Search Results

Search found 53261 results on 2131 pages for 'system state'.

Page 531/2131 | < Previous Page | 527 528 529 530 531 532 533 534 535 536 537 538  | Next Page >

  • Bypassing "Found New Hardware Wizard" / Setting Windows to Install Drivers Automatically

    - by Synetech inc.
    Hi, My motherboard finally died after the better part of a decade, so I bought a used system. I put my old hard-drive and sound-card in the new system, and connected my old keyboard and mouse (the rest of the components—CPU, RAM, mobo, video card—are from the new system). I knew beforehand that it would be a challenge to get Windows to boot and install drivers for the new hardware (particularly since the foundational components are new), but I am completely unable to even attempt to get through the work of installing drivers for things like the video card because the keyboard and mouse won't work (they do work, in the BIOS screen, in DOS mode, in Windows 7, in XP's boot menu, etc., just not in Windows XP itself). Whenever I try to boot XP (in normal or safe mode), I get a bunch of balloons popping up for all the new hardware detected, and a New Hardware Found Wizard for Processor (obviously it has to install drivers for the lowest-level components on up). Unfortunately I cannot click Next since the keyboard and mouse won't work yet because the motherboard drivers (for the PS/2 or USB ports) are not yet installed. I even tried a serial mouse, but to no avail—again, it does work in DOS, 7, etc., but not XP because it doesn't have the serial port driver installed. I tried mounting the SOFTWARE and SYSTEM hives under Windows 7 in order to manually set the "unsigned drivers warning" to ignore (using both of the driver-signing policy settings that I found references to). That didn't work; I still get the wizard. They are not even fancy, proprietary, third-party, or unsigned drivers. They are drivers that come with Windows—as the drivers for CPU, RAM, IDE controller, etc. tend to be. And the keyboard and mouse drivers are the generic ones at that (but like I said, those are irrelevant since the drivers for the ports that they are connected to are not yet installed). Obviously at some point in time over the past several years, a setting got changed to make Windows always prompt me when it detects new hardware. (It was also configured to show the Shutdown Event Tracker on abnormal shutdowns, so I had to turn that off so that I could even see the desktop.) Oh, and I tried deleting all of the PNF files so that they get regenerated, but that too did not help. Does anyone know how I can reset Windows to at least try to automatically install drivers for new hardware before prompting me if it fails? Conversely, does anyone know how exactly one turns off automatic driver installation (and prompt with the wizard)? Thanks a lot.

    Read the article

  • Need advice on which PCI SATA Controller Card to Purchase

    - by Matt1776
    I have a major issue with the build of a machine I am trying to get up and running. My goal is to create a file server that will service the needs of my software development, personal media storage and streaming/media server needs, as well as provide a strong platform for backing up all this data in a routine, cron-job oriented German efficiency sort of way. The issue is a simple one - all my drives are SATA drives and my motherboard controller only contains 4 ports. Solving the issue has proven to be an unmitigated nightmare. I would like advice on the purchase of the following: 4 Port internal SATA / 2 Port external eSATA PCI SATA Controller Card that has the following features and/or advantages: It must function. If I plug it in and attach drives, I expect my system to still make it to the Operating System login screen. It must function on CentOS, and I mean it must function WELL and with MINIMAL hassle. If hassle is unavoidable, there shall be CLEAR CUT and EASY TO FOLLOW instructions on how to install drivers and other supporting software. I do not need nor want fakeRAID - I will be setting up any RAID configurations from within the operating system. Now, if I am able to find such a mythical device, I would be eternally grateful to whomever would be able to point me in the right direction, a direction which I assume will be paved with yellow bricks. I am prepared to pay a considerable sum of money (as SATA controller cards go) and so paying anywhere between 60 to 120 dollars will not be an issue whatsoever. Does such a magical device exist? The following link shows an "example" of the type of thing I am looking for, however, I have no way of verifying that once I plug this baby in that my system will still continue to function once I've attached the drives, or that once I've made it to the OS, I will be able to install whatever drivers or software programs I need to make it work with relative ease. It doesn't have to be dog-shit simple, but it cannot involve kernels or brain surgery. http://www.amazon.com/gp/product/B00552PLN4/ref=pd_lpo_k2_dp_sr_1?pf_rd_p=486539851&pf_rd_s=lpo-top-stripe-1&pf_rd_t=201&pf_rd_i=B003GSGMPU&pf_rd_m=ATVPDKIKX0DER&pf_rd_r=1HJG60XTZFJ48Z173HKY So does anyone have a suggestion regarding the subject I am asking about? PCI SATA Controller Cards? It would help if you've had experience with the component before - that is after all why I am asking here - for those who have had experience that I do not have. Bear in mind that this is for a home setup and that I do not have a company credit card. I have a budget with a 'relative' upper limit of about $150.00.

    Read the article

  • Send file by webservice

    - by phenevo
    Hi, I have webservice, wwith method: [WebMethod] public byte[] GetFile(string FName) { System.IO.FileStream fs1 = null; fs1 = System.IO.File.Open(FName, FileMode.Open, FileAccess.Read); byte[] b1 = new byte[fs1.Length]; fs1.Read(b1, 0, (int)fs1.Length); fs1.Close(); return b1; } and it works with small file like 1mb, but when it comes to photoshop's file (about 1,5gb) I get: System.OutOfMemoryException The idea is I have winforms application which get this file and saving it on local disc.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Hang while starting several daemons

    - by Adrian Lang
    I’m running a Debian Squeeze AMD64 server. Target runlevel after boot is runlevel 2, which includes rsyslogd, cron, sshd and some other stuff, but not dovecot, postfix, apache2, etc. The system fails to reach runlevel 2 with several symptoms: The system hangs at trying to start rsyslogd Booting into runlevel 1 works, then login from the console works Starting rsyslogd from runlevel 1 via /etc/init.d/rsyslog hangs Starting runlevel 2 with rsyslogd disabled works But then, logging in via console fails: I get the motd, and then nothing Starting sshd from runlevel 1 succeeds But then, I cannot login via ssh. Sometimes password ssh login gives me the motd and then nothing, sometimes not even this. Trying to offer a public key seems to annoy the sshd enough to not talk to me any further. When rebooting from runlevel 1, the server hangs at trying to stop apache2 (which is not running, so this really should be trivial). Trying to stop apache2 when logged in in runleve 1 does hang as well. And that’s just the stuff which fails all the time. RAM has been tested, dmesg shows no problems. I have no clue. Update: (shortened) output from rsyslogd -c4 -d called in runlevel 1 rsyslogd 4.6.4 startup, compatibility mode 4, module path '' caller requested object 'net', not found (iRet -3003) Requested to load module 'lmnet' loading module '/user/lib/rsyslog/lmnet.so' module of type 2 being loaded conf.c requested ref for 'lmnet', refcount 1 rsylog runtime initialized, version 4.6.4, current users 1 syslogd.c requested ref for 'lmnet', refcount now 2 I can kill rsyslogd with Strg+C, then. /var/log shows none of the configured log files, though. Update2: Thanks to @DerfK I still have no clue, but at least I narrowed down the problem. I’m now testing with /etc/init.d/apache2 stop (without an apache2 running, of course) which hangs as well and looks like an even more obvious failure. After some testing I found out that a file with one single line: /usr/sbin/apache2ctl configtest /dev/null 2&1 hangs, while the same line executed in an interactive shell works. I was not able to further reduce this line while, i. e. every single part, the stream redirections and the commando itself is necessary to reproduce the hang. @DerfK also pointed me to strace which gave a shallow hint about what kind of hang we have here: wait4(-1for the init scripts futex(0xsomepointer, FUTEX_WAIT_PRIVATE, 2, NULL for rsyslogd / apache2 binaries called by the init scripts The system was installed as a Debian Lenny by my hoster in autumn 2011, I upgraded it to Squeeze immediately and kept it up to date with Squeeze, which then used to be testing. There were no big changes, though. I guess I never tried to reboot the system before.

    Read the article

  • Comparing Nested object properties using C#

    - by Kumar
    I have a method which compares two objects and returns a list of all the property names which are different. public static IList<string> GetDifferingProperties(object source, object) { var sourceType = source.GetType(); var sourceProperties = sourceType.GetProperties(); var targetType = target.GetType(); var targetProperties = targetType.GetProperties(); var properties = (from s in sourceProperties from t in targetProperties where s.Name == t.Name && s.PropertyType == t.PropertyType && s.GetValue(source,null) != t.GetValue(target,null) select s.Name).ToList(); return properties; } For example if I have two classes as follows: public class Address { public string AddressLine1 { get; set; } public string AddressLine2 { get; set; } public string City { get; set; } public string State { get; set; } public string Zip { get; set; } } public class Employee { public string FirstName { get; set; } public string MiddleName { get; set; } public string LastName { get; set; } public Address EmployeeAddress { get; set; } } I am trying to compare the following two employee instances: var emp1Address = new Address(); emp1Address.AddressLine1 = "Microsoft Corporation"; emp1Address.AddressLine2 = "One Microsoft Way"; emp1Address.City = "Redmond"; emp1Address.State = "WA"; emp1Address.Zip = "98052-6399"; var emp1 = new Employee(); emp1.FirstName = "Bill"; emp1.LastName = "Gates"; emp1.EmployeeAddress = emp1Address; var emp2Address = new Address(); emp2Address.AddressLine1 = "Gates Foundation"; emp2Address.AddressLine2 = "One Microsoft Way"; emp2Address.City = "Redmond"; emp2Address.State = "WA"; emp2Address.Zip = "98052-6399"; var emp2 = new Employee(); emp2.FirstName = "Melinda"; emp2.LastName = "Gates"; emp2.EmployeeAddress = emp2Address; So when I pass these two employee objects to my GetDifferingProperties method currently it returns FirstName and EmployeeAddress, but it does not tell me which exact property (which in this case is Address1) in the EmployeeAddress has changed. How can I tweak this method to get something like EmployeeAddress.Address1?

    Read the article

  • Invalid Parametes value

    - by Sheery
    Hi Guys, I have an application build in C#, for saving sms, MMS and contacts from the mobile attached via data cable. i am able to save sms and contacts but it gives an error of invalid parameters, my code for saving is if (iRet == PCCSErrors.CONA_OK) { dataVersit = (CAContentAccess.CADataDefinitions.CA_DATA_VERSIT)Marshal.PtrToStructure(bufData, typeof(CAContentAccess.CADataDefinitions.CA_DATA_VERSIT)); byte[] bVersitObject = new byte[dataVersit.iDataLength]; Marshal.Copy(dataVersit.pbVersitObject, bVersitObject, 0, dataVersit.iDataLength); System.IO.Stream ios = System.IO.File.Open(fileDlg.FileName, System.IO.FileMode.Create); ios.Write(bVersitObject, bVersitObject.GetLowerBound(0), dataVersit.iDataLength); ios.Flush(); ios.Close(); } else { PCCAPIUtils.ShowErrorMessage("CAReadItem", iRet); }

    Read the article

  • Routing and Remote Access Service won't start after full disk

    - by NKCSS
    The HDD of the server was out of disk space, and after a reboot, RRAS won't start anymore on my 2008 R2 server. Error Details: Log Name: System Source: RemoteAccess Date: 2/5/2012 9:39:52 PM Event ID: 20153 Task Category: None Level: Error Keywords: Classic User: N/A Computer: Windows14111.<snip> Description: The currently configured accounting provider failed to load and initialize successfully. The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error. Event Xml: <Event xmlns="http://schemas.microsoft.com/win/2004/08/events/event"> <System> <Provider Name="RemoteAccess" /> <EventID Qualifiers="0">20153</EventID> <Level>2</Level> <Task>0</Task> <Keywords>0x80000000000000</Keywords> <TimeCreated SystemTime="2012-02-05T20:39:52.000Z" /> <EventRecordID>12148869</EventRecordID> <Channel>System</Channel> <Computer>Windows14111.<snip></Computer> <Security /> </System> <EventData> <Data>The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error.</Data> <Binary>2C030000</Binary> </EventData> </Event> I think it has something to do with a corrupt config file, but I am unsure of what to do. I Removed the RRAS role, rebooted, and re-added, but it keeps failing with the same error. Thanks in advance. [UPDATE] If i set the accounting provider from 'Windows' to '' the service starts but VPN won't work. Any ideas how this can be repaired?

    Read the article

  • MVC3 Razor DropDownListFor Enums

    - by jordan.baucke
    Trying to get my project updated to MVC3, something I just can't find: I have a simple datatype of ENUMS: public enum States() { AL,AK,AZ,...WY } Which I want to use as a DropDown/SelectList in my view of a model that contains this datatype: public class FormModel() { public States State {get; set;} } Pretty straight forward: when I go to use the auto-generate view for this partial class, it ignores this type. I need a simple select list that sets the value of the enum as the selected item when I hit submit and process via my AJAX - JSON POST Method. And than the view (???!): <div class="editor-field"> @Html.DropDownListFor(model => model.State, model => model.States) </div> thanks in advance for the advice!

    Read the article

  • Linq to Entities - left Outer Join

    - by user255234
    Could you please help me to figure this one out? I need to replace a join with OSLP table with OUTER join. Seems a bit tricky for someone who is not an expert in Linq to entities. How would I do that? var surgeonList = ( from item in context.T1_STM_Surgeon .Include("T1_STM_SurgeonTitle") .Include("OTER") where item.ID == surgeonId join reptable in context.OSLP on item.Rep equals reptable.SlpCode select new { ID = item.ID, First = item.First, Last = item.Last, Rep = reptable.SlpName, Reg = item.OTER.descript, PrimClinic = item.T1_STM_ClinicalCenter.Name, Titles = item.T1_STM_SurgeonTitle, Phone = item.Phone, Email = item.Email, Address1 = item.Address1, Address2 = item.Address2, City = item.City, State = item.State, Zip = item.Zip, Comments = item.Comments, Active = item.Active, DateEntered = item.DateEntered }).ToList(); Thanks in advance!!

    Read the article

  • BlackBerry - Exception with null message when sending sms using Connector

    - by vikram deshpande
    I used code given but I am getting "IOCancelledException" and "IOException". And IOCancelledException.getMessage() / IOException.getMessage() giving null string, it does not give error message. Please help me understaing reason. class SMSThread extends Thread { Thread myThread; MessageConnection msgConn; String message; String mobilenumber; public SMSThread(String textMsg, String mobileNumber) { message = textMsg; mobilenumber = mobileNumber; } public void run() { try { msgConn = (MessageConnection) Connector.open("sms://+" + mobilenumber); TextMessage text = (TextMessage) msgConn .newMessage(MessageConnection.TEXT_MESSAGE); text.setPayloadText(message); msgConn.send(text); msgConn.close(); } catch (IOCancelledException ioce) { System.out .println("IOCancelledException: " + ioce.getMessage()); } catch (IOException ioe) { System.out.println("IOException: " + ioe.getMessage()); } catch (Exception e) { System.out.println("Exception: " + e); } } }

    Read the article

  • How to grant su access to wheel without asking for password on FreeBSD?

    - by cstamas
    I would like to grant users of the wheel group (other sysadmins) su access without being asked for password. I know how to do it with pam in linux, but the question now is for FreeBSD. I am not familiar with the syntax for FreeBSD's PAM subsystem. What shall I enter in /etc/pam.d/su instead of the default: auth sufficient pam_rootok.so no_warn auth sufficient pam_self.so no_warn auth requisite pam_group.so no_warn group=wheel root_only fail_safe ruser auth include system # account account include system # session session required pam_permit.so

    Read the article

  • Using java.util.logging, is it possible to restart logs after a certain period of time?

    - by Fry
    I have some java code that will be running as an importer for data for a much larger project. The initial logging code was done with the java.util.logging classes, so I'd like to keep it if possible, but it seems to be a little inadequate now given he amount of data passing through the importer. Often times in the system, the importer will get data that the main system doesn't have information for or doesn't match the system's data so it is ignored but a message is written to the log about what information was dropped and why it wasn't imported. The problem is that this tends to grow in size very quickly, so we'd like to be able to start a fresh log daily or weekly. Does anybody have an idea if this can be done in the logging classes or would I have to switch to log4j or custom? Thanks for any help!

    Read the article

  • How to Programmatically Identify a PI Font (a Dingbat) under OS X

    - by Glenn Howes
    There is a class of fonts called Pi fonts whose glyphs, under OS X, get mapped to the private Unicode space 0xF021-0xF0FF such that if you subtract 0xF000 from each unicode character to retrieve the 8-bit version of the character and be able to draw that character as if it were a standard Roman character. My question is how do I recognize these fonts? It's obvious the system can do so because there is a category on the Special Characters palette called "Pi Fonts" which apparently has the various such fonts installed on my system. In my case they are BookshelSymbolSeven, MSReferenceSpeciality, MT-Extras, Marlett, MonotypeSorts, Webdings, and various Wingdings. If I use the old fashioned QuickDraw routines to ask for the TextEncoding of these fonts, I get a value of 0x20000 which I do not see in the system header file TextCommon.h. Am I supposed to treat any font with a TextEncoding of 0x20000 as a Pi Font? And I'd rather not use any QuickDraw font handling routines for obvious reasons.

    Read the article

  • SQL Server 2008 - Error starting service - model.mdf not found?!

    - by alex
    my SQL server 2008 was running fine. About an hour ago, it suddenly stopped - the MSSQLSERVER service had stopped I right clicked, clicked start, and it said the service had started, and stopped I looked in the event log and saw these two errors: 17207 : udopen: Operating system error 3(error not found) during the creation/opening of physical device C:\Program Files\Microsoft SQL Server\MSSQL\data\model.mdf. 17204 : FCB::Open failed: Could not open device C:\Program Files\Microsoft SQL Server\MSSQL\data\model.mdf for virtual device number (VDN) 1. The model.mdf db has NEVER been in that location - i specified drive F: to use for data / log during install. I checked the SQL Configuration Manager, to try and set startup params, but SQL Server is not listed as one of the services..... EDIT: I've now moved the db to where it was looking for: C:\Program Files\Microsoft SQL Server\MSSQL\data\ directory. Now if I start the service, it still does not work - i get this error message in the log: Could not find row in sysindexes for database ID 3, object ID 1, index ID 1. Run DBCC CHECKTABLE on sysindexes. Interestingly, i checked the error log - around the time users reported problems, there is this: 2010-01-08 17:11:26.44 spid51 Configuration option 'show advanced options' changed from 0 to 1. Run the RECONFIGURE statement to install. 2010-01-08 17:11:26.44 spid51 FILESTREAM: effective level = 0, configured level = 0, file system access share name = 'MSSQLSERVER'. 2010-01-08 17:11:26.44 spid51 Configuration option 'Agent XPs' changed from 1 to 0. Run the RECONFIGURE statement to install. 2010-01-08 17:11:26.44 spid51 FILESTREAM: effective level = 0, configured level = 0, file system access share name = 'MSSQLSERVER'. 2010-01-08 17:11:26.44 spid51 Configuration option 'show advanced options' changed from 1 to 0. Run the RECONFIGURE statement to install. 2010-01-08 17:11:26.44 spid51 FILESTREAM: effective level = 0, configured level = 0, file system access share name = 'MSSQLSERVER'. 2010-01-08 17:11:44.89 spid10s Service Broker manager has shut down. 2010-01-08 17:11:47.83 spid7s SQL Server is terminating in response to a 'stop' request from Service Control Manager. This is an informational message only. No user action is required. 2010-01-08 17:11:47.83 spid7s SQL Trace was stopped due to server shutdown. Trace ID = '1'. This is an informational message only; no user action is required.

    Read the article

  • Android bluetooth socket error

    - by ashwini
    I am using backport bluetooth api on android 1.6. I am using Google Bluetooth Chat sample app for testing. The app works fine in normal scenarios. In a scenario, when I try to connect to paired device which is in off state, I get following error. 01-04 09:00:11.629: ERROR/BluetoothEventLoop.cpp(84): onGetRemoteServiceChannelResult: D-Bus error: org.bluez.Error.ConnectionAttemptFailed (Host is down) 01-04 09:00:11.729: DEBUG/dalvikvm(128): GC freed 4535 objects / 256008 bytes in 296ms 01-04 09:00:21.880: ERROR/bluetooth_RfcommSocket.cpp(1433): connect error: Host is down (112) But it sets the state as connected. The app is unable to catch the exception. Why does it happen? Or is it the case with backport api? Any help is appreciated as I am struggling a lot to get things run fine.

    Read the article

  • SecurityException from Activator.CreateInstance(), How to grant permissons to Assembly?

    - by user365164
    I have been loading an assembly via Assembly.LoadFrom(@"path"); and then doing Type t = asm.GetType("Test.Test"); test = Activator.CreateInstance(t, new Object[] { ... }); and it was working fine, but now I moved the dll I am getting the following System.Reflection.TargetInvocationException: Exception has been thrown by the target of an invocation. --- System.Security.SecurityException: Request for the permission of type 'System.Security.Permissons.SecurityPermission, etc .. For the sake of brevity it seems the demand was for an PermissionSet that allowed ControlAppDomain and it's not getting it. My question is how can I create this permissionset and pass it to the instance or assembly? I've been googling for hours to no avail.

    Read the article

  • Sending the files (At least 11 files) from folder through web service to android app.

    - by Shashank_Itmaster
    Hello All, I stuck in middle of this situation,Please help me out. My question is that I want to send files (Total 11 PDF Files) to android app using web service. I tried it with below code.Main Class from which web service is created public class MultipleFilesImpl implements MultipleFiles { public FileData[] sendPDFs() { FileData fileData = null; // List<FileData> filesDetails = new ArrayList<FileData>(); File fileFolder = new File( "C:/eclipse/workspace/AIPWebService/src/pdfs/"); // File fileTwo = new File( // "C:/eclipse/workspace/AIPWebService/src/simple.pdf"); File sendFiles[] = fileFolder.listFiles(); // sendFiles[0] = fileOne; // sendFiles[1] = fileTwo; DataHandler handler = null; char[] readLine = null; byte[] data = null; int offset = 0; int numRead = 0; InputStream stream = null; FileOutputStream outputStream = null; FileData[] filesData = null; try { System.out.println("Web Service Called Successfully"); for (int i = 0; i < sendFiles.length; i++) { handler = new DataHandler(new FileDataSource(sendFiles[i])); fileData = new FileData(); data = new byte[(int) sendFiles[i].length()]; stream = handler.getInputStream(); while (offset < data.length && (numRead = stream.read(data, offset, data.length - offset)) >= 0) { offset += numRead; } readLine = Base64Coder.encode(data); offset = 0; numRead = 0; System.out.println("'Reading File............................"); System.out.println("\n"); System.out.println(readLine); System.out.println("Data Reading Successful"); fileData.setFileName(sendFiles[i].getName()); fileData.setFileData(String.valueOf(readLine)); readLine = null; System.out.println("Data from bean " + fileData.getFileData()); outputStream = new FileOutputStream("D:/" + sendFiles[i].getName()); outputStream.write(Base64Coder.decode(fileData.getFileData())); outputStream.flush(); outputStream.close(); stream.close(); // FileData fileDetails = new FileData(); // fileDetails = fileData; // filesDetails.add(fileData); filesData = new FileData[(int) sendFiles[i].length()]; } // return fileData; } catch (FileNotFoundException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (Exception e) { e.printStackTrace(); } return filesData; } } Also The Interface MultipleFiles:- public interface MultipleFiles extends Remote { public FileData[] sendPDFs() throws FileNotFoundException, IOException, Exception; } Here I am sending an array of bean "File Data",having properties viz. FileData & FileName. FileData- contains file data in encoded. FileName- encoded file name. The Bean:- (FileData) public class FileData { private String fileName; private String fileData; public String getFileName() { return fileName; } public void setFileName(String fileName) { this.fileName = fileName; } public String getFileData() { return fileData; } public void setFileData(String string) { this.fileData = string; } } The android DDMS gives out of memory exception when tried below code & when i tried to send two files then only first file is created. public class PDFActivity extends Activity { private final String METHOD_NAME = "sendPDFs"; private final String NAMESPACE = "http://webservice.uks.com/"; private final String SOAP_ACTION = NAMESPACE + METHOD_NAME; private final String URL = "http://192.168.1.123:8080/AIPWebService/services/MultipleFilesImpl"; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); TextView textViewOne = (TextView) findViewById(R.id.textViewOne); try { SoapObject soapObject = new SoapObject(NAMESPACE, METHOD_NAME); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope( SoapEnvelope.VER11); envelope.setOutputSoapObject(soapObject); textViewOne.setText("Web Service Started"); AndroidHttpTransport httpTransport = new AndroidHttpTransport(URL); httpTransport.call(SOAP_ACTION, envelope); // SoapObject result = (SoapObject) envelope.getResponse(); Object result = envelope.getResponse(); Log.i("Result", result.toString()); // String fileName = result.getProperty("fileName").toString(); // String fileData = result.getProperty("fileData").toString(); // Log.i("File Name", fileName); // Log.i("File Data", fileData); // File pdfFile = new File(fileName); // FileOutputStream outputStream = // openFileOutput(pdfFile.toString(), // MODE_PRIVATE); // outputStream.write(Base64Coder.decode(fileData)); Log.i("File", "File Created"); // textViewTwo.setText(result); // Object result = envelope.getResponse(); // FileOutputStream outputStream = openFileOutput(name, mode) } catch (Exception e) { e.printStackTrace(); } } } Please help with some explanation or changes in my code. Thanks in Advance.

    Read the article

  • Extracting init script from bult-in intrfs into Linux bzImage

    - by Maciej Piechotka
    I have following problem - I damaged my system (Gentoo - by rebuilding using gcc 4.5) beyond repair. I unmounted /home, copied /etc + other important files and I've started reinstalling system. However I forgot to copy init script. It is still present in kernel image that I have. How to extract it? Please note that initrd is not a separate file but is in the kernel image.

    Read the article

  • EBS with RAID0 (striping) and restoring snapshots

    - by grourk
    We have a MySQL database on EC2 and are looking at the disk IO performance there. Currently we have a single EBS volume with XFS and take snapshots for backup. It seems that a lot of people have seen significant performance gains by striping across multiple EBS volumes with software RAID. If this is done, how does one take snapshots and ensure the consistency of the file system? It seems to me that restoring the file system from multiple snapshots could be tricky.

    Read the article

  • PL/SQL Package invalidated

    - by FrustratedWithFormsDesigner
    I have a script that makes use of a package (PKG_MY_PACKAGE). I will change some of the fields in a query in that package and then recompile it (I don't change or compile any other packages). I run the script and I get an error that looks like ORA-04068: existing state of packages has been discarded ORA-04061: existing state of package body "USER3.PKG_MY_PACKAGE" has been invalidated ORA-04065: not executed, altered or dropped package body "USER3.PKG_MY_PACKAGE" ORA-06508: PL/SQL: could not find program unit being called: "USER3.PKG_MY_PACKAGE" ORA-06512: at line 34 I run the script again (without changing anything else in the system) and the script executes successfully. I thought that when I compiled before I executed the script that would fix any invalid references. This is 100% reproducible, and the more I test this script the more annoying it gets. What could cause this, and what would fix it? (oracle 10g, using PL/SQL Developer 7)

    Read the article

  • How do people handle working with Code Names for their projects?

    - by Mark
    Hi All, Recently we started using some code names for several different types of prototype applications all following a theme. This made things a little more fun and was a great idea. The problem is that Im not too sure how people deal with migrating a codebase from "codename" state into version 1.0 state which may have a proper name... not something that a client really shouldnt see :) We are using Visual Studio at the moment, and I can see that you can change the assembly name, but there are references to the namespaces, etc... that would really be a large change to make. Do people both changing things like namespaces before the v1.0 release?

    Read the article

  • Changing a limited user account in XP fails

    - by javamonkey79
    I have the following: using System; using System.DirectoryServices.AccountManagement; public class ChangePassword { public static void Main() { PrincipalContext context = new PrincipalContext(ContextType.Machine); UserPrincipal user = UserPrincipal.FindByIdentity(context, "someLimitedAccount"); user.ChangePassword( "xxx", "zzz" ); } } This works just fine with administrator accounts, but seems to crash like so when I try to change limited accounts in XP: Unhandled Exception: System.NullReferenceException: Object reference not set to an instance of an object. at ChangePassword.Main() Is what I am trying to do possible? If so, how? EDIT #1: I added the following: Console.WriteLine( "user: " + user ); Below this line: UserPrincipal user = UserPrincipal.FindByIdentity(context, "someLimitedAccount"); And I get this: user: It doesn't look like user is null when I print it, but then again I'm not really a .Net guy - I seem to remember this being expected behavior.

    Read the article

  • How to implement an EventHandler to update controls

    - by Bill
    May I ask for help with the following? I am attempting to connect and control three pieces of household electronic equipment by computer through a GlobalCache GC-100 and iTach. As you will see in the following code, I created a class-instance of GlobalCacheAdapter that communicates with each piece of equipment. Although the code seems to work well in controlling the equipment, I am having trouble updating controls with the feedback from the equipment. The procedure "ReaderThreadProc" captures the feedback; however I don't know how to update the associated TextBox with the feedback. I believe that I need to create an EventHandler to notify the TextBox of the available update; however I am uncertain as to how an EventHandler like this would be implemented. Any help wold be greatly appreciated. using System; using System.IO; using System.Net; using System.Net.Sockets; using System.Threading; using System.Windows.Forms; namespace WindowsFormsApplication1 { public partial class Form1 : Form { // Create three new instances of GlobalCacheAdaptor and connect. // GC-100 (Elan) 192.168.1.70 4998 // GC-100 (TuneSuite) 192.168.1.70 5000 // GC iTach (Lighting) 192.168.1.71 4999 private GlobalCacheAdaptor elanGlobalCacheAdaptor; private GlobalCacheAdaptor tuneSuiteGlobalCacheAdaptor; private GlobalCacheAdaptor lutronGlobalCacheAdaptor; public Form1() { InitializeComponent(); elanGlobalCacheAdaptor = new GlobalCacheAdaptor(); elanGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.70"), 4998); tuneSuiteGlobalCacheAdaptor = new GlobalCacheAdaptor(); tuneSuiteGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.70"), 5000); lutronGlobalCacheAdaptor = new GlobalCacheAdaptor(); lutronGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.71"), 4999); elanTextBox.Text = elanGlobalCacheAdaptor._line; tuneSuiteTextBox.Text = tuneSuiteGlobalCacheAdaptor._line; lutronTextBox.Text = lutronGlobalCacheAdaptor._line; } private void btnZoneOnOff_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,4,1,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,800" + Environment.NewLine); } private void btnSourceInput1_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,1,1,20,179,20,179,20,179,20,179,20,179,20,179,20,179,20,278,20,179,20,179,20,179,20,780" + Environment.NewLine); } private void btnSystemOff_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,1,1,20,184,20,184,20,184,20,184,20,184,20,286,20,286,20,286,20,184,20,184,20,184,20,820" + Environment.NewLine); } private void btnLightOff_Click(object sender, EventArgs e) { lutronGlobalCacheAdaptor.SendMessage("sdl,14,0,0,S2\x0d"); } private void btnLightOn_Click(object sender, EventArgs e) { lutronGlobalCacheAdaptor.SendMessage("sdl,14,100,0,S2\x0d"); } private void btnChannel31_Click(object sender, EventArgs e) { tuneSuiteGlobalCacheAdaptor.SendMessage("\xB8\x4D\xB5\x33\x31\x00\x30\x21\xB8\x0D"); } private void btnChannel30_Click(object sender, EventArgs e) { tuneSuiteGlobalCacheAdaptor.SendMessage("\xB8\x4D\xB5\x33\x30\x00\x30\x21\xB8\x0D"); } } } public class GlobalCacheAdaptor { public Socket _multicastListener; public string _preferredDeviceID; public IPAddress _deviceAddress; public Socket _deviceSocket; public StreamWriter _deviceWriter; public bool _isConnected; public int _port; public IPAddress _address; public string _line; public GlobalCacheAdaptor() { } public static readonly GlobalCacheAdaptor Instance = new GlobalCacheAdaptor(); public bool IsListening { get { return _multicastListener != null; } } public GlobalCacheAdaptor ConnectToDevice(IPAddress address, int port) { if (_deviceSocket != null) _deviceSocket.Close(); try { _port = port; _address = address; _deviceSocket = new Socket(AddressFamily.InterNetwork, SocketType.Stream, ProtocolType.Tcp); _deviceSocket.Connect(new IPEndPoint(address, port)); ; _deviceAddress = address; var stream = new NetworkStream(_deviceSocket); var reader = new StreamReader(stream); var writer = new StreamWriter(stream) { NewLine = "\r", AutoFlush = true }; _deviceWriter = writer; writer.WriteLine("getdevices"); var readerThread = new Thread(ReaderThreadProc) { IsBackground = true }; readerThread.Start(reader); _isConnected = true; return Instance; } catch { DisconnectFromDevice(); MessageBox.Show("ConnectToDevice Error."); throw; } } public void SendMessage(string message) { try { var stream = new NetworkStream(_deviceSocket); var reader = new StreamReader(stream); var writer = new StreamWriter(stream) { NewLine = "\r", AutoFlush = true }; _deviceWriter = writer; writer.WriteLine(message); var readerThread = new Thread(ReaderThreadProc) { IsBackground = true }; readerThread.Start(reader); } catch { MessageBox.Show("SendMessage() Error."); } } public void DisconnectFromDevice() { if (_deviceSocket != null) { try { _deviceSocket.Close(); _isConnected = false; } catch { MessageBox.Show("DisconnectFromDevice Error."); } _deviceSocket = null; } _deviceWriter = null; _deviceAddress = null; } private void ReaderThreadProc(object state) { var reader = (StreamReader)state; try { while (true) { var line = reader.ReadLine(); if (line == null) break; _line = _line + line + Environment.NewLine; } // Need to create EventHandler to notify the TextBoxes to update with _line } catch { MessageBox.Show("ReaderThreadProc Error."); } } }

    Read the article

< Previous Page | 527 528 529 530 531 532 533 534 535 536 537 538  | Next Page >