Search Results

Search found 21908 results on 877 pages for 'content catalog'.

Page 528/877 | < Previous Page | 524 525 526 527 528 529 530 531 532 533 534 535  | Next Page >

  • How to get structure of a Google Protobuf message without the definition

    - by dqminh
    I have to get the message structure of a protobuf message transfered to me without the message's definition. Using UnknownFieldSet methods, I was able to get a string representation of the message as below: 1: "a" 2: { 3:"b" 4:"c" } What data structure does field 2 represent ? Using UnknownFieldSet.Field.getGroupList i was able to get the content of field 3 and 4, does that means field 2 has the "deprecated" group structure ?

    Read the article

  • How do I do a cross domain GET of an XML feed in a WordPress plugin?

    - by MM.
    I would like to use AJAX to display dynamic content via my wordpress plugin. The data source is an xml feed from a remote domain (not owned by me). I have tried using JQuery plugins that use YQL to do cross domain Ajax calls; however, they are geared towards json and tend to return the data to me in a mangled state. My question is, is there a way of obtaining an xml feed using ajax from a remote domain?

    Read the article

  • How to centre list-items in a column

    - by unknowndomain
    Hey all, I am trying to centre page numbers at the bottom of this test blog... http://jocelynwarner.com/test/ in the centre between the previous and next buttons however I cannot think how to do it, I tried a few different tutorials but they didn't really seem to help with this. Any hints on how to make them sit centrally in the left column (the width of the blog content - sidebar) would be greatly appreciated.

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • Java writes bad wave files

    - by Cliff
    I'm writing out wave files in Java using AudioInputStream output = new AudioInputStream(new ByteArrayInputStream(rawPCMSamples), new AudioFormat(22000,16,1,true,false), rawPCMSamples.length) AudioSystem.write(output, AudioFileFormat.Type.WAVE, new FileOutputStream('somefile.wav')) And I get what appears to be corrupt wave files on OSX. They won't play from Finder however using the same code behind a servlet writing directly to the response stream and setting the Content-Type to audio/wave seems to play fine in quicktime. What gives?

    Read the article

  • SimpleModal Strange ASP.NET Button problem

    - by bhsstudio
    Hi I have the following codes $('#<%= btnOpen.ClientID %>').click(function() { $('#content').modal(); }); <asp:Button ID="btnOpen" runat="server" Text="Open" /> When I click on the button, the modal window will appear for about 0.5 second and disappear right away.Can anyone help me please? Thanks a lot!

    Read the article

  • Unstructured database design

    - by Linh
    Hi all, According to normal way, we design the table with fields. Example with an article the table can contain fields as follows: title, content, author..... But how does everybody think if we add up some fields to a field?

    Read the article

  • Free ASP.Net (MVC/WebForms) based CMS which has plugins built in for connecting to Orkut and Faceboo

    - by SharePoint Newbie
    I looking for free ASP.NET based content management system (CMS) which has the following features: Blogs (Admin, some super users can have their own blogs) Forums (Admins can create forums. Some moderation features) Admin Dashboard Integration with LinkedIn, Orkut and Facebook (native or through freely available add-ons) Support for moderated user registration (moderated by Admin) Windows Sharepoint services 3.0 is an option. With some tweaking, it supports all the above and there are free third party web parts available. NB: The CMS listed must be free, as in beer.

    Read the article

  • Include code file into C#? Create library for others?

    - by Tomas
    Hi, I would like to know how can I embedd a code source file (if possible), something like that: class X { include "ClassXsource" } My second question - Can I build DLL or something like that for my colleagues to use? I need them to be able to call methods from my "part" but do not modify or view their content. Basically just use namespace "MyNamespace" and call its methods, but I have never done anything like that. Thanks

    Read the article

  • Fancybox: Get id of clicked anchor/element

    - by kastru
    I am trying to get the id of the clicked/shown element in fancybox. I have tried both "this.id" and "this.attr("id")" - but none of them works. $("a.lightbox_image").fancybox({ 'transitionIn': 'elastic', 'transitionOut': 'elastic', 'speedIn': 600, 'speedOut': 200, 'content': 'Id of element clicked'+this.attr("id") }); Any suggestions?

    Read the article

  • How do you hide an image tag based on an ajax response?

    - by Chris
    What is the correct jquery statement to replace the "//Needed magic" comments below so that the image tags are hidden or unhidden based on the AJAX responses? <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <title>JQuery</title> <style type="text/css"> .isSolvedImage{ width: 68px; height: 47px; border: 1px solid red; cursor: pointer; } </style> <script src="_js/jquery-1.4.2.min.js" type="text/javascript"> </script> </head> <body> <div id='true1.txt' class='isSolvedImage'> <img src="_images/solved.png"> </div> <div id='false1.txt' class='isSolvedImage'> <img src="_images/solved.png"> </div> <div id='true2.txt' class='isSolvedImage'> <img src="_images/solved.png"> </div> <div id='false2.txt' class='isSolvedImage'> <img src="_images/solved.png"> </div> <script type="text/javascript"> $(function(){ var getDivs = 0; //iterate div with class isSolvedImage $("div.isSolvedImage").each(function() { alert('div id--'+this.id); // send ajax requrest $.get(this.id, function(data) { // check if ajax response is 1 alert('div id--'+this.url+'--ajax response--'+data); if(data == 1){ alert('div id--'+this.url+'--Unhiding image--'); //Needed magic //Show image if data==1 } else{ alert('div id--'+this.url+'--Hiding image--'); //Needed magic //Hide image if data!=1 } }); }); }); </script> </body> </html>

    Read the article

  • Javascript sliding (preferably jQuery)

    - by jwzk
    I am trying to think of the name of the plugin (or a plugin) that slides content in (up or down). So I have a hidden div, I click on one of the titles/header, it opens the hidden div, if I click on another header it hides the other visible div, and slides up or down the new one. I can't think of it for some reason.. anyone?

    Read the article

  • paperclip plugin not support for I18n

    - by user354413
    I've added I18n support for error messages: Now you can define translations for the errors messages in e.g. your YAML locale file: en: paperclip: errors: attachment: size: "Invalid file size" content_type: "Unsupported content type" presence: "Cant' be blank" when I use validates_attachemnt_zie :avatar how to get error message?

    Read the article

  • How can I create an http response from scratch?

    - by ispiro
    I have code that returns an http response, but it also includes the content of the page. How can I create a response from scratch so it won't include anything except what I put in it? My code now: GCheckout.AutoGen.NotificationAcknowledgment response = new GCheckout.AutoGen.NotificationAcknowledgment(); response.serialnumber = serialNumber; HttpContext.Current.Response.Clear(); HttpContext.Current.Response.BinaryWrite(GCheckout.Util.EncodeHelper.Serialize(response)); HttpContext.Current.Response.StatusCode = 200;

    Read the article

  • I can't access certain subkeys in an entry in the registry

    - by shifuimam
    I'm trying to get to HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\GameUX\, but the only subkey being returned in C# is MachineSettings - even though there are additional subkeys, including Games and several keys named for different user SIDs. How can I access these other keys? Even a standard user account can read the content of both Games and that account's own SID (when looking in regedit)...

    Read the article

  • Validation is not working

    - by Joby Kurian
    hi...I have one asp content page.Its contain many controls like dropdownlist,textbox etc.All controls are inside a div tag.I gave required field validator for all my drop down list.i have one SAVE button that reside inside another div tag.I gave SAVE button cause validation true.But my problem is that, the validator is not working and the page.Isvalid property is true.What is the problem with my code?

    Read the article

  • Redirect to login page automatically after some time

    - by ASD
    How can we redirect to login page automatically after some time? I have a requirement to redirect to login page if the current page is idle for 10 minutes in Java/JSP. I tried to use <meta http-equiv="refresh" content="120;url=./login.html"> tag. This works only when I click on any link but not automatically after 2 mins(120secs). Can anyone tell me how to redirect to login page automatically?

    Read the article

  • Android : Connecting to MySQL using PHP

    - by user1771128
    I followed the following article http://blog.sptechnolab.com/2011/02/10/android/android-connecting-to-mysql-using-php/ I am able to execute my php file. I executed it individually and its working fine. The problem is in the android execution part. Am posting the Log Cat for the error am facing. Tried putting in a List View with id "list" but the error stil 10-28 16:08:27.201: E/AndroidRuntime(664): **FATAL EXCEPTION: main** 10-28 16:08:27.201: E/AndroidRuntime(664): java.lang.RuntimeException: Unable to start activity ComponentInfo{com.example.city/com.example.city.City}: java.lang.RuntimeException: Your content must have a ListView whose id attribute is 'android.R.id.list' 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1956) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1981) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread.access$600(ActivityThread.java:123) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1147) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.os.Handler.dispatchMessage(Handler.java:99) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.os.Looper.loop(Looper.java:137) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread.main(ActivityThread.java:4424) 10-28 16:08:27.201: E/AndroidRuntime(664): at java.lang.reflect.Method.invokeNative(Native Method) 10-28 16:08:27.201: E/AndroidRuntime(664): at java.lang.reflect.Method.invoke(Method.java:511) 10-28 16:08:27.201: E/AndroidRuntime(664): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:784) 10-28 16:08:27.201: E/AndroidRuntime(664): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:551) 10-28 16:08:27.201: E/AndroidRuntime(664): at dalvik.system.NativeStart.main(Native Method) 10-28 16:08:27.201: E/AndroidRuntime(664): Caused by: java.lang.RuntimeException: Your content must have a ListView whose id attribute is 'android.R.id.list' 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ListActivity.onContentChanged(ListActivity.java:243) 10-28 16:08:27.201: E/AndroidRuntime(664): at com.android.internal.policy.impl.PhoneWindow.setContentView(PhoneWindow.java:254) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.Activity.setContentView(Activity.java:1835) 10-28 16:08:27.201: E/AndroidRuntime(664): at com.example.city.City.onCreate(City.java:35) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.Activity.performCreate(Activity.java:4465) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1049) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1920) 10-28 16:08:27.201: E/AndroidRuntime(664): ... 11 more

    Read the article

< Previous Page | 524 525 526 527 528 529 530 531 532 533 534 535  | Next Page >