Search Results

Search found 21908 results on 877 pages for 'content catalog'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 528/877 | < Previous Page | 524 525 526 527 528 529 530 531 532 533 534 535  | Next Page >

  • How do I do a cross domain GET of an XML feed in a WordPress plugin?

    - by MM.
    I would like to use AJAX to display dynamic content via my wordpress plugin. The data source is an xml feed from a remote domain (not owned by me). I have tried using JQuery plugins that use YQL to do cross domain Ajax calls; however, they are geared towards json and tend to return the data to me in a mangled state. My question is, is there a way of obtaining an xml feed using ajax from a remote domain?

    Read the article

  • ipad saving excel sheet opened in uiwebview

    - by satyam
    I've few excel sheets and i want to distribut them along with ap. I want to create an application that open those excel sheets, allow user to modify the content and save the excel sheet as new file. For that purpose, I think I can open excel sheets in UIWebView that allows editing as well. But the trouble is, can I save edited Excel sheet in UIWebView back on to iPad? If Possible, how?

    Read the article

  • Unstructured database design

    - by Linh
    Hi all, According to normal way, we design the table with fields. Example with an article the table can contain fields as follows: title, content, author..... But how does everybody think if we add up some fields to a field?

    Read the article

  • Get main article image with PHP

    - by PaulAdamDavis
    Hello! I'd like to get the main image for an article, much like Facebook does when you post a link (but without the choosing image part). The data we have to work with is the whole pages HTML as a variable. The page & URL will be different for every time this function runs. Are there any libraries or classes that are particularly good at getting the main body of content, much like Instapaper that would be of any help?

    Read the article

  • How can I create an http response from scratch?

    - by ispiro
    I have code that returns an http response, but it also includes the content of the page. How can I create a response from scratch so it won't include anything except what I put in it? My code now: GCheckout.AutoGen.NotificationAcknowledgment response = new GCheckout.AutoGen.NotificationAcknowledgment(); response.serialnumber = serialNumber; HttpContext.Current.Response.Clear(); HttpContext.Current.Response.BinaryWrite(GCheckout.Util.EncodeHelper.Serialize(response)); HttpContext.Current.Response.StatusCode = 200;

    Read the article

  • Why does one column seem to load first in Wordpress?

    - by Cynthia
    I have a Wordpress site that is doing something very bizarre. If you go to: http://digitaldemo.net/joy/krippen-a-b-c/ When it loads, the main content div loads on the right hand side of the page and then once the sidebar loads, THEN it gets pushed over to where it ought to be. It's only really noticable in Firefox, but I'd like to find out what is causing it and fix the issue. Any ideas? Many thanks!

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • Java writes bad wave files

    - by Cliff
    I'm writing out wave files in Java using AudioInputStream output = new AudioInputStream(new ByteArrayInputStream(rawPCMSamples), new AudioFormat(22000,16,1,true,false), rawPCMSamples.length) AudioSystem.write(output, AudioFileFormat.Type.WAVE, new FileOutputStream('somefile.wav')) And I get what appears to be corrupt wave files on OSX. They won't play from Finder however using the same code behind a servlet writing directly to the response stream and setting the Content-Type to audio/wave seems to play fine in quicktime. What gives?

    Read the article

  • How to centre list-items in a column

    - by unknowndomain
    Hey all, I am trying to centre page numbers at the bottom of this test blog... http://jocelynwarner.com/test/ in the centre between the previous and next buttons however I cannot think how to do it, I tried a few different tutorials but they didn't really seem to help with this. Any hints on how to make them sit centrally in the left column (the width of the blog content - sidebar) would be greatly appreciated.

    Read the article

  • Include code file into C#? Create library for others?

    - by Tomas
    Hi, I would like to know how can I embedd a code source file (if possible), something like that: class X { include "ClassXsource" } My second question - Can I build DLL or something like that for my colleagues to use? I need them to be able to call methods from my "part" but do not modify or view their content. Basically just use namespace "MyNamespace" and call its methods, but I have never done anything like that. Thanks

    Read the article

  • Free ASP.Net (MVC/WebForms) based CMS which has plugins built in for connecting to Orkut and Faceboo

    - by SharePoint Newbie
    I looking for free ASP.NET based content management system (CMS) which has the following features: Blogs (Admin, some super users can have their own blogs) Forums (Admins can create forums. Some moderation features) Admin Dashboard Integration with LinkedIn, Orkut and Facebook (native or through freely available add-ons) Support for moderated user registration (moderated by Admin) Windows Sharepoint services 3.0 is an option. With some tweaking, it supports all the above and there are free third party web parts available. NB: The CMS listed must be free, as in beer.

    Read the article

  • Mod_rewrite on all website images

    - by Esteve Camps
    I'm designing an image repository. I want to uncouple the filename from the image html link. For instance: image in filesystem is called images/items/12543.jpg HTML is <img src="images/car.jpg" /> Does anyone strongly discourages me to rewrite all image requests using PHP so when retrieving images/car.jpg, Apache really replies content from images/items/12543.jpg? I don't know if I may get performance problems.

    Read the article

  • paperclip plugin not support for I18n

    - by user354413
    I've added I18n support for error messages: Now you can define translations for the errors messages in e.g. your YAML locale file: en: paperclip: errors: attachment: size: "Invalid file size" content_type: "Unsupported content type" presence: "Cant' be blank" when I use validates_attachemnt_zie :avatar how to get error message?

    Read the article

  • I can't access certain subkeys in an entry in the registry

    - by shifuimam
    I'm trying to get to HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\GameUX\, but the only subkey being returned in C# is MachineSettings - even though there are additional subkeys, including Games and several keys named for different user SIDs. How can I access these other keys? Even a standard user account can read the content of both Games and that account's own SID (when looking in regedit)...

    Read the article

  • How to copy files in Visual C++?

    - by karikari
    I am using Visual C++. How to copy the content of this file to another file? UINT32 writeToLog(wstring log) { wfstream file1 (LOG_FILE_NAME, ios_base::out); file1 << log; file1.close(); // want to copy file1 to file2 return 0; }

    Read the article

  • Android : Connecting to MySQL using PHP

    - by user1771128
    I followed the following article http://blog.sptechnolab.com/2011/02/10/android/android-connecting-to-mysql-using-php/ I am able to execute my php file. I executed it individually and its working fine. The problem is in the android execution part. Am posting the Log Cat for the error am facing. Tried putting in a List View with id "list" but the error stil 10-28 16:08:27.201: E/AndroidRuntime(664): **FATAL EXCEPTION: main** 10-28 16:08:27.201: E/AndroidRuntime(664): java.lang.RuntimeException: Unable to start activity ComponentInfo{com.example.city/com.example.city.City}: java.lang.RuntimeException: Your content must have a ListView whose id attribute is 'android.R.id.list' 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1956) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1981) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread.access$600(ActivityThread.java:123) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1147) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.os.Handler.dispatchMessage(Handler.java:99) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.os.Looper.loop(Looper.java:137) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread.main(ActivityThread.java:4424) 10-28 16:08:27.201: E/AndroidRuntime(664): at java.lang.reflect.Method.invokeNative(Native Method) 10-28 16:08:27.201: E/AndroidRuntime(664): at java.lang.reflect.Method.invoke(Method.java:511) 10-28 16:08:27.201: E/AndroidRuntime(664): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:784) 10-28 16:08:27.201: E/AndroidRuntime(664): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:551) 10-28 16:08:27.201: E/AndroidRuntime(664): at dalvik.system.NativeStart.main(Native Method) 10-28 16:08:27.201: E/AndroidRuntime(664): Caused by: java.lang.RuntimeException: Your content must have a ListView whose id attribute is 'android.R.id.list' 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ListActivity.onContentChanged(ListActivity.java:243) 10-28 16:08:27.201: E/AndroidRuntime(664): at com.android.internal.policy.impl.PhoneWindow.setContentView(PhoneWindow.java:254) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.Activity.setContentView(Activity.java:1835) 10-28 16:08:27.201: E/AndroidRuntime(664): at com.example.city.City.onCreate(City.java:35) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.Activity.performCreate(Activity.java:4465) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1049) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1920) 10-28 16:08:27.201: E/AndroidRuntime(664): ... 11 more

    Read the article

  • SWFUpload and long filenames.

    - by HKBemis
    Everything is working fine with SWFuploader, however when uploading files that have longer filenames the SWF applet expands to become wider then my content pane. Does anyone have a method or hack to trim the filename and alt text fields of SWFUpload?

    Read the article

  • Fancybox: Get id of clicked anchor/element

    - by kastru
    I am trying to get the id of the clicked/shown element in fancybox. I have tried both "this.id" and "this.attr("id")" - but none of them works. $("a.lightbox_image").fancybox({ 'transitionIn': 'elastic', 'transitionOut': 'elastic', 'speedIn': 600, 'speedOut': 200, 'content': 'Id of element clicked'+this.attr("id") }); Any suggestions?

    Read the article

  • Javascript sliding (preferably jQuery)

    - by jwzk
    I am trying to think of the name of the plugin (or a plugin) that slides content in (up or down). So I have a hidden div, I click on one of the titles/header, it opens the hidden div, if I click on another header it hides the other visible div, and slides up or down the new one. I can't think of it for some reason.. anyone?

    Read the article

  • Redirect to login page automatically after some time

    - by ASD
    How can we redirect to login page automatically after some time? I have a requirement to redirect to login page if the current page is idle for 10 minutes in Java/JSP. I tried to use <meta http-equiv="refresh" content="120;url=./login.html"> tag. This works only when I click on any link but not automatically after 2 mins(120secs). Can anyone tell me how to redirect to login page automatically?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 524 525 526 527 528 529 530 531 532 533 534 535  | Next Page >