex:(NSInteger) indexPath.row]; // cell.text = [twitter objectForKey:@"text"]; tweet.text = (NSString *) [twitter objectForKey:@"text"]; tweet.hidden = NO; from.text = (NSString *) [twitter objectForKey:@"from_user"]; from.hidden = NO; NSString *avatar_url = (NSString *)[twitter objectForKey:@"profile_image_url"]; NSData * imageData = [[NSData alloc] initWithContentsOfURL: [NSURL URLWithString: avatar_url]]; imageView.image = [UIImage imageWithData: imageData]; imageView.hidden = NO; return cell; } #pragma mark - #pragma mark Table view delegate - (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { NSMutableDictionary *twitter = [twitters objectAtIndex:(NSInteger)indexPath.row]; NSLog(@"Twit ini kepilih :%@", [twitter objectForKey:@"text"]); } #pragma mark - #pragma mark Memory management - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; } - (void)viewDidUnload { } - (void)dealloc { [super dealloc]; } @end

    Read the article

  • Condition Variable in Shared Memory - is this code POSIX-conformant?

    - by GrahamS
    We've been trying to use a mutex and condition variable to synchronise access to named shared memory on a LynuxWorks LynxOS-SE system (POSIX-conformant). One shared memory block is called "/sync" and contains the mutex and condition variable, the other is "/data" and contains the actual data we are syncing access to. We're seeing failures from pthread_cond_signal() if both processes don't perform the mmap() calls in exactly the same order, or if one process mmaps in some other piece of shared memory before it mmaps the sync memory. This example code is about as short as I can make it: #include <sys/types.h> #include <sys/stat.h> #include <sys/mman.h> #include <sys/file.h> #include <stdlib.h> #include <pthread.h> #include <errno.h> #include <iostream> #include <string> using namespace std; static const string shm_name_sync("/sync"); static const string shm_name_data("/data"); struct shared_memory_sync { pthread_mutex_t mutex; pthread_cond_t condition; }; struct shared_memory_data { int a; int b; }; //Create 2 shared memory objects // - sync contains 2 shared synchronisation objects (mutex and condition) // - data not important void create() { // Create and map 'sync' shared memory int fd_sync = shm_open(shm_name_sync.c_str(), O_CREAT|O_RDWR, S_IRUSR|S_IWUSR); ftruncate(fd_sync, sizeof(shared_memory_sync)); void* addr_sync = mmap(0, sizeof(shared_memory_sync), PROT_READ|PROT_WRITE, MAP_SHARED, fd_sync, 0); shared_memory_sync* p_sync = static_cast<shared_memory_sync*> (addr_sync); // init the cond and mutex pthread_condattr_t cond_attr; pthread_condattr_init(&cond_attr); pthread_condattr_setpshared(&cond_attr, PTHREAD_PROCESS_SHARED); pthread_cond_init(&(p_sync->condition), &cond_attr); pthread_condattr_destroy(&cond_attr); pthread_mutexattr_t m_attr; pthread_mutexattr_init(&m_attr); pthread_mutexattr_setpshared(&m_attr, PTHREAD_PROCESS_SHARED); pthread_mutex_init(&(p_sync->mutex), &m_attr); pthread_mutexattr_destroy(&m_attr); // Create the 'data' shared memory int fd_data = shm_open(shm_name_data.c_str(), O_CREAT|O_RDWR, S_IRUSR|S_IWUSR); ftruncate(fd_data, sizeof(shared_memory_data)); void* addr_data = mmap(0, sizeof(shared_memory_data), PROT_READ|PROT_WRITE, MAP_SHARED, fd_data, 0); shared_memory_data* p_data = static_cast<shared_memory_data*> (addr_data); // Run the second process while it sleeps here. sleep(10); int res = pthread_cond_signal(&(p_sync->condition)); assert(res==0); // <--- !!!THIS ASSERT WILL FAIL ON LYNXOS!!! munmap(addr_sync, sizeof(shared_memory_sync)); shm_unlink(shm_name_sync.c_str()); munmap(addr_data, sizeof(shared_memory_data)); shm_unlink(shm_name_data.c_str()); } //Open the same 2 shared memory objects but in reverse order // - data // - sync void open() { sleep(2); int fd_data = shm_open(shm_name_data.c_str(), O_RDWR, S_IRUSR|S_IWUSR); void* addr_data = mmap(0, sizeof(shared_memory_data), PROT_READ|PROT_WRITE, MAP_SHARED, fd_data, 0); shared_memory_data* p_data = static_cast<shared_memory_data*> (addr_data); int fd_sync = shm_open(shm_name_sync.c_str(), O_RDWR, S_IRUSR|S_IWUSR); void* addr_sync = mmap(0, sizeof(shared_memory_sync), PROT_READ|PROT_WRITE, MAP_SHARED, fd_sync, 0); shared_memory_sync* p_sync = static_cast<shared_memory_sync*> (addr_sync); // Wait on the condvar pthread_mutex_lock(&(p_sync->mutex)); pthread_cond_wait(&(p_sync->condition), &(p_sync->mutex)); pthread_mutex_unlock(&(p_sync->mutex)); munmap(addr_sync, sizeof(shared_memory_sync)); munmap(addr_data, sizeof(shared_memory_data)); } int main(int argc, char** argv) { if(argc>1) { open(); } else { create(); } return (0); } Run this program with no args, then another copy with args, and the first one will fail at the assert checking the pthread_cond_signal(). But change the open() function to mmap() the "/sync" memory first and it will all work fine. This seems like a major bug in LynxOS but LynuxWorks claim that using mutex and condition variable in this way is not covered by the POSIX standard, so they are not interested. Can anyone determine if this code does violate POSIX? Or does anyone have any convincing documentation that it is POSIX compliant?

    Read the article

  • compile time if && return string reference optimization

    - by Truncheon
    Hi. I'm writing a series classes that inherit from a base class using virtual. They are INT, FLOAT and STRING objects that I want to use in a scripting language. I'm trying to implement weak typing, but I don't want STRING objects to return copies of themselves when used in the following way (instead I would prefer to have a reference returned which can be used in copying): a = "hello "; b = "world"; c = a + b; I have written the following code as a mock example: #include <iostream> #include <string> #include <cstdio> #include <cstdlib> std::string dummy("<int object cannot return string reference>"); struct BaseImpl { virtual bool is_string() = 0; virtual int get_int() = 0; virtual std::string get_string_copy() = 0; virtual std::string const& get_string_ref() = 0; }; struct INT : BaseImpl { int value; INT(int i = 0) : value(i) { std::cout << "constructor called\n"; } INT(BaseImpl& that) : value(that.get_int()) { std::cout << "copy constructor called\n"; } bool is_string() { return false; } int get_int() { return value; } std::string get_string_copy() { char buf[33]; sprintf(buf, "%i", value); return buf; } std::string const& get_string_ref() { return dummy; } }; struct STRING : BaseImpl { std::string value; STRING(std::string s = "") : value(s) { std::cout << "constructor called\n"; } STRING(BaseImpl& that) { if (that.is_string()) value = that.get_string_ref(); else value = that.get_string_copy(); std::cout << "copy constructor called\n"; } bool is_string() { return true; } int get_int() { return atoi(value.c_str()); } std::string get_string_copy() { return value; } std::string const& get_string_ref() { return value; } }; struct Base { BaseImpl* impl; Base(BaseImpl* p = 0) : impl(p) {} ~Base() { delete impl; } }; int main() { Base b1(new INT(1)); Base b2(new STRING("Hello world")); Base b3(new INT(*b1.impl)); Base b4(new STRING(*b2.impl)); std::cout << "\n"; std::cout << b1.impl->get_int() << "\n"; std::cout << b2.impl->get_int() << "\n"; std::cout << b3.impl->get_int() << "\n"; std::cout << b4.impl->get_int() << "\n"; std::cout << "\n"; std::cout << b1.impl->get_string_ref() << "\n"; std::cout << b2.impl->get_string_ref() << "\n"; std::cout << b3.impl->get_string_ref() << "\n"; std::cout << b4.impl->get_string_ref() << "\n"; std::cout << "\n"; std::cout << b1.impl->get_string_copy() << "\n"; std::cout << b2.impl->get_string_copy() << "\n"; std::cout << b3.impl->get_string_copy() << "\n"; std::cout << b4.impl->get_string_copy() << "\n"; return 0; } It was necessary to add an if check in the STRING class to determine whether its safe to request a reference instead of a copy: Script code: a = "test"; b = a; c = 1; d = "" + c; /* not safe to request reference by standard */ C++ code: STRING(BaseImpl& that) { if (that.is_string()) value = that.get_string_ref(); else value = that.get_string_copy(); std::cout << "copy constructor called\n"; } If was hoping there's a way of moving that if check into compile time, rather than run time.

    Read the article

  • Trying to reduce the speed overhead of an almost-but-not-quite-int number class

    - by Fumiyo Eda
    I have implemented a C++ class which behaves very similarly to the standard int type. The difference is that it has an additional concept of "epsilon" which represents some tiny value that is much less than 1, but greater than 0. One way to think of it is as a very wide fixed point number with 32 MSBs (the integer parts), 32 LSBs (the epsilon parts) and a huge sea of zeros in between. The following class works, but introduces a ~2x speed penalty in the overall program. (The program includes code that has nothing to do with this class, so the actual speed penalty of this class is probably much greater than 2x.) I can't paste the code that is using this class, but I can say the following: +, -, +=, <, > and >= are the only heavily used operators. Use of setEpsilon() and getInt() is extremely rare. * is also rare, and does not even need to consider the epsilon values at all. Here is the class: #include <limits> struct int32Uepsilon { typedef int32Uepsilon Self; int32Uepsilon () { _value = 0; _eps = 0; } int32Uepsilon (const int &i) { _value = i; _eps = 0; } void setEpsilon() { _eps = 1; } Self operator+(const Self &rhs) const { Self result = *this; result._value += rhs._value; result._eps += rhs._eps; return result; } Self operator-(const Self &rhs) const { Self result = *this; result._value -= rhs._value; result._eps -= rhs._eps; return result; } Self operator-( ) const { Self result = *this; result._value = -result._value; result._eps = -result._eps; return result; } Self operator*(const Self &rhs) const { return this->getInt() * rhs.getInt(); } // XXX: discards epsilon bool operator<(const Self &rhs) const { return (_value < rhs._value) || (_value == rhs._value && _eps < rhs._eps); } bool operator>(const Self &rhs) const { return (_value > rhs._value) || (_value == rhs._value && _eps > rhs._eps); } bool operator>=(const Self &rhs) const { return (_value >= rhs._value) || (_value == rhs._value && _eps >= rhs._eps); } Self &operator+=(const Self &rhs) { this->_value += rhs._value; this->_eps += rhs._eps; return *this; } Self &operator-=(const Self &rhs) { this->_value -= rhs._value; this->_eps -= rhs._eps; return *this; } int getInt() const { return(_value); } private: int _value; int _eps; }; namespace std { template<> struct numeric_limits<int32Uepsilon> { static const bool is_signed = true; static int max() { return 2147483647; } } }; The code above works, but it is quite slow. Does anyone have any ideas on how to improve performance? There are a few hints/details I can give that might be helpful: 32 bits are definitely insufficient to hold both _value and _eps. In practice, up to 24 ~ 28 bits of _value are used and up to 20 bits of _eps are used. I could not measure a significant performance difference between using int32_t and int64_t, so memory overhead itself is probably not the problem here. Saturating addition/subtraction on _eps would be cool, but isn't really necessary. Note that the signs of _value and _eps are not necessarily the same! This broke my first attempt at speeding this class up. Inline assembly is no problem, so long as it works with GCC on a Core i7 system running Linux!

    Read the article

  • Paypal development. encrypt transactions. php p12

    - by ninchen
    when i take a look at the paypal documentation, they say "Note that the PayPal SDK for PHP does not require SSL encryption". https://developer.paypal.com/docs/classic/api/apiCredentials/#encrypting-your-certificate Is the statement of this phrase, that i don't have to create a p12 certificate when working with php, but use the public_key.pem and paypal_public_key.pem? If yes: Is it secure enough to create the encrypted form input elements without p12 certificate? If no: What do they mean? :-) Before this question came up, i've tested this little programm. http://www.softarea51.com/blog/how-to-integrate-your-custom-shopping-cart-with-paypal-website-payments-standard-using-php/ There is a config file paypal-wps-config.inc.php where i can define the paths to my certificates. // tryed to use // 'paypal_cert.p12 '; $config['private_key_path'] = '/home/folder/.cert/pp/prvkey.pem'; // must match the one you set when you created the private key $config['private_key_password'] = ''; //'my_password'; When i try to use the p12 certificate, openssl_error_string() returns "Could not sign data: error:0906D06C:PEM routines:PEM_read_bio:no start line openssl_pkcs7_sign When i instead use the prvkey.pem without password all works fine. Here is the function, which signs and encrypt the data. function signAndEncrypt($dataStr_, $ewpCertPath_, $ewpPrivateKeyPath_, $ewpPrivateKeyPwd_, $paypalCertPath_) { $dataStrFile = realpath(tempnam('/tmp', 'pp_')); $fd = fopen($dataStrFile, 'w'); if(!$fd) { $error = "Could not open temporary file $dataStrFile."; return array("status" => false, "error_msg" => $error, "error_no" => 0); } fwrite($fd, $dataStr_); fclose($fd); $signedDataFile = realpath(tempnam('/tmp', 'pp_')); **// here the error came from** if(!@openssl_pkcs7_sign( $dataStrFile, $signedDataFile, "file://$ewpCertPath_", array("file://$ewpPrivateKeyPath_", $ewpPrivateKeyPwd_), array(), PKCS7_BINARY)) { unlink($dataStrFile); unlink($signedDataFile); $error = "Could not sign data: ".openssl_error_string(); return array("status" => false, "error_msg" => $error, "error_no" => 0); } unlink($dataStrFile); $signedData = file_get_contents($signedDataFile); $signedDataArray = explode("\n\n", $signedData); $signedData = $signedDataArray[1]; $signedData = base64_decode($signedData); unlink($signedDataFile); $decodedSignedDataFile = realpath(tempnam('/tmp', 'pp_')); $fd = fopen($decodedSignedDataFile, 'w'); if(!$fd) { $error = "Could not open temporary file $decodedSignedDataFile."; return array("status" => false, "error_msg" => $error, "error_no" => 0); } fwrite($fd, $signedData); fclose($fd); $encryptedDataFile = realpath(tempnam('/tmp', 'pp_')); if(!@openssl_pkcs7_encrypt( $decodedSignedDataFile, $encryptedDataFile, file_get_contents($paypalCertPath_), array(), PKCS7_BINARY)) { unlink($decodedSignedDataFile); unlink($encryptedDataFile); $error = "Could not encrypt data: ".openssl_error_string(); return array("status" => false, "error_msg" => $error, "error_no" => 0); } unlink($decodedSignedDataFile); $encryptedData = file_get_contents($encryptedDataFile); if(!$encryptedData) { $error = "Encryption and signature of data failed."; return array("status" => false, "error_msg" => $error, "error_no" => 0); } unlink($encryptedDataFile); $encryptedDataArray = explode("\n\n", $encryptedData); $encryptedData = trim(str_replace("\n", '', $encryptedDataArray[1])); return array("status" => true, "encryptedData" => $encryptedData); } // signAndEncrypt } // PPCrypto The main questions: 1. Is it possible to use p12 cert with php, or is it secure enough to work without it? 2. Why i become an error when using openssl_pkcs7_sign Please help. Greetings ninchen

    Read the article

  • Linux C: "Interactive session" with separate read and write named pipes?

    - by ~sd-imi
    Hi all, I am trying to work with "Introduction to Interprocess Communication Using Named Pipes - Full-Duplex Communication Using Named Pipes", http://developers.sun.com/solaris/articles/named_pipes.html#5 ; in particular fd_server.c (included below for reference) Here is my info and compile line: :~$ cat /etc/issue Ubuntu 10.04 LTS \n \l :~$ gcc --version gcc (Ubuntu 4.4.3-4ubuntu5) 4.4.3 :~$ gcc fd_server.c -o fd_server fd_server.c creates two named pipes, one for reading and one for writing. What one can do, is: in one terminal, run the server and read (through cat) its write pipe: :~$ ./fd_server & 2/dev/null [1] 11354 :~$ cat /tmp/np2 and in another, write (using echo) to server's read pipe: :~$ echo "heeellloooo" /tmp/np1 going back to first terminal, one can see: :~$ cat /tmp/np2 HEEELLLOOOO 0[1]+ Exit 13 ./fd_server 2 /dev/null What I would like to do, is make sort of a "interactive" (or "shell"-like) session; that is, the server is run as usual, but instead of running "cat" and "echo", I'd like to use something akin to screen. What I mean by that, is that screen can be called like screen /dev/ttyS0 38400, and then it makes a sort of a interactive session, where what is typed in terminal is passed to /dev/ttyS0, and its response is written to terminal. Now, of course, I cannot use screen, because in my case the program has two separate nodes, and as far as I can tell, screen can refer to only one. How would one go about to achieve this sort of "interactive" session in this context (with two separate read/write pipes)? Thanks, Cheers! Code below: #include <stdio.h> #include <errno.h> #include <ctype.h> #include <sys/types.h> #include <sys/stat.h> #include <fcntl.h> //#include <fullduplex.h> /* For name of the named-pipe */ #define NP1 "/tmp/np1" #define NP2 "/tmp/np2" #define MAX_BUF_SIZE 255 #include <stdlib.h> //exit #include <string.h> //strlen int main(int argc, char *argv[]) { int rdfd, wrfd, ret_val, count, numread; char buf[MAX_BUF_SIZE]; /* Create the first named - pipe */ ret_val = mkfifo(NP1, 0666); if ((ret_val == -1) && (errno != EEXIST)) { perror("Error creating the named pipe"); exit (1); } ret_val = mkfifo(NP2, 0666); if ((ret_val == -1) && (errno != EEXIST)) { perror("Error creating the named pipe"); exit (1); } /* Open the first named pipe for reading */ rdfd = open(NP1, O_RDONLY); /* Open the second named pipe for writing */ wrfd = open(NP2, O_WRONLY); /* Read from the first pipe */ numread = read(rdfd, buf, MAX_BUF_SIZE); buf[numread] = '0'; fprintf(stderr, "Full Duplex Server : Read From the pipe : %sn", buf); /* Convert to the string to upper case */ count = 0; while (count < numread) { buf[count] = toupper(buf[count]); count++; } /* * Write the converted string back to the second * pipe */ write(wrfd, buf, strlen(buf)); } Edit: Right, just to clarify - it seems I found a document discussing something very similar, it is http://en.wikibooks.org/wiki/Serial_Programming/Serial_Linux#Configuration_with_stty - a modification of the script there ("For example, the following script configures the device and starts a background process for copying all received data from the serial device to standard output...") for the above program is below: # stty raw # ( ./fd_server 2>/dev/null; )& bgPidS=$! ( cat < /tmp/np2 ; )& bgPid=$! # Read commands from user, send them to device echo $(kill -0 $bgPidS 2>/dev/null ; echo $?) while [ "$(kill -0 $bgPidS 2>/dev/null ; echo $?)" -eq "0" ] && read cmd; do # redirect debug msgs to stderr, as here we're redirected to /tmp/np1 echo "$? - $bgPidS - $bgPid" >&2 echo "$cmd" echo -e "\nproc: $(kill -0 $bgPidS 2>/dev/null ; echo $?)" >&2 done >/tmp/np1 echo OUT # Terminate background read process - if they still exist if [ "$(kill -0 $bgPid 2>/dev/null ; echo $?)" -eq "0" ] ; then kill $bgPid fi if [ "$(kill -0 $bgPidS 2>/dev/null ; echo $?)" -eq "0" ] ; then kill $bgPidS fi # stty cooked So, saving the script as say starter.sh and calling it, results with the following session: $ ./starter.sh 0 i'm typing here and pressing [enter] at end 0 - 13496 - 13497 I'M TYPING HERE AND PRESSING [ENTER] AT END 0~?.N=?(?~? ?????}????@??????~? [garble] proc: 0 OUT which is what I'd call for "interactive session" (ignoring the debug statements) - server waits for me to enter a command; it gives its output after it receives a command (and as in this case it exits after first command, so does the starter script as well). Except that, I'd like to not have buffered input, but sent character by character (meaning the above session should exit after first key press, and print out a single letter only - which is what I expected stty raw would help with, but it doesn't: it just kills reaction to both Enter and Ctrl-C :) ) I was just wandering if there already is an existing command (akin to screen in respect to serial devices, I guess) that would accept two such named pipes as arguments, and establish a "terminal" or "shell" like session through them; or would I have to use scripts as above and/or program own 'client' that will behave as a terminal..

    Read the article

  • Receiving broadcast packets using packet socket

    - by user314336
    Hello I try to send DHCP RENEW packets to the network and receive the responses. I broadcast the packet and I can see that it's successfully sent using Wireshark. But I have difficulties receiving the responses.I use packet sockets to catch the packets. I can see that there are responses to my RENEW packet using Wireshark, but my function 'packet_receive_renew' sometimes catch the packets but sometimes it can not catch the packets. I set the file descriptor using FDSET but the 'select' in my code can not realize that there are new packets for that file descriptor and timeout occurs. I couldn't make it clear that why it sometimes catches the packets and sometimes doesn't. Anybody have an idea? Thanks in advance. Here's the receive function. int packet_receive_renew(struct client_info* info) { int fd; struct sockaddr_ll sock, si_other; struct sockaddr_in si_me; fd_set rfds; struct timeval tv; time_t start, end; int bcast = 1; int ret = 0, try = 0; char buf[1500] = {'\0'}; uint8_t tmp[BUFLEN] = {'\0'}; struct dhcp_packet pkt; socklen_t slen = sizeof(si_other); struct dhcps* new_dhcps; memset((char *) &si_me, 0, sizeof(si_me)); memset((char *) &si_other, 0, sizeof(si_other)); memset(&pkt, 0, sizeof(struct dhcp_packet)); define SERVER_AND_CLIENT_PORTS ((67 << 16) + 68) static const struct sock_filter filter_instr[] = { /* check for udp */ BPF_STMT(BPF_LD|BPF_B|BPF_ABS, 9), BPF_JUMP(BPF_JMP|BPF_JEQ|BPF_K, IPPROTO_UDP, 0, 4), /* L5, L1, is UDP? */ /* skip IP header */ BPF_STMT(BPF_LDX|BPF_B|BPF_MSH, 0), /* L5: */ /* check udp source and destination ports */ BPF_STMT(BPF_LD|BPF_W|BPF_IND, 0), BPF_JUMP(BPF_JMP|BPF_JEQ|BPF_K, SERVER_AND_CLIENT_PORTS, 0, 1), /* L3, L4 */ /* returns */ BPF_STMT(BPF_RET|BPF_K, 0x0fffffff ), /* L3: pass */ BPF_STMT(BPF_RET|BPF_K, 0), /* L4: reject */ }; static const struct sock_fprog filter_prog = { .len = sizeof(filter_instr) / sizeof(filter_instr[0]), /* casting const away: */ .filter = (struct sock_filter *) filter_instr, }; printf("opening raw socket on ifindex %d\n", info->interf.if_index); if (-1==(fd = socket(PF_PACKET, SOCK_DGRAM, htons(ETH_P_IP)))) { perror("packet_receive_renew::socket"); return -1; } printf("got raw socket fd %d\n", fd); /* Use only if standard ports are in use */ /* Ignoring error (kernel may lack support for this) */ if (-1==setsockopt(fd, SOL_SOCKET, SO_ATTACH_FILTER, &filter_prog, sizeof(filter_prog))) perror("packet_receive_renew::setsockopt"); sock.sll_family = AF_PACKET; sock.sll_protocol = htons(ETH_P_IP); //sock.sll_pkttype = PACKET_BROADCAST; sock.sll_ifindex = info->interf.if_index; if (-1 == bind(fd, (struct sockaddr *) &sock, sizeof(sock))) { perror("packet_receive_renew::bind"); close(fd); return -3; } if (-1 == setsockopt(fd, SOL_SOCKET, SO_BROADCAST, &bcast, sizeof(bcast))) { perror("packet_receive_renew::setsockopt"); close(fd); return -1; } FD_ZERO(&rfds); FD_SET(fd, &rfds); tv.tv_sec = TIMEOUT; tv.tv_usec = 0; ret = time(&start); if (-1 == ret) { perror("packet_receive_renew::time"); close(fd); return -1; } while(1) { ret = select(fd + 1, &rfds, NULL, NULL, &tv); time(&end); if (TOTAL_PENDING <= (end - start)) { fprintf(stderr, "End receiving\n"); break; } if (-1 == ret) { perror("packet_receive_renew::select"); close(fd); return -4; } else if (ret) { new_dhcps = (struct dhcps*)calloc(1, sizeof(struct dhcps)); if (-1 == recvfrom(fd, buf, 1500, 0, (struct sockaddr*)&si_other, &slen)) { perror("packet_receive_renew::recvfrom"); close(fd); return -4; } deref_packet((unsigned char*)buf, &pkt, info); if (-1!=(ret=get_option_val(pkt.options, DHO_DHCP_SERVER_IDENTIFIER, tmp))) { sprintf((char*)tmp, "%d.%d.%d.%d", tmp[0],tmp[1],tmp[2],tmp[3]); fprintf(stderr, "Received renew from %s\n", tmp); } else { fprintf(stderr, "Couldnt get DHO_DHCP_SERVER_IDENTIFIER%s\n", tmp); close(fd); return -5; } new_dhcps->dhcps_addr = strdup((char*)tmp); //add to list if (info->dhcps_list) info->dhcps_list->next = new_dhcps; else info->dhcps_list = new_dhcps; new_dhcps->next = NULL; } else { try++; tv.tv_sec = TOTAL_PENDING - try * TIMEOUT; tv.tv_usec = 0; fprintf(stderr, "Timeout occured\n"); } } close(fd); printf("close fd:%d\n", fd); return 0; }

    Read the article

  • Center footer fixed at the bottom IE

    - by Mirko
    I am coding a web interface for a University project and I have been dealing with this issue: I want my footer fixed at the bottom so it is in place no matter which screen I am using or if I toggle the full screen mode It works in all the other browsers except IE7 (I do not have to support previous versions) HTML <div id="menu"> <a href="information.html" rel="shadowbox;height=500;width=650" title="INFORMATION" > <img src="images/info.png" alt="information icon" /> </a> <a href="images/bricks_of_destiny.jpg" rel="shadowbox[gallery]" title="IMAGES" > <img src="images/image.png" alt="image icon" /> </a> <a href="music_player.swf" title="MUSIC" rel="shadowbox;height=400;width=600" > <img src="images/music.png" alt="music icon" /> </a> <a href="#" title="MOVIES"><img src="images/television.png" alt="movies icon" /></a> <a href="quotes.html" title="QUOTES" rel="shadowbox;height=300;width=650" > <img src="images/male_user.png" alt="male user icon" /> </a> <a href="#" title="REFERENCES"> <img src="images/search_globe.png" alt="search globe icon" /> </a> </div> <a href="images/destiny_1.jpg" rel="shadowbox[gallery]" title="IMAGES"></a> <a href="images/destiny_carma_jewell.jpg" rel="shadowbox[gallery]" title="IMAGES"></a> <a href="images/destiny-joan-marie.jpg" rel="shadowbox[gallery]" title="IMAGES"></a> <a href="images/pursuing_destiny.jpg" rel="shadowbox[gallery]" title="IMAGES"></a> <div class="clear"></div> <div id="destiny"> Discover more about the word <span class="strong">DESTINY </span>! Click one of the icon above! (F11 Toggle Full / Standard screen) </div> <div id="footer"> <ul id="breadcrumbs"> <li>Disclaimer</li> <li> | Icons by: <a href="http://dryicons.com/" rel="shadowbox">dryicons.com</a></li> <li> | Website by: <a href="http://www.eezzyweb.com/" rel="shadowbox">eezzyweb</a></li> <li> | <a href="http://jquery.com/" rel="shadowbox">jQuery</a></li> </ul> </div> </div> CSS: #wrapper{ text-align:center; margin:0 auto; width:750px; height:430px; border:1px solid #fff; } #menu{ position:relative; margin:0 auto; top:350px; width:450px; height:60px; } #destiny{ position:relative; top:380px; color:#FFF; font-size:1.5em; font-weight:bold; border:1px solid #fff; } #breadcrumbs{ list-style:none; } #breadcrumbs li{ display:inline; color:#FFF; } #footer{ position:absolute; width:750px; height:60px; margin:0 auto; text-align:center; border:1px solid #fff; bottom:0; } .clear{ clear:both; } The white borders are there only for debugging purposes The application is hosted at http://www.eezzyweb.com/destiny/ Any suggestion is appreciated

    Read the article

  • Link List Implementation Help - Visual C++

    - by Greenhouse Gases
    Hi there I'm trying to implement a link list which stores the city name (though you will see this commented out as I need to resolve the issue of not being able to use string and needing to use a primitive data type instead during the declaration), longitude, latitude and of course a pointer to the next node in the chain. I am new to the Visual C++ environment and my brain is somewhat scrambled after coding for several straight hours today so I wondered if anyone could help resolve the 2 errors I am getting (ignore the #include syntax as I had to change them to avoid the browser interpreting html!): 1U08221.obj : error LNK2028: unresolved token (0A000298) "public: __thiscall Locations::Locations(void)" (??0Locations@@$$FQAE@XZ) referenced in function "int __clrcall main(cli::array^)" (?main@@$$HYMHP$01AP$AAVString@System@@@Z) 1U08221.obj : error LNK2019: unresolved external symbol "public: __thiscall Locations::Locations(void)" (??0Locations@@$$FQAE@XZ) referenced in function "int __clrcall main(cli::array^)" (?main@@$$HYMHP$01AP$AAVString@System@@@Z) The code for my header file is here: include string struct locationNode { //char[10] nodeCityName; double nodeLati; double nodeLongi; locationNode* Next; }; class Locations { private: int size; public: Locations(); // constructor for the class locationNode* Head; int Add(locationNode* Item); }; and here is the code for the file containing the main method: // U08221.cpp : main project file. include "stdafx.h" include "Locations.h" include iostream include string using namespace std; int n = 0; int x; string cityNameInput; bool acceptedInput = false; int Locations::Add(locationNode *NewItem) { locationNode *Sample = new locationNode; Sample = NewItem; Sample-Next = Head; Head = Sample; return size++; } void CorrectCase(string name) // Correct upper and lower case letters of input { x = name.size(); int firstLetVal = name[0], letVal; n = 1; // variable for name index from second letter onwards if((name[0] 90) && (name[0] < 123)) // First letter is lower case { firstLetVal = firstLetVal - 32; // Capitalise first letter name[0] = firstLetVal; } while(n <= x - 1) { if((name[n] = 65) && (name[n] <= 90)) { letVal = name[n] + 32; name[n] = letVal; } n++; } cityNameInput = name; } void nameValidation(string name) { n = 0; // start from first letter x = name.size(); while(!acceptedInput) { if((name[n] = 65) && (name[n] <= 122)) // is in the range of letters { while(n <= x - 1) { while((name[n] =91) && (name[n] <=97)) // ERROR!! { cout << "Please enter a valid city name" << endl; cin name; } n++; } } else { cout << "Please enter a valid city name" << endl; cin name; } if(n <= x - 1) { acceptedInput = true; } } cityNameInput = name; } int main(array ^args) { cout << "Enter a city name" << endl; cin cityNameInput; nameValidation(cityNameInput); // check is made up of valid characters CorrectCase(cityNameInput); // corrects name to standard format of capitalised first letter, and lower case subsequent letters cout << cityNameInput; cin cityNameInput; Locations::Locations(); Locations *Parts = new Locations(); locationNode *Part; Part = new locationNode; //Part-nodeCityName = "London"; Part-nodeLati = 87; Part-nodeLongi = 80; Parts-Add(Part); } I am familiar with the concepts but somewhat inexperienced with OOP so am making some silly errors that you can never find when you've stared at something too long. Any help you can offer will be appreciated! Thanks

    Read the article

  • Php mail pulling form data from previous page

    - by Mark
    So I have a form being filled out on one php like so: <p> <label for="first_name">First Name: </label> <input type="text" size="30" name="first_name" id="first_name"/> </p> <p> <label for="last_name"> Last Name:</label> <input type="text" size="30" name="last_name" id="last_name"/> </p> <p> <label for="address_street">Street:</label> <input type="text" size="30" name="address_street" id="address_street"/> </p> <p> <label for="address_city">City:</label> <input type="text" size="30" name="address_city" id="address_city"/> </p> <p> <label for="address_state">State/Province:</label> <input type="text" size="30" name="address_state" id="address_state"/> </p> <p> <label for="email">Your e-mail: </label> <input type="text" size="30" name="email" id="email"/> </p> <p> <label for="phone">Your phone number: </label> <input type="text" size="30" name="phone" id="phone"/> </p> This is on one php page. From here, it goes to another php which part of it contains script to send a html email to recipient. Problem is, I cannot seem to get it to pull the variables even though I thought I declared them correctly and mixed them into the html correctly. <?php $first_name = $_POST['first_name']; $last_name = $_POST['last_name']; $to = "[email protected], [email protected]"; $subject = "HTML email for ALPS"; $message .= ' <html> <body> <div style="display: inline-block; width: 28%; float: left;"> <img src="http://englishintheusa.com/images/alps-logo.jpg" alt="ALPS Language School" /> </div> <div style="display: inline-block; width: 68%; float: right;"> <p style="color: #4F81BD; font-size: 20px; text-decoration: underline;">Thanks You For Your Inquiry!</p> </div> <div style="padding-left: 20px; color: #666666; font-size: 16.8px; clear: both;"> <p>Dear $first_name $last_name ,</p> </br > <p>Thank you for the following inquiry:</p> </br > </br > </br > </br > <p>****Comment goes here****</p> </br > </br > <p>We will contact you within 2 business days. Our office is open Monday-Friday, 8:30 AM - 5:00 PM Pacific Standard Time.</p> </br > <p>Thank you for your interest!</p> </br > </br > <p>Best Regards,</p> </br > </br > <p>ALPS Language School</p> </br > </br > <p>430 Broadway East</p> <p>Seattle WA 98102</p> <p>Phone: 206.720.6363</p> <p>Fax: 206. 720.1806</p> <p>Email: [email protected]</p> </div> </body> </html>'; // Always set content-type when sending HTML email $headers .= "MIME-Version: 1.0" . "\r\n"; $headers .= "Content-type:text/html;charset=UTF-8" . "\r\n"; // More headers mail($to,$subject,$message,$headers); ?> So you see where I am trying to get first_name and last_name. Well it doesn't come out correctly. Can someone help here?

    Read the article

  • How to detect crashing tabed webbrowser and handle it?

    - by David Eaton
    I have a desktop application (forms) with a tab control, I assign a tab and a new custom webrowser control. I open up about 10 of these tabs. Each one visits about 100 - 500 different pages. The trouble is that if 1 webbrowser control has a problem it shuts down the entire program. I want to be able to close the offending webbrowser control and open a new one in it's place. Is there any event that I need to subscribe to catch a crashing or unresponsive webbrowser control ? I am using C# on windows 7 (Forms), .NET framework v4 =============================================================== UPDATE: 1 - The Tabbed WebBrowser Example Here is the code I have and How I use the webbrowser control in the most basic way. Create a new forms project and name it SimpleWeb Add a new class and name it myWeb.cs, here is the code to use. using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Windows.Forms; using System.Security.Policy; namespace SimpleWeb { //inhert all of webbrowser class myWeb : WebBrowser { public myWeb() { //no javascript errors this.ScriptErrorsSuppressed = true; //Something we want set? AssignEvents(); } //keep near the top private void AssignEvents() { //assign WebBrowser events to our custom methods Navigated += myWeb_Navigated; DocumentCompleted += myWeb_DocumentCompleted; Navigating += myWeb_Navigating; NewWindow += myWeb_NewWindow; } #region Events //List of events:http://msdn.microsoft.com/en-us/library/system.windows.forms.webbrowser_events%28v=vs.100%29.aspx //Fired when a new windows opens private void myWeb_NewWindow(object sender, System.ComponentModel.CancelEventArgs e) { //cancel all popup windows e.Cancel = true; //beep to let you know canceled new window Console.Beep(9000, 200); } //Fired before page is navigated (not sure if its before or during?) private void myWeb_Navigating(object sender, System.Windows.Forms.WebBrowserNavigatingEventArgs args) { } //Fired after page is navigated (but not loaded) private void myWeb_Navigated(object sender, System.Windows.Forms.WebBrowserNavigatedEventArgs args) { } //Fired after page is loaded (Catch 22 - Iframes could be considered a page, can fire more than once. Ads are good examples) private void myWeb_DocumentCompleted(System.Object sender, System.Windows.Forms.WebBrowserDocumentCompletedEventArgs args) { } #endregion //Answer supplied by mo. (modified)? public void OpenUrl(string url) { try { //this.OpenUrl(url); this.Navigate(url); } catch (Exception ex) { MessageBox.Show("Your App Crashed! Because = " + ex.ToString()); //MyApplication.HandleException(ex); } } //Keep near the bottom private void RemoveEvents() { //Remove Events Navigated -= myWeb_Navigated; DocumentCompleted -= myWeb_DocumentCompleted; Navigating -= myWeb_Navigating; NewWindow -= myWeb_NewWindow; } } } On Form1 drag a standard tabControl and set the dock to fill, you can go into the tab collection and delete the pre-populated tabs if you like. Right Click on Form1 and Select "View Code" and replace it with this code. using System; using System.Collections.Generic; using System.ComponentModel; using System.Data; using System.Drawing; using System.Linq; using System.Text; using System.Windows.Forms; using mshtml; namespace SimpleWeb { public partial class Form1 : Form { public Form1() { InitializeComponent(); //Load Up 10 Tabs for (int i = 0; i <= 10; i++) { newTab("Test_" + i, "http://wwww.yahoo.com"); } } private void newTab(string Title, String Url) { //Create a new Tab TabPage newTab = new TabPage(); newTab.Name = Title; newTab.Text = Title; //create webbrowser Instance myWeb newWeb = new myWeb(); //Add webbrowser to new tab newTab.Controls.Add(newWeb); newWeb.Dock = DockStyle.Fill; //Add New Tab to Tab Pages tabControl1.TabPages.Add(newTab); newWeb.OpenUrl(Url); } } } Save and Run the project. Using the answer below by mo. , you can surf the first url with no problem, but what about all the urls the user clicks on? How do we check those? I prefer not to add events to every single html element on a page, there has to be a way to run the new urls thru the function OpenUrl before it navigates without having an endless loop. Thanks.

    Read the article

  • Implicit constructor available for all types derived from Base excepted the current type?

    - by Vincent
    The following code sum up my problem : template<class Parameter> class Base {}; template<class Parameter1, class Parameter2, class Parameter> class Derived1 : public Base<Parameter> { }; template<class Parameter1, class Parameter2, class Parameter> class Derived2 : public Base<Parameter> { public : // Copy constructor Derived2(const Derived2& x); // An EXPLICIT constructor that does a special conversion for a Derived2 // with other template parameters template<class OtherParameter1, class OtherParameter2, class OtherParameter> explicit Derived2( const Derived2<OtherParameter1, OtherParameter2, OtherParameter>& x ); // Now the problem : I want an IMPLICIT constructor that will work for every // type derived from Base EXCEPT // Derived2<OtherParameter1, OtherParameter2, OtherParameter> template<class Type, class = typename std::enable_if</* SOMETHING */>::type> Derived2(const Type& x); }; How to restrict an implicit constructor to all classes derived from the parent class excepted the current class whatever its template parameters, considering that I already have an explicit constructor as in the example code ? EDIT : For the implicit constructor from Base, I can obviously write : template<class OtherParameter> Derived2(const Base<OtherParameter>& x); But in that case, do I have the guaranty that the compiler will not use this constructor as an implicit constructor for Derived2<OtherParameter1, OtherParameter2, OtherParameter> ? EDIT2: Here I have a test : (LWS here : http://liveworkspace.org/code/cd423fb44fb4c97bc3b843732d837abc) #include <iostream> template<typename Type> class Base {}; template<typename Type> class Other : public Base<Type> {}; template<typename Type> class Derived : public Base<Type> { public: Derived() {std::cout<<"empty"<<std::endl;} Derived(const Derived<Type>& x) {std::cout<<"copy"<<std::endl;} template<typename OtherType> explicit Derived(const Derived<OtherType>& x) {std::cout<<"explicit"<<std::endl;} template<typename OtherType> Derived(const Base<OtherType>& x) {std::cout<<"implicit"<<std::endl;} }; int main() { Other<int> other0; Other<double> other1; std::cout<<"1 = "; Derived<int> dint1; // <- empty std::cout<<"2 = "; Derived<int> dint2; // <- empty std::cout<<"3 = "; Derived<double> ddouble; // <- empty std::cout<<"4 = "; Derived<double> ddouble1(ddouble); // <- copy std::cout<<"5 = "; Derived<double> ddouble2(dint1); // <- explicit std::cout<<"6 = "; ddouble = other0; // <- implicit std::cout<<"7 = "; ddouble = other1; // <- implicit std::cout<<"8 = "; ddouble = ddouble2; // <- nothing (normal : default assignment) std::cout<<"\n9 = "; ddouble = Derived<double>(dint1); // <- explicit std::cout<<"10 = "; ddouble = dint2; // <- implicit : WHY ?!?! return 0; } The last line worry me. Is it ok with the C++ standard ? Is it a bug of g++ ?

    Read the article

  • how to avoid temporaries when copying weakly typed object

    - by Truncheon
    Hi. I'm writing a series classes that inherit from a base class using virtual. They are INT, FLOAT and STRING objects that I want to use in a scripting language. I'm trying to implement weak typing, but I don't want STRING objects to return copies of themselves when used in the following way (instead I would prefer to have a reference returned which can be used in copying): a = "hello "; b = "world"; c = a + b; I have written the following code as a mock example: #include <iostream> #include <string> #include <cstdio> #include <cstdlib> std::string dummy("<int object cannot return string reference>"); struct BaseImpl { virtual bool is_string() = 0; virtual int get_int() = 0; virtual std::string get_string_copy() = 0; virtual std::string const& get_string_ref() = 0; }; struct INT : BaseImpl { int value; INT(int i = 0) : value(i) { std::cout << "constructor called\n"; } INT(BaseImpl& that) : value(that.get_int()) { std::cout << "copy constructor called\n"; } bool is_string() { return false; } int get_int() { return value; } std::string get_string_copy() { char buf[33]; sprintf(buf, "%i", value); return buf; } std::string const& get_string_ref() { return dummy; } }; struct STRING : BaseImpl { std::string value; STRING(std::string s = "") : value(s) { std::cout << "constructor called\n"; } STRING(BaseImpl& that) { if (that.is_string()) value = that.get_string_ref(); else value = that.get_string_copy(); std::cout << "copy constructor called\n"; } bool is_string() { return true; } int get_int() { return atoi(value.c_str()); } std::string get_string_copy() { return value; } std::string const& get_string_ref() { return value; } }; struct Base { BaseImpl* impl; Base(BaseImpl* p = 0) : impl(p) {} ~Base() { delete impl; } }; int main() { Base b1(new INT(1)); Base b2(new STRING("Hello world")); Base b3(new INT(*b1.impl)); Base b4(new STRING(*b2.impl)); std::cout << "\n"; std::cout << b1.impl->get_int() << "\n"; std::cout << b2.impl->get_int() << "\n"; std::cout << b3.impl->get_int() << "\n"; std::cout << b4.impl->get_int() << "\n"; std::cout << "\n"; std::cout << b1.impl->get_string_ref() << "\n"; std::cout << b2.impl->get_string_ref() << "\n"; std::cout << b3.impl->get_string_ref() << "\n"; std::cout << b4.impl->get_string_ref() << "\n"; std::cout << "\n"; std::cout << b1.impl->get_string_copy() << "\n"; std::cout << b2.impl->get_string_copy() << "\n"; std::cout << b3.impl->get_string_copy() << "\n"; std::cout << b4.impl->get_string_copy() << "\n"; return 0; } It was necessary to add an if check in the STRING class to determine whether its safe to request a reference instead of a copy: Script code: a = "test"; b = a; c = 1; d = "" + c; /* not safe to request reference by standard */ C++ code: STRING(BaseImpl& that) { if (that.is_string()) value = that.get_string_ref(); else value = that.get_string_copy(); std::cout << "copy constructor called\n"; } If was hoping there's a way of moving that if check into compile time, rather than run time.

    Read the article

  • Why does decorating a class break the descriptor protocol, thus preventing staticmethod objects from behaving as expected?

    - by Robru
    I need a little bit of help understanding the subtleties of the descriptor protocol in Python, as it relates specifically to the behavior of staticmethod objects. I'll start with a trivial example, and then iteratively expand it, examining it's behavior at each step: class Stub: @staticmethod def do_things(): """Call this like Stub.do_things(), with no arguments or instance.""" print "Doing things!" At this point, this behaves as expected, but what's going on here is a bit subtle: When you call Stub.do_things(), you are not invoking do_things directly. Instead, Stub.do_things refers to a staticmethod instance, which has wrapped the function we want up inside it's own descriptor protocol such that you are actually invoking staticmethod.__get__, which first returns the function that we want, and then gets called afterwards. >>> Stub <class __main__.Stub at 0x...> >>> Stub.do_things <function do_things at 0x...> >>> Stub.__dict__['do_things'] <staticmethod object at 0x...> >>> Stub.do_things() Doing things! So far so good. Next, I need to wrap the class in a decorator that will be used to customize class instantiation -- the decorator will determine whether to allow new instantiations or provide cached instances: def deco(cls): def factory(*args, **kwargs): # pretend there is some logic here determining # whether to make a new instance or not return cls(*args, **kwargs) return factory @deco class Stub: @staticmethod def do_things(): """Call this like Stub.do_things(), with no arguments or instance.""" print "Doing things!" Now, naturally this part as-is would be expected to break staticmethods, because the class is now hidden behind it's decorator, ie, Stub not a class at all, but an instance of factory that is able to produce instances of Stub when you call it. Indeed: >>> Stub <function factory at 0x...> >>> Stub.do_things Traceback (most recent call last): File "<stdin>", line 1, in <module> AttributeError: 'function' object has no attribute 'do_things' >>> Stub() <__main__.Stub instance at 0x...> >>> Stub().do_things <function do_things at 0x...> >>> Stub().do_things() Doing things! So far I understand what's happening here. My goal is to restore the ability for staticmethods to function as you would expect them to, even though the class is wrapped. As luck would have it, the Python stdlib includes something called functools, which provides some tools just for this purpose, ie, making functions behave more like other functions that they wrap. So I change my decorator to look like this: def deco(cls): @functools.wraps(cls) def factory(*args, **kwargs): # pretend there is some logic here determining # whether to make a new instance or not return cls(*args, **kwargs) return factory Now, things start to get interesting: >>> Stub <function Stub at 0x...> >>> Stub.do_things <staticmethod object at 0x...> >>> Stub.do_things() Traceback (most recent call last): File "<stdin>", line 1, in <module> TypeError: 'staticmethod' object is not callable >>> Stub() <__main__.Stub instance at 0x...> >>> Stub().do_things <function do_things at 0x...> >>> Stub().do_things() Doing things! Wait.... what? functools copies the staticmethod over to the wrapping function, but it's not callable? Why not? What did I miss here? I was playing around with this for a bit and I actually came up with my own reimplementation of staticmethod that allows it to function in this situation, but I don't really understand why it was necessary or if this is even the best solution to this problem. Here's the complete example: class staticmethod(object): """Make @staticmethods play nice with decorated classes.""" def __init__(self, func): self.func = func def __call__(self, *args, **kwargs): """Provide the expected behavior inside decorated classes.""" return self.func(*args, **kwargs) def __get__(self, obj, objtype=None): """Re-implement the standard behavior for undecorated classes.""" return self.func def deco(cls): @functools.wraps(cls) def factory(*args, **kwargs): # pretend there is some logic here determining # whether to make a new instance or not return cls(*args, **kwargs) return factory @deco class Stub: @staticmethod def do_things(): """Call this like Stub.do_things(), with no arguments or instance.""" print "Doing things!" Indeed it works exactly as expected: >>> Stub <function Stub at 0x...> >>> Stub.do_things <__main__.staticmethod object at 0x...> >>> Stub.do_things() Doing things! >>> Stub() <__main__.Stub instance at 0x...> >>> Stub().do_things <function do_things at 0x...> >>> Stub().do_things() Doing things! What approach would you take to make a staticmethod behave as expected inside a decorated class? Is this the best way? Why doesn't the builtin staticmethod implement __call__ on it's own in order for this to just work without any fuss? Thanks.

    Read the article

  • Integrating JavaScript Unit Tests with Visual Studio

    - by Stephen Walther
    Modern ASP.NET web applications take full advantage of client-side JavaScript to provide better interactivity and responsiveness. If you are building an ASP.NET application in the right way, you quickly end up with lots and lots of JavaScript code. When writing server code, you should be writing unit tests. One big advantage of unit tests is that they provide you with a safety net that enable you to safely modify your existing code – for example, fix bugs, add new features, and make performance enhancements -- without breaking your existing code. Every time you modify your code, you can execute your unit tests to verify that you have not broken anything. For the same reason that you should write unit tests for your server code, you should write unit tests for your client code. JavaScript is just as susceptible to bugs as C#. There is no shortage of unit testing frameworks for JavaScript. Each of the major JavaScript libraries has its own unit testing framework. For example, jQuery has QUnit, Prototype has UnitTestJS, YUI has YUI Test, and Dojo has Dojo Objective Harness (DOH). The challenge is integrating a JavaScript unit testing framework with Visual Studio. Visual Studio and Visual Studio ALM provide fantastic support for server-side unit tests. You can easily view the results of running your unit tests in the Visual Studio Test Results window. You can set up a check-in policy which requires that all unit tests pass before your source code can be committed to the source code repository. In addition, you can set up Team Build to execute your unit tests automatically. Unfortunately, Visual Studio does not provide “out-of-the-box” support for JavaScript unit tests. MS Test, the unit testing framework included in Visual Studio, does not support JavaScript unit tests. As soon as you leave the server world, you are left on your own. The goal of this blog entry is to describe one approach to integrating JavaScript unit tests with MS Test so that you can execute your JavaScript unit tests side-by-side with your C# unit tests. The goal is to enable you to execute JavaScript unit tests in exactly the same way as server-side unit tests. You can download the source code described by this project by scrolling to the end of this blog entry. Rejected Approach: Browser Launchers One popular approach to executing JavaScript unit tests is to use a browser as a test-driver. When you use a browser as a test-driver, you open up a browser window to execute and view the results of executing your JavaScript unit tests. For example, QUnit – the unit testing framework for jQuery – takes this approach. The following HTML page illustrates how you can use QUnit to create a unit test for a function named addNumbers(). <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd"> <html> <head> <title>Using QUnit</title> <link rel="stylesheet" href="http://github.com/jquery/qunit/raw/master/qunit/qunit.css" type="text/css" /> </head> <body> <h1 id="qunit-header">QUnit example</h1> <h2 id="qunit-banner"></h2> <div id="qunit-testrunner-toolbar"></div> <h2 id="qunit-userAgent"></h2> <ol id="qunit-tests"></ol> <div id="qunit-fixture">test markup, will be hidden</div> <script type="text/javascript" src="http://code.jquery.com/jquery-latest.js"></script> <script type="text/javascript" src="http://github.com/jquery/qunit/raw/master/qunit/qunit.js"></script> <script type="text/javascript"> // The function to test function addNumbers(a, b) { return a+b; } // The unit test test("Test of addNumbers", function () { equals(4, addNumbers(1,3), "1+3 should be 4"); }); </script> </body> </html> This test verifies that calling addNumbers(1,3) returns the expected value 4. When you open this page in a browser, you can see that this test does, in fact, pass. The idea is that you can quickly refresh this QUnit HTML JavaScript test driver page in your browser whenever you modify your JavaScript code. In other words, you can keep a browser window open and keep refreshing it over and over while you are developing your application. That way, you can know very quickly whenever you have broken your JavaScript code. While easy to setup, there are several big disadvantages to this approach to executing JavaScript unit tests: You must view your JavaScript unit test results in a different location than your server unit test results. The JavaScript unit test results appear in the browser and the server unit test results appear in the Visual Studio Test Results window. Because all of your unit test results don’t appear in a single location, you are more likely to introduce bugs into your code without noticing it. Because your unit tests are not integrated with Visual Studio – in particular, MS Test -- you cannot easily include your JavaScript unit tests when setting up check-in policies or when performing automated builds with Team Build. A more sophisticated approach to using a browser as a test-driver is to automate the web browser. Instead of launching the browser and loading the test code yourself, you use a framework to automate this process. There are several different testing frameworks that support this approach: · Selenium – Selenium is a very powerful framework for automating browser tests. You can create your tests by recording a Firefox session or by writing the test driver code in server code such as C#. You can learn more about Selenium at http://seleniumhq.org/. LTAF – The ASP.NET team uses the Lightweight Test Automation Framework to test JavaScript code in the ASP.NET framework. You can learn more about LTAF by visiting the project home at CodePlex: http://aspnet.codeplex.com/releases/view/35501 jsTestDriver – This framework uses Java to automate the browser. jsTestDriver creates a server which can be used to automate multiple browsers simultaneously. This project is located at http://code.google.com/p/js-test-driver/ TestSwam – This framework, created by John Resig, uses PHP to automate the browser. Like jsTestDriver, the framework creates a test server. You can open multiple browsers that are automated by the test server. Learn more about TestSwarm by visiting the following address: https://github.com/jeresig/testswarm/wiki Yeti – This is the framework introduced by Yahoo for automating browser tests. Yeti uses server-side JavaScript and depends on Node.js. Learn more about Yeti at http://www.yuiblog.com/blog/2010/08/25/introducing-yeti-the-yui-easy-testing-interface/ All of these frameworks are great for integration tests – however, they are not the best frameworks to use for unit tests. In one way or another, all of these frameworks depend on executing tests within the context of a “living and breathing” browser. If you create an ASP.NET Unit Test then Visual Studio will launch a web server before executing the unit test. Why is launching a web server so bad? It is not the worst thing in the world. However, it does introduce dependencies that prevent your code from being tested in isolation. One of the defining features of a unit test -- versus an integration test – is that a unit test tests code in isolation. Another problem with launching a web server when performing unit tests is that launching a web server can be slow. If you cannot execute your unit tests quickly, you are less likely to execute your unit tests each and every time you make a code change. You are much more likely to fall into the pit of failure. Launching a browser when performing a JavaScript unit test has all of the same disadvantages as launching a web server when performing an ASP.NET unit test. Instead of testing a unit of JavaScript code in isolation, you are testing JavaScript code within the context of a particular browser. Using the frameworks listed above for integration tests makes perfect sense. However, I want to consider a different approach for creating unit tests for JavaScript code. Using Server-Side JavaScript for JavaScript Unit Tests A completely different approach to executing JavaScript unit tests is to perform the tests outside of any browser. If you really want to test JavaScript then you should test JavaScript and leave the browser out of the testing process. There are several ways that you can execute JavaScript on the server outside the context of any browser: Rhino – Rhino is an implementation of JavaScript written in Java. The Rhino project is maintained by the Mozilla project. Learn more about Rhino at http://www.mozilla.org/rhino/ V8 – V8 is the open-source Google JavaScript engine written in C++. This is the JavaScript engine used by the Chrome web browser. You can download V8 and embed it in your project by visiting http://code.google.com/p/v8/ JScript – JScript is the JavaScript Script Engine used by Internet Explorer (up to but not including Internet Explorer 9), Windows Script Host, and Active Server Pages. Internet Explorer is still the most popular web browser. Therefore, I decided to focus on using the JScript Script Engine to execute JavaScript unit tests. Using the Microsoft Script Control There are two basic ways that you can pass JavaScript to the JScript Script Engine and execute the code: use the Microsoft Windows Script Interfaces or use the Microsoft Script Control. The difficult and proper way to execute JavaScript using the JScript Script Engine is to use the Microsoft Windows Script Interfaces. You can learn more about the Script Interfaces by visiting http://msdn.microsoft.com/en-us/library/t9d4xf28(VS.85).aspx The main disadvantage of using the Script Interfaces is that they are difficult to use from .NET. There is a great series of articles on using the Script Interfaces from C# located at http://www.drdobbs.com/184406028. I picked the easier alternative and used the Microsoft Script Control. The Microsoft Script Control is an ActiveX control that provides a higher level abstraction over the Window Script Interfaces. You can download the Microsoft Script Control from here: http://www.microsoft.com/downloads/en/details.aspx?FamilyID=d7e31492-2595-49e6-8c02-1426fec693ac After you download the Microsoft Script Control, you need to add a reference to it to your project. Select the Visual Studio menu option Project, Add Reference to open the Add Reference dialog. Select the COM tab and add the Microsoft Script Control 1.0. Using the Script Control is easy. You call the Script Control AddCode() method to add JavaScript code to the Script Engine. Next, you call the Script Control Run() method to run a particular JavaScript function. The reference documentation for the Microsoft Script Control is located at the MSDN website: http://msdn.microsoft.com/en-us/library/aa227633%28v=vs.60%29.aspx Creating the JavaScript Code to Test To keep things simple, let’s imagine that you want to test the following JavaScript function named addNumbers() which simply adds two numbers together: MvcApplication1\Scripts\Math.js function addNumbers(a, b) { return 5; } Notice that the addNumbers() method always returns the value 5. Right-now, it will not pass a good unit test. Create this file and save it in your project with the name Math.js in your MVC project’s Scripts folder (Save the file in your actual MVC application and not your MVC test application). Creating the JavaScript Test Helper Class To make it easier to use the Microsoft Script Control in unit tests, we can create a helper class. This class contains two methods: LoadFile() – Loads a JavaScript file. Use this method to load the JavaScript file being tested or the JavaScript file containing the unit tests. ExecuteTest() – Executes the JavaScript code. Use this method to execute a JavaScript unit test. Here’s the code for the JavaScriptTestHelper class: JavaScriptTestHelper.cs   using System; using System.IO; using Microsoft.VisualStudio.TestTools.UnitTesting; using MSScriptControl; namespace MvcApplication1.Tests { public class JavaScriptTestHelper : IDisposable { private ScriptControl _sc; private TestContext _context; /// <summary> /// You need to use this helper with Unit Tests and not /// Basic Unit Tests because you need a Test Context /// </summary> /// <param name="testContext">Unit Test Test Context</param> public JavaScriptTestHelper(TestContext testContext) { if (testContext == null) { throw new ArgumentNullException("TestContext"); } _context = testContext; _sc = new ScriptControl(); _sc.Language = "JScript"; _sc.AllowUI = false; } /// <summary> /// Load the contents of a JavaScript file into the /// Script Engine. /// </summary> /// <param name="path">Path to JavaScript file</param> public void LoadFile(string path) { var fileContents = File.ReadAllText(path); _sc.AddCode(fileContents); } /// <summary> /// Pass the path of the test that you want to execute. /// </summary> /// <param name="testMethodName">JavaScript function name</param> public void ExecuteTest(string testMethodName) { dynamic result = null; try { result = _sc.Run(testMethodName, new object[] { }); } catch { var error = ((IScriptControl)_sc).Error; if (error != null) { var description = error.Description; var line = error.Line; var column = error.Column; var text = error.Text; var source = error.Source; if (_context != null) { var details = String.Format("{0} \r\nLine: {1} Column: {2}", source, line, column); _context.WriteLine(details); } } throw new AssertFailedException(error.Description); } } public void Dispose() { _sc = null; } } }     Notice that the JavaScriptTestHelper class requires a Test Context to be instantiated. For this reason, you can use the JavaScriptTestHelper only with a Visual Studio Unit Test and not a Basic Unit Test (These are two different types of Visual Studio project items). Add the JavaScriptTestHelper file to your MVC test application (for example, MvcApplication1.Tests). Creating the JavaScript Unit Test Next, we need to create the JavaScript unit test function that we will use to test the addNumbers() function. Create a folder in your MVC test project named JavaScriptTests and add the following JavaScript file to this folder: MvcApplication1.Tests\JavaScriptTests\MathTest.js /// <reference path="JavaScriptUnitTestFramework.js"/> function testAddNumbers() { // Act var result = addNumbers(1, 3); // Assert assert.areEqual(4, result, "addNumbers did not return right value!"); }   The testAddNumbers() function takes advantage of another JavaScript library named JavaScriptUnitTestFramework.js. This library contains all of the code necessary to make assertions. Add the following JavaScriptnitTestFramework.js to the same folder as the MathTest.js file: MvcApplication1.Tests\JavaScriptTests\JavaScriptUnitTestFramework.js var assert = { areEqual: function (expected, actual, message) { if (expected !== actual) { throw new Error("Expected value " + expected + " is not equal to " + actual + ". " + message); } } }; There is only one type of assertion supported by this file: the areEqual() assertion. Most likely, you would want to add additional types of assertions to this file to make it easier to write your JavaScript unit tests. Deploying the JavaScript Test Files This step is non-intuitive. When you use Visual Studio to run unit tests, Visual Studio creates a new folder and executes a copy of the files in your project. After you run your unit tests, your Visual Studio Solution will contain a new folder named TestResults that includes a subfolder for each test run. You need to configure Visual Studio to deploy your JavaScript files to the test run folder or Visual Studio won’t be able to find your JavaScript files when you execute your unit tests. You will get an error that looks something like this when you attempt to execute your unit tests: You can configure Visual Studio to deploy your JavaScript files by adding a Test Settings file to your Visual Studio Solution. It is important to understand that you need to add this file to your Visual Studio Solution and not a particular Visual Studio project. Right-click your Solution in the Solution Explorer window and select the menu option Add, New Item. Select the Test Settings item and click the Add button. After you create a Test Settings file for your solution, you can indicate that you want a particular folder to be deployed whenever you perform a test run. Select the menu option Test, Edit Test Settings to edit your test configuration file. Select the Deployment tab and select your MVC test project’s JavaScriptTest folder to deploy. Click the Apply button and the Close button to save the changes and close the dialog. Creating the Visual Studio Unit Test The very last step is to create the Visual Studio unit test (the MS Test unit test). Add a new unit test to your MVC test project by selecting the menu option Add New Item and selecting the Unit Test project item (Do not select the Basic Unit Test project item): The difference between a Basic Unit Test and a Unit Test is that a Unit Test includes a Test Context. We need this Test Context to use the JavaScriptTestHelper class that we created earlier. Enter the following test method for the new unit test: [TestMethod] public void TestAddNumbers() { var jsHelper = new JavaScriptTestHelper(this.TestContext); // Load JavaScript files jsHelper.LoadFile("JavaScriptUnitTestFramework.js"); jsHelper.LoadFile(@"..\..\..\MvcApplication1\Scripts\Math.js"); jsHelper.LoadFile("MathTest.js"); // Execute JavaScript Test jsHelper.ExecuteTest("testAddNumbers"); } This code uses the JavaScriptTestHelper to load three files: JavaScripUnitTestFramework.js – Contains the assert functions. Math.js – Contains the addNumbers() function from your MVC application which is being tested. MathTest.js – Contains the JavaScript unit test function. Next, the test method calls the JavaScriptTestHelper ExecuteTest() method to execute the testAddNumbers() JavaScript function. Running the Visual Studio JavaScript Unit Test After you complete all of the steps described above, you can execute the JavaScript unit test just like any other unit test. You can use the keyboard combination CTRL-R, CTRL-A to run all of the tests in the current Visual Studio Solution. Alternatively, you can use the buttons in the Visual Studio toolbar to run the tests: (Unfortunately, the Run All Impacted Tests button won’t work correctly because Visual Studio won’t detect that your JavaScript code has changed. Therefore, you should use either the Run Tests in Current Context or Run All Tests in Solution options instead.) The results of running the JavaScript tests appear side-by-side with the results of running the server tests in the Test Results window. For example, if you Run All Tests in Solution then you will get the following results: Notice that the TestAddNumbers() JavaScript test has failed. That is good because our addNumbers() function is hard-coded to always return the value 5. If you double-click the failing JavaScript test, you can view additional details such as the JavaScript error message and the line number of the JavaScript code that failed: Summary The goal of this blog entry was to explain an approach to creating JavaScript unit tests that can be easily integrated with Visual Studio and Visual Studio ALM. I described how you can use the Microsoft Script Control to execute JavaScript on the server. By taking advantage of the Microsoft Script Control, we were able to execute our JavaScript unit tests side-by-side with all of our other unit tests and view the results in the standard Visual Studio Test Results window. You can download the code discussed in this blog entry from here: http://StephenWalther.com/downloads/Blog/JavaScriptUnitTesting/JavaScriptUnitTests.zip Before running this code, you need to first install the Microsoft Script Control which you can download from here: http://www.microsoft.com/downloads/en/details.aspx?FamilyID=d7e31492-2595-49e6-8c02-1426fec693ac

    Read the article

< Previous Page | 522 523 524 525 526 527 528 529 530 531 532 533  | Next Page >