Search Results

Search found 53261 results on 2131 pages for 'system state'.

Page 531/2131 | < Previous Page | 527 528 529 530 531 532 533 534 535 536 537 538  | Next Page >

  • Changing a limited user account in XP fails

    - by javamonkey79
    I have the following: using System; using System.DirectoryServices.AccountManagement; public class ChangePassword { public static void Main() { PrincipalContext context = new PrincipalContext(ContextType.Machine); UserPrincipal user = UserPrincipal.FindByIdentity(context, "someLimitedAccount"); user.ChangePassword( "xxx", "zzz" ); } } This works just fine with administrator accounts, but seems to crash like so when I try to change limited accounts in XP: Unhandled Exception: System.NullReferenceException: Object reference not set to an instance of an object. at ChangePassword.Main() Is what I am trying to do possible? If so, how? EDIT #1: I added the following: Console.WriteLine( "user: " + user ); Below this line: UserPrincipal user = UserPrincipal.FindByIdentity(context, "someLimitedAccount"); And I get this: user: It doesn't look like user is null when I print it, but then again I'm not really a .Net guy - I seem to remember this being expected behavior.

    Read the article

  • SecurityException from Activator.CreateInstance(), How to grant permissons to Assembly?

    - by user365164
    I have been loading an assembly via Assembly.LoadFrom(@"path"); and then doing Type t = asm.GetType("Test.Test"); test = Activator.CreateInstance(t, new Object[] { ... }); and it was working fine, but now I moved the dll I am getting the following System.Reflection.TargetInvocationException: Exception has been thrown by the target of an invocation. --- System.Security.SecurityException: Request for the permission of type 'System.Security.Permissons.SecurityPermission, etc .. For the sake of brevity it seems the demand was for an PermissionSet that allowed ControlAppDomain and it's not getting it. My question is how can I create this permissionset and pass it to the instance or assembly? I've been googling for hours to no avail.

    Read the article

  • Need advice on which PCI SATA Controller Card to Purchase

    - by Matt1776
    I have a major issue with the build of a machine I am trying to get up and running. My goal is to create a file server that will service the needs of my software development, personal media storage and streaming/media server needs, as well as provide a strong platform for backing up all this data in a routine, cron-job oriented German efficiency sort of way. The issue is a simple one - all my drives are SATA drives and my motherboard controller only contains 4 ports. Solving the issue has proven to be an unmitigated nightmare. I would like advice on the purchase of the following: 4 Port internal SATA / 2 Port external eSATA PCI SATA Controller Card that has the following features and/or advantages: It must function. If I plug it in and attach drives, I expect my system to still make it to the Operating System login screen. It must function on CentOS, and I mean it must function WELL and with MINIMAL hassle. If hassle is unavoidable, there shall be CLEAR CUT and EASY TO FOLLOW instructions on how to install drivers and other supporting software. I do not need nor want fakeRAID - I will be setting up any RAID configurations from within the operating system. Now, if I am able to find such a mythical device, I would be eternally grateful to whomever would be able to point me in the right direction, a direction which I assume will be paved with yellow bricks. I am prepared to pay a considerable sum of money (as SATA controller cards go) and so paying anywhere between 60 to 120 dollars will not be an issue whatsoever. Does such a magical device exist? The following link shows an "example" of the type of thing I am looking for, however, I have no way of verifying that once I plug this baby in that my system will still continue to function once I've attached the drives, or that once I've made it to the OS, I will be able to install whatever drivers or software programs I need to make it work with relative ease. It doesn't have to be dog-shit simple, but it cannot involve kernels or brain surgery. http://www.amazon.com/gp/product/B00552PLN4/ref=pd_lpo_k2_dp_sr_1?pf_rd_p=486539851&pf_rd_s=lpo-top-stripe-1&pf_rd_t=201&pf_rd_i=B003GSGMPU&pf_rd_m=ATVPDKIKX0DER&pf_rd_r=1HJG60XTZFJ48Z173HKY So does anyone have a suggestion regarding the subject I am asking about? PCI SATA Controller Cards? It would help if you've had experience with the component before - that is after all why I am asking here - for those who have had experience that I do not have. Bear in mind that this is for a home setup and that I do not have a company credit card. I have a budget with a 'relative' upper limit of about $150.00.

    Read the article

  • Comparing Nested object properties using C#

    - by Kumar
    I have a method which compares two objects and returns a list of all the property names which are different. public static IList<string> GetDifferingProperties(object source, object) { var sourceType = source.GetType(); var sourceProperties = sourceType.GetProperties(); var targetType = target.GetType(); var targetProperties = targetType.GetProperties(); var properties = (from s in sourceProperties from t in targetProperties where s.Name == t.Name && s.PropertyType == t.PropertyType && s.GetValue(source,null) != t.GetValue(target,null) select s.Name).ToList(); return properties; } For example if I have two classes as follows: public class Address { public string AddressLine1 { get; set; } public string AddressLine2 { get; set; } public string City { get; set; } public string State { get; set; } public string Zip { get; set; } } public class Employee { public string FirstName { get; set; } public string MiddleName { get; set; } public string LastName { get; set; } public Address EmployeeAddress { get; set; } } I am trying to compare the following two employee instances: var emp1Address = new Address(); emp1Address.AddressLine1 = "Microsoft Corporation"; emp1Address.AddressLine2 = "One Microsoft Way"; emp1Address.City = "Redmond"; emp1Address.State = "WA"; emp1Address.Zip = "98052-6399"; var emp1 = new Employee(); emp1.FirstName = "Bill"; emp1.LastName = "Gates"; emp1.EmployeeAddress = emp1Address; var emp2Address = new Address(); emp2Address.AddressLine1 = "Gates Foundation"; emp2Address.AddressLine2 = "One Microsoft Way"; emp2Address.City = "Redmond"; emp2Address.State = "WA"; emp2Address.Zip = "98052-6399"; var emp2 = new Employee(); emp2.FirstName = "Melinda"; emp2.LastName = "Gates"; emp2.EmployeeAddress = emp2Address; So when I pass these two employee objects to my GetDifferingProperties method currently it returns FirstName and EmployeeAddress, but it does not tell me which exact property (which in this case is Address1) in the EmployeeAddress has changed. How can I tweak this method to get something like EmployeeAddress.Address1?

    Read the article

  • SWT Filedialog Open into home folder

    - by Ivan
    I want to open a FileDialog window into the user home folder (i.e. /home/user or /Users/unsername) I read the user home folder, using System.getProperty: String homefolder = System.getProperty(user.home); And the variable containts the correct home folder. But when i set the filterpath in FileDialog, it opens (in linux) only the /home level not entering into the user home dir. This is the source code: FileDialog dialog = new FileDialog(shell); dialog.setText("Choose a certificate"); String platform = SWT.getPlatform(); String homefolder = System.getProperty("user.home"); dialog.setFilterPath(homefolder); Any idea? Here a screenshot:

    Read the article

  • Using java.util.logging, is it possible to restart logs after a certain period of time?

    - by Fry
    I have some java code that will be running as an importer for data for a much larger project. The initial logging code was done with the java.util.logging classes, so I'd like to keep it if possible, but it seems to be a little inadequate now given he amount of data passing through the importer. Often times in the system, the importer will get data that the main system doesn't have information for or doesn't match the system's data so it is ignored but a message is written to the log about what information was dropped and why it wasn't imported. The problem is that this tends to grow in size very quickly, so we'd like to be able to start a fresh log daily or weekly. Does anybody have an idea if this can be done in the logging classes or would I have to switch to log4j or custom? Thanks for any help!

    Read the article

  • Two versions of same asp.net app using same server as stateserver - bad?

    - by MGOwen
    We have 2 production web servers for our web app, load balanced to handle lots of traffic. We also have a similar setup for testing. Test pool: [TEST 1]---[TEST 2] Prod pool: [PROD 1]---[PROD 2] When comparing the Web.Config of the app versions (test vs live) I discovered something surprising: both pools have the same value for stateConnectionString. If I understand right, this means they are using the same state server: <sessionState mode="StateServer" stateConnectionString="tcpip=123.123.123.123:42424" cookieless="false" timeout="30"/> Is this a problem? (How does the state server not confuse the two pools)? I was having odd only-sometimes slowdown/errors on the test server, that's why I was looking at this in the first place, but the prod pool runs fine...

    Read the article

  • http://localhost/ always gives 502 unknown host

    - by Nitesh Panchal
    My service for World Wide Web Publishing Service started successfully but whenever I browse to http://localhost/ I always get 502 Unknown host. Also, wampapache is installed side by side but when I stop IIS service and start wampapache from services.msc I get error and when I view it in System event log I get this error: - <Event xmlns="http://schemas.microsoft.com/win/2004/08/events/event"> - <System> <Provider Name="Service Control Manager" Guid="{555908d1-a6d7-4695-8e1e-26931d2012f4}" EventSourceName="Service Control Manager" /> <EventID Qualifiers="49152">7024</EventID> <Version>0</Version> <Level>2</Level> <Task>0</Task> <Opcode>0</Opcode> <Keywords>0x8080000000000000</Keywords> <TimeCreated SystemTime="2011-06-12T17:43:28.223498400Z" /> <EventRecordID>346799</EventRecordID> <Correlation /> <Execution ProcessID="456" ThreadID="3936" /> <Channel>System</Channel> <Computer>MACHINENAME</Computer> <Security /> </System> - <EventData> <Data Name="param1">wampapache</Data> <Data Name="param2">%%1</Data> </EventData> </Event> I am fed up of this error and it is driving me nuts. I feel like banging my head against the laptop. I am really serious. Without concentrating on my real application I am trying to solve this issue since 3 hours. I google various threads and few of them said that there could be issue of Reporting Services or Skype. But I have uninstalled Skype and Reporting Services are disabled. What more should I do? I have hosts file present in etc directory and it does have mapping for localhost to 127.0.0.1. What more could I do?

    Read the article

  • Agile Approach for WCM

    - by cameron.f.logan
    Can anyone provide me with advice, opinions, or experience with using an agile methodology to delivery an enterprise-scale Web Content Management system (e.g., Interwoven TeamSite, Tridion)? My current opinion is that to implement a CM system there is a certain--relatively high--amount of upfront work that needs to happen to make sure the system is going to be scalable and efficient for future projects for the multi-year lifespan an WCM is expected to have. This suggests a hybrid approach at best, if not a more waterfall-like approach. I'm really interested to learn what approaches others have taken. Thanks.

    Read the article

  • Sending the files (At least 11 files) from folder through web service to android app.

    - by Shashank_Itmaster
    Hello All, I stuck in middle of this situation,Please help me out. My question is that I want to send files (Total 11 PDF Files) to android app using web service. I tried it with below code.Main Class from which web service is created public class MultipleFilesImpl implements MultipleFiles { public FileData[] sendPDFs() { FileData fileData = null; // List<FileData> filesDetails = new ArrayList<FileData>(); File fileFolder = new File( "C:/eclipse/workspace/AIPWebService/src/pdfs/"); // File fileTwo = new File( // "C:/eclipse/workspace/AIPWebService/src/simple.pdf"); File sendFiles[] = fileFolder.listFiles(); // sendFiles[0] = fileOne; // sendFiles[1] = fileTwo; DataHandler handler = null; char[] readLine = null; byte[] data = null; int offset = 0; int numRead = 0; InputStream stream = null; FileOutputStream outputStream = null; FileData[] filesData = null; try { System.out.println("Web Service Called Successfully"); for (int i = 0; i < sendFiles.length; i++) { handler = new DataHandler(new FileDataSource(sendFiles[i])); fileData = new FileData(); data = new byte[(int) sendFiles[i].length()]; stream = handler.getInputStream(); while (offset < data.length && (numRead = stream.read(data, offset, data.length - offset)) >= 0) { offset += numRead; } readLine = Base64Coder.encode(data); offset = 0; numRead = 0; System.out.println("'Reading File............................"); System.out.println("\n"); System.out.println(readLine); System.out.println("Data Reading Successful"); fileData.setFileName(sendFiles[i].getName()); fileData.setFileData(String.valueOf(readLine)); readLine = null; System.out.println("Data from bean " + fileData.getFileData()); outputStream = new FileOutputStream("D:/" + sendFiles[i].getName()); outputStream.write(Base64Coder.decode(fileData.getFileData())); outputStream.flush(); outputStream.close(); stream.close(); // FileData fileDetails = new FileData(); // fileDetails = fileData; // filesDetails.add(fileData); filesData = new FileData[(int) sendFiles[i].length()]; } // return fileData; } catch (FileNotFoundException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (Exception e) { e.printStackTrace(); } return filesData; } } Also The Interface MultipleFiles:- public interface MultipleFiles extends Remote { public FileData[] sendPDFs() throws FileNotFoundException, IOException, Exception; } Here I am sending an array of bean "File Data",having properties viz. FileData & FileName. FileData- contains file data in encoded. FileName- encoded file name. The Bean:- (FileData) public class FileData { private String fileName; private String fileData; public String getFileName() { return fileName; } public void setFileName(String fileName) { this.fileName = fileName; } public String getFileData() { return fileData; } public void setFileData(String string) { this.fileData = string; } } The android DDMS gives out of memory exception when tried below code & when i tried to send two files then only first file is created. public class PDFActivity extends Activity { private final String METHOD_NAME = "sendPDFs"; private final String NAMESPACE = "http://webservice.uks.com/"; private final String SOAP_ACTION = NAMESPACE + METHOD_NAME; private final String URL = "http://192.168.1.123:8080/AIPWebService/services/MultipleFilesImpl"; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); TextView textViewOne = (TextView) findViewById(R.id.textViewOne); try { SoapObject soapObject = new SoapObject(NAMESPACE, METHOD_NAME); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope( SoapEnvelope.VER11); envelope.setOutputSoapObject(soapObject); textViewOne.setText("Web Service Started"); AndroidHttpTransport httpTransport = new AndroidHttpTransport(URL); httpTransport.call(SOAP_ACTION, envelope); // SoapObject result = (SoapObject) envelope.getResponse(); Object result = envelope.getResponse(); Log.i("Result", result.toString()); // String fileName = result.getProperty("fileName").toString(); // String fileData = result.getProperty("fileData").toString(); // Log.i("File Name", fileName); // Log.i("File Data", fileData); // File pdfFile = new File(fileName); // FileOutputStream outputStream = // openFileOutput(pdfFile.toString(), // MODE_PRIVATE); // outputStream.write(Base64Coder.decode(fileData)); Log.i("File", "File Created"); // textViewTwo.setText(result); // Object result = envelope.getResponse(); // FileOutputStream outputStream = openFileOutput(name, mode) } catch (Exception e) { e.printStackTrace(); } } } Please help with some explanation or changes in my code. Thanks in Advance.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Lookahead regex produces unexpected group

    - by Ivan Yatskevich
    I'm trying to extract a page name and query string from a URL which should not contain .html Here is an example code in Java: public class TestRegex { public static void main(String[] args) { Pattern pattern = Pattern.compile("/test/(((?!\\.html).)+)\\?(.+)"); Matcher matcher = pattern.matcher("/test/page?param=value"); System.out.println(matcher.matches()); System.out.println(matcher.group(1)); System.out.println(matcher.group(2)); } } By running this code one can get the following output: true page e What's wrong with my regex so the second group contains the letter e instead of param=value?

    Read the article

  • "Initializing - Busy - Stopping" LOOP issue in Azure deployement

    - by Kushal Waikar
    Hi folks, I am trying to deploy an azure cloud application on Windows Azure. Application specifications are -- It has one WebRole - ASP.Net MVC Application (ASP.Net charting control is used in this MVC application) It does not contain any worker role. Third party references are set with property "copy Local" to "true"(MVC,ASP Charting control & ASP Provider DLLs) There is no DiagnosticsConnectionString in service configuration file It uses ASP provider for session state management. This application runs successfully on local dev fabric but when I try to deploy it on Windows Azure it gets stuck in a loop with status being changed between Initializing, Busy, Stopping states. It never goes into READY state. It seems that there are no ERROR logs for conveying the deployment issues to user. So is there any way to diagnose deployment issues ? Is there any way to get deployment ERROR logs ? Any kind of help will be appreciated. Thanks, Kushal

    Read the article

  • Linq to Entities - left Outer Join

    - by user255234
    Could you please help me to figure this one out? I need to replace a join with OSLP table with OUTER join. Seems a bit tricky for someone who is not an expert in Linq to entities. How would I do that? var surgeonList = ( from item in context.T1_STM_Surgeon .Include("T1_STM_SurgeonTitle") .Include("OTER") where item.ID == surgeonId join reptable in context.OSLP on item.Rep equals reptable.SlpCode select new { ID = item.ID, First = item.First, Last = item.Last, Rep = reptable.SlpName, Reg = item.OTER.descript, PrimClinic = item.T1_STM_ClinicalCenter.Name, Titles = item.T1_STM_SurgeonTitle, Phone = item.Phone, Email = item.Email, Address1 = item.Address1, Address2 = item.Address2, City = item.City, State = item.State, Zip = item.Zip, Comments = item.Comments, Active = item.Active, DateEntered = item.DateEntered }).ToList(); Thanks in advance!!

    Read the article

  • ASP.net error message when using REST starter kit

    - by jonhobbs
    Hi all, I've written some code using the REST starter kit and it works fine on my development machine. However, when I upload it to our server the page gives me the following error message... CS1684: Warning as Error: Reference to type 'System.Runtime.Serialization.Json.DataContractJsonSerializer' claims it is defined in 'c:\WINNT\assembly\GAC_MSIL\System.ServiceModel.Web\3.5.0.0__31bf3856ad364e35\System.ServiceModel.Web.dll', but it could not be found I've removed code line by line and it appears that the following line of code is triggering the error... HttpContent newOrganizationContent = HttpContentExtensions.CreateXmlSerializable(newOrganizationXml); Really haven't got a clue how to fix it. I assumed it might be because it needs a newer version of the framework to run, but looking in IIS it says it's running version 2.0.50727 which I think is the lates version because it says that even when we're using framework 3.5 Very confused, any ideas? Jon

    Read the article

  • PL/SQL Package invalidated

    - by FrustratedWithFormsDesigner
    I have a script that makes use of a package (PKG_MY_PACKAGE). I will change some of the fields in a query in that package and then recompile it (I don't change or compile any other packages). I run the script and I get an error that looks like ORA-04068: existing state of packages has been discarded ORA-04061: existing state of package body "USER3.PKG_MY_PACKAGE" has been invalidated ORA-04065: not executed, altered or dropped package body "USER3.PKG_MY_PACKAGE" ORA-06508: PL/SQL: could not find program unit being called: "USER3.PKG_MY_PACKAGE" ORA-06512: at line 34 I run the script again (without changing anything else in the system) and the script executes successfully. I thought that when I compiled before I executed the script that would fix any invalid references. This is 100% reproducible, and the more I test this script the more annoying it gets. What could cause this, and what would fix it? (oracle 10g, using PL/SQL Developer 7)

    Read the article

  • castle monorails httpHandlers

    - by bogdanbrudiu
    I have a question and I hope you can help me solve it... I have a castle monorails application. In web.config file in httphandlers I have *.aspx maped to monorails (my hosting does not suport other extensions...) <add verb="*" path="*.aspx" type="Castle.MonoRail.Framework.MonoRailHttpHandlerFactory,Castle.MonoRail.Framework"/> The problem is that I have some Webforms pages that I want to work with aspx... So I am adding something like this to the web.config file... <add verb="*" path="connector.aspx*" type="System.Web.UI.PageHandlerFactory"/> <add verb="*" path="ChatPage.aspx*" type="System.Web.UI.PageHandlerFactory"/> <add verb="*" path="Logon.aspx*" type="System.Web.UI.PageHandlerFactory"/> Still it does not work.. What am I doing wrong?

    Read the article

  • BlackBerry - Exception with null message when sending sms using Connector

    - by vikram deshpande
    I used code given but I am getting "IOCancelledException" and "IOException". And IOCancelledException.getMessage() / IOException.getMessage() giving null string, it does not give error message. Please help me understaing reason. class SMSThread extends Thread { Thread myThread; MessageConnection msgConn; String message; String mobilenumber; public SMSThread(String textMsg, String mobileNumber) { message = textMsg; mobilenumber = mobileNumber; } public void run() { try { msgConn = (MessageConnection) Connector.open("sms://+" + mobilenumber); TextMessage text = (TextMessage) msgConn .newMessage(MessageConnection.TEXT_MESSAGE); text.setPayloadText(message); msgConn.send(text); msgConn.close(); } catch (IOCancelledException ioce) { System.out .println("IOCancelledException: " + ioce.getMessage()); } catch (IOException ioe) { System.out.println("IOException: " + ioe.getMessage()); } catch (Exception e) { System.out.println("Exception: " + e); } } }

    Read the article

  • Bypassing "Found New Hardware Wizard" / Setting Windows to Install Drivers Automatically

    - by Synetech inc.
    Hi, My motherboard finally died after the better part of a decade, so I bought a used system. I put my old hard-drive and sound-card in the new system, and connected my old keyboard and mouse (the rest of the components—CPU, RAM, mobo, video card—are from the new system). I knew beforehand that it would be a challenge to get Windows to boot and install drivers for the new hardware (particularly since the foundational components are new), but I am completely unable to even attempt to get through the work of installing drivers for things like the video card because the keyboard and mouse won't work (they do work, in the BIOS screen, in DOS mode, in Windows 7, in XP's boot menu, etc., just not in Windows XP itself). Whenever I try to boot XP (in normal or safe mode), I get a bunch of balloons popping up for all the new hardware detected, and a New Hardware Found Wizard for Processor (obviously it has to install drivers for the lowest-level components on up). Unfortunately I cannot click Next since the keyboard and mouse won't work yet because the motherboard drivers (for the PS/2 or USB ports) are not yet installed. I even tried a serial mouse, but to no avail—again, it does work in DOS, 7, etc., but not XP because it doesn't have the serial port driver installed. I tried mounting the SOFTWARE and SYSTEM hives under Windows 7 in order to manually set the "unsigned drivers warning" to ignore (using both of the driver-signing policy settings that I found references to). That didn't work; I still get the wizard. They are not even fancy, proprietary, third-party, or unsigned drivers. They are drivers that come with Windows—as the drivers for CPU, RAM, IDE controller, etc. tend to be. And the keyboard and mouse drivers are the generic ones at that (but like I said, those are irrelevant since the drivers for the ports that they are connected to are not yet installed). Obviously at some point in time over the past several years, a setting got changed to make Windows always prompt me when it detects new hardware. (It was also configured to show the Shutdown Event Tracker on abnormal shutdowns, so I had to turn that off so that I could even see the desktop.) Oh, and I tried deleting all of the PNF files so that they get regenerated, but that too did not help. Does anyone know how I can reset Windows to at least try to automatically install drivers for new hardware before prompting me if it fails? Conversely, does anyone know how exactly one turns off automatic driver installation (and prompt with the wizard)? Thanks a lot.

    Read the article

  • Open source configuration framework for ASP.NET - does one exist?

    - by Jon
    We currently have an old product written in classic asp and are about to re-write parts in ASP.NET. One big problem is that much of the cutomer-specifics within the system are hard coded. We want to split this out for specific customers by storing data in the database. Is there a quick an easy open source framework which allows me to set up some quick tables and simple UIs to allow me to change configuration items? We have 6-7 modules, and it would be nice to have the ability to have system admins gain access to a configuration area where they can set-up settings in a tabbed UI format, settings could also be set-up to allow dropdown, fields, numbers etc. The items could then be accessed via classes in C#/vb for use within the operational parts of the system. If not, I'm suprised and it might even be a good basis for a new open source project.

    Read the article

  • MVC3 Razor DropDownListFor Enums

    - by jordan.baucke
    Trying to get my project updated to MVC3, something I just can't find: I have a simple datatype of ENUMS: public enum States() { AL,AK,AZ,...WY } Which I want to use as a DropDown/SelectList in my view of a model that contains this datatype: public class FormModel() { public States State {get; set;} } Pretty straight forward: when I go to use the auto-generate view for this partial class, it ignores this type. I need a simple select list that sets the value of the enum as the selected item when I hit submit and process via my AJAX - JSON POST Method. And than the view (???!): <div class="editor-field"> @Html.DropDownListFor(model => model.State, model => model.States) </div> thanks in advance for the advice!

    Read the article

  • problem in saving drag&drop object in database

    - by Mac Taylor
    hey guys i made a script inspired by wordpress widgets'page to drag&drop blocks of my sites but problem is in saving the position after droping this is jquery code , i used to do the above target : <script type="text/javascript" >$(function(){ $('.widget') .each(function(){ $(this).hover(function(){ $(this).find('h4').addClass('collapse'); }, function(){ $(this).find('h4').removeClass('collapse'); }) .find('h4').hover(function(){ $(this).find('.in-widget-title').css('visibility', 'visible'); }, function(){ $(this).find('.in-widget-title').css('visibility', 'hidden'); }) .click(function(){ $(this).siblings('.widget-inside').toggle(); //Save state on change of collapse state of panel updateWidgetData(); }) .end() .find('.in-widget-title').css('visibility', 'hidden'); }); $('.column').sortable({ connectWith: '.column', handle: 'h4', cursor: 'move', placeholder: 'placeholder', forcePlaceholderSize: true, opacity: 0.4, start: function(event, ui){ //Firefox, Safari/Chrome fire click event after drag is complete, fix for that if($.browser.mozilla || $.browser.safari) $(ui.item).find('.widget-inside').toggle(); }, stop: function(event, ui){ ui.item.css({'top':'0','left':'0'}); //Opera fix if(!$.browser.mozilla && !$.browser.safari) updateWidgetData(); } }) .disableSelection(); }); function updateWidgetData(){ var items=[]; $('.column').each(function(){ var columnId=$(this).attr('id'); $('.widget', this).each(function(i){ var collapsed=0; if($(this).find('.widget-inside').css('display')=="none") collapsed=1; //Create Item object for current panel var item={ id: $(this).attr('id'), collapsed: collapsed, order : i, column: columnId }; //Push item object into items array items.push(item); }); }); //Assign items array to sortorder JSON variable var sortorder={ items: items }; //Pass sortorder variable to server using ajax to save state $.post('updatePanels.php', 'data='+$.toJSON(sortorder), function(response){ if(response=="success") $("#console").html('<div class="success">Saved</div>').hide().fadeIn(1000); setTimeout(function(){ $('#console').fadeOut(1000); }, 2000); }); } </script> and a simple php file but problem is its not sending data to target php file is there anything wrong with my code ?

    Read the article

  • How to Programmatically Identify a PI Font (a Dingbat) under OS X

    - by Glenn Howes
    There is a class of fonts called Pi fonts whose glyphs, under OS X, get mapped to the private Unicode space 0xF021-0xF0FF such that if you subtract 0xF000 from each unicode character to retrieve the 8-bit version of the character and be able to draw that character as if it were a standard Roman character. My question is how do I recognize these fonts? It's obvious the system can do so because there is a category on the Special Characters palette called "Pi Fonts" which apparently has the various such fonts installed on my system. In my case they are BookshelSymbolSeven, MSReferenceSpeciality, MT-Extras, Marlett, MonotypeSorts, Webdings, and various Wingdings. If I use the old fashioned QuickDraw routines to ask for the TextEncoding of these fonts, I get a value of 0x20000 which I do not see in the system header file TextCommon.h. Am I supposed to treat any font with a TextEncoding of 0x20000 as a Pi Font? And I'd rather not use any QuickDraw font handling routines for obvious reasons.

    Read the article

< Previous Page | 527 528 529 530 531 532 533 534 535 536 537 538  | Next Page >