Search Results

Search found 18319 results on 733 pages for 'array push'.

Page 565/733 | < Previous Page | 561 562 563 564 565 566 567 568 569 570 571 572  | Next Page >

• Building resultset using collection object

  - by Bhaskara Krishna Mohan Potam

  Hi, I had an issue in building the resultset using java. Here it goes... I am storing a collection object which is organized as row wise taken from a resultset object and putting the collection object(which is stored as vector/array list) in cache and trying to retrieve the same collection object. Here i need to build back the resultset again using the collection object. Now my doubt is building the resultset in this way possible or not? Please let me know asap. Thanks in advance, Bhaskar

  Read the article

• Best way to parse command line arguments in C#

  - by Paul Stovell

  When building console applications that take parameters, you can use the arguments passed to Main(string[] args). In the past I've simply indexed/looped that array and done a few regular expressions to extract the values. However, when the commands get more complicated, the parsing can get pretty ugly. More recently, I built the world's simplest Backus-Naur Form parser in C# to parse the arguments. It does the job, but it also feels like overkill. So I'm interested in: Libraries that you use Patterns that you use Assume the commands always adhere to common standards such as answered here.

  Read the article

• Equality Comparison with Multiple Instances/IEqualityComparer problems in LINQ

  - by Stacey

  This is similar to my last question; but from a different angle. http://stackoverflow.com/questions/2792393/see-if-item-exists-once-in-enumerable-linq Given the following set of items, and lists containing them... Item 1 Item 2 Item 3 Item 4 Item 5 class Item { string Name { get; set; } } List<Item> available = new List<Item>() { Item 1 Item 1 Item 2 Item 3 Item 5 } List<Item> selected = new List<Item>() { Item 1 Item 2 Item 3 } I need to make a third List that has everything from "available", except what is in "selected". However 'Item 1' is in 'available' twice, but only in 'selected' once. Since they are instances of the same item, I am having trouble figuring out the appropriate logic to accomodate this. The final array should look like... List<Item> selectable = new List<Item>() { Item 1 Item5 }

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• rails update whole index of a model with one click

  - by mattherick

  hello! i have a store model, this will handle my leaflet and my shoppingcart for my shop. now i d´like to show all items added from an user to his leaflet in the index of store. in the store an user can change the quantity of the choosen items. and now i want to save that the changes of the different quantities in the database with one click on a button "update store". so how could i implement an update over the whole index with one click? i´d like to do this with ajax and most dynamically. somebody has an idea? i render all items into a form so far, but now i have the problem, when i submit this form only the last quantity and item id are included in the params. further i pushed every quantity into an array and i want to submit this also as a param. but i could not. please give me some tips, will be very fine :) mattherick

  Read the article

• High Availability for IaaS, PaaS and SaaS in the Cloud

  - by BuckWoody

  Outages, natural disasters and unforeseen events have proved that even in a distributed architecture, you need to plan for High Availability (HA). In this entry I'll explain a few considerations for HA within Infrastructure-as-a-Service (IaaS), Platform-as-a-Service (PaaS) and Software-as-a-Service (SaaS). In a separate post I'll talk more about Disaster Recovery (DR), since each paradigm has a different way to handle that. Planning for HA in IaaS IaaS involves Virtual Machines - so in effect, an HA strategy here takes on many of the same characteristics as it would on-premises. The primary difference is that the vendor controls the hardware, so you need to verify what they do for things like local redundancy and so on from the hardware perspective. As far as what you can control and plan for, the primary factors fall into three areas: multiple instances, geographical dispersion and task-switching. In almost every cloud vendor I've studied, to ensure your application will be protected by any level of HA, you need to have at least two of the Instances (VM's) running. This makes sense, but you might assume that the vendor just takes care of that for you - they don't. If a single VM goes down (for whatever reason) then the access to it is lost. Depending on multiple factors, you might be able to recover the data, but you should assume that you can't. You should keep a sync to another location (perhaps the vendor's storage system in another geographic datacenter or to a local location) to ensure you can continue to serve your clients. You'll also need to host the same VM's in another geographical location. Everything from a vendor outage to a network path problem could prevent your users from reaching the system, so you need to have multiple locations to handle this. This means that you'll have to figure out how to manage state between the geo's. If the system goes down in the middle of a transaction, you need to figure out what part of the process the system was in, and then re-create or transfer that state to the second set of systems. If you didn't write the software yourself, this is non-trivial. You'll also need a manual or automatic process to detect the failure and re-route the traffic to your secondary location. You could flip a DNS entry (if your application can tolerate that) or invoke another process to alias the first system to the second, such as load-balancing and so on. There are many options, but all of them involve coding the state into the application layer. If you've simply moved a state-ful application to VM's, you may not be able to easily implement an HA solution. Planning for HA in PaaS Implementing HA in PaaS is a bit simpler, since it's built on the concept of stateless applications deployment. Once again, you need at least two copies of each element in the solution (web roles, worker roles, etc.) to remain available in a single datacenter. Also, you need to deploy the application again in a separate geo, but the advantage here is that you could work out a "shared storage" model such that state is auto-balanced across the world. In fact, you don't have to maintain a "DR" site, the alternate location can be live and serving clients, and only take on extra load if the other site is not available. In Windows Azure, you can use the Traffic Manager service top route the requests as a type of auto balancer. Even with these benefits, I recommend a second backup of storage in another geographic location. Storage is inexpensive; and that second copy can be used for not only HA but DR. Planning for HA in SaaS In Software-as-a-Service (such as Office 365, or Hadoop in Windows Azure) You have far less control over the HA solution, although you still maintain the responsibility to ensure you have it. Since each SaaS is different, check with the vendor on the solution for HA - and make sure you understand what they do and what you are responsible for. They may have no HA for that solution, or pin it to a particular geo, or perhaps they have a massive HA built in with automatic load balancing (which is often the case).   All of these options (with the exception of SaaS) involve higher costs for the design. Do not sacrifice reliability for cost - that will always cost you more in the end. Build in the redundancy and HA at the very outset of the project - if you try to tack it on later in the process the business will push back and potentially not implement HA. References: http://www.bing.com/search?q=windows+azure+High+Availability  (each type of implementation is different, so I'm routing you to a search on the topic - look for the "Patterns and Practices" results for the area in Azure you're interested in)

  Read the article

• Can't get my head around background workers in .NET

  - by Connel

  I have wrote an application that syncs two folders together. The problem with the program is that it stops responding whilst copying files. A quick search of stack-overflow told me I need to use something called a background worker. I have read a few pages on the net about this but find it really hard to understand as I'm pretty new to programming. Below is the code for my application - how can I simply put all of the File.Copy(....) commands into their own background worker (if that's even how it works)? Below is the code for the button click event that runs the sub procedure and the sub procedure I wish to use a background worker on all the File.Copy lines. Button event: protected virtual void OnBtnSyncClicked (object sender, System.EventArgs e) { //sets running boolean to true booRunning=true; //sets progress bar to 0 prgProgressBar.Fraction = 0; //resets values used by progressbar dblCurrentStatus = 0; dblFolderSize = 0; //tests if user has entered the same folder for both target and destination if (fchDestination.CurrentFolder == fchTarget.CurrentFolder) { //creates message box MessageDialog msdSame = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync two folders that are the same"); //sets message box title msdSame.Title="Error"; //sets respone type ResponseType response = (ResponseType) msdSame.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdSame.Destroy(); } return; } //tests if user has entered a target folder that is an extension of the destination folder // or if user has entered a desatination folder that is an extension of the target folder if (fchTarget.CurrentFolder.StartsWith(fchDestination.CurrentFolder) || fchDestination.CurrentFolder.StartsWith(fchTarget.CurrentFolder)) { //creates message box MessageDialog msdContains = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync a folder with one of its parent folders"); //sets message box title msdContains.Title="Error"; //sets respone type and runs message box ResponseType response = (ResponseType) msdContains.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdContains.Destroy(); } return; } //gets folder size of target folder FileSizeOfTarget(fchTarget.CurrentFolder); //gets folder size of destination folder FileSizeOfDestination(fchDestination.CurrentFolder); //runs SyncTarget procedure SyncTarget(fchTarget.CurrentFolder); //runs SyncDestination procedure SyncDestination(fchDestination.CurrentFolder); //informs user process is complete prgProgressBar.Text = "Finished"; //sets running bool to false booRunning = false; } Sync sub-procedure: protected void SyncTarget (string strCurrentDirectory) { //string array of all the directories in directory string[] staAllDirectories = Directory.GetDirectories(strCurrentDirectory); //string array of all the files in directory string[] staAllFiles = Directory.GetFiles(strCurrentDirectory); //loop over each file in directory foreach (string strFile in staAllFiles) { //string of just the file's name and not its path string strFileName = System.IO.Path.GetFileName(strFile); //string containing directory in target folder string strDirectoryInsideTarget = System.IO.Path.GetDirectoryName(strFile).Substring(fchTarget.CurrentFolder.Length); //inform user as to what file is being copied prgProgressBar.Text="Syncing " + strFile; //tests if file does not exist in destination folder if (!File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //if file does not exist copy it to destination folder, the true below means overwrite if file already exists File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } //tests if file does exist in destination folder if (File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //long (number) that contains date of last write time of target file long lngTargetFileDate = File.GetLastWriteTime(strFile).ToFileTime(); //long (number) that contains date of last write time of destination file long lngDestinationFileDate = File.GetLastWriteTime(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName).ToFileTime(); //tests if target file is newer than destination file if (lngTargetFileDate > lngDestinationFileDate) { //if it is newer then copy file from target folder to destination folder File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } } //gets current file size FileInfo FileSize = new FileInfo(strFile); //sets file's filesize to dblCurrentStatus and adds it to current total of files dblCurrentStatus = dblCurrentStatus + FileSize.Length; double dblPercentage = dblCurrentStatus/dblFolderSize; prgProgressBar.Fraction = dblPercentage; } //loop over each folder in target folder foreach (string strDirectory in staAllDirectories) { //string containing directories inside target folder but not any higher directories string strDirectoryInsideTarget = strDirectory.Substring(fchTarget.CurrentFolder.Length); //tests if directory does not exist inside destination folder if (!Directory.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget)) { //it directory does not exisit create it Directory.CreateDirectory(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget); } //run sync on all files in directory SyncTarget(strDirectory); } } Any help will be greatly appreciated as after this the program will pretty much be finished :D

  Read the article

• Routing configuration in cakephp

  - by ShiVik

  Hello all I am trying to implement routing in cakephp. I want the urls to mapped like this... www.example.com/nodes/main - www.example.com/main www.example.com/nodes/about - www.example.com/about So for this I wrote in my config/routes.php file.. Router::connect('/:action', array('controller' => 'nodes')); Now, I got the thing going but when I click on the links, the url in browser appears like www.example.com/nodes/main www.example.com/nodes/about Is there some way where I can get the urls to appear the way they are routed? Setting in .htaccess or httpd.conf would be easy - but I don't have access to that. Regards Vikram

  Read the article

• Sending POST variables through a PHP proxy for AJAX?

  - by b. e. hollenbeck

  I've decided that using a PHP proxy for AJAX calls for a project is the best way to go - but I have a question regarding passing POST data through the proxy. As in - how to do it. Should I need to create a single variable in the javascript using alternate characters, then have the PHP proxy parse and modify the variable to reassemble a valid HTTP request? Or is there some means of passing along the $_POST array in new request to the external server by pulling the data out of the headers and re-sending it?

  Read the article

• Kohana input & validation libraries - overlap?

  - by keithjgrant

  I'm familiarizing myself with Kohana. I've been reading up on the Input library, which automatically pre-filters GET and POST data for me, and the Validation libary, which helps with form validation. Should I use both together? The examples given in the Validation library documentation use the unfiltered $_POST array instead of $this->input->post(). Seems to me it would be more secure to chain the two, but the two sets of documentation seem to make no mention of each other, so I don't know if this would be redundant or not.

  Read the article

• Seven Random Thoughts on JavaOne

  - by HecklerMark

  As most people reading this blog may know, last week was JavaOne. There are a lot of summary/recap articles popping up now, and while I didn't want to just "add to pile", I did want to share a few observations. Disclaimer: I am an Oracle employee, but most of these observations are either externally verifiable or based upon a collection of opinions from Oracle and non-Oracle attendees alike. Anyway, here are a few take-aways: The Java ecosystem is alive and well, with a breadth and depth that is impossible to adequately describe in a short post...or a long post, for that matter. If there is any one area within the Java language or JVM that you would like to - or need to - know more about, it's well-represented at J1. While there are several IDEs that are used to great effect by the developer community, NetBeans is on a roll. I lost count how many sessions mentioned or used NetBeans, but it was by far the dominant IDE in use at J1. As a recent re-convert to NetBeans, I wasn't surprised others liked it so well, only how many. OpenJDK, OpenJFX, etc. Many developers were understandably concerned with the change of sponsorship/leadership when Java creator and longtime steward Sun Microsystems was acquired by Oracle. The read I got from attendees regarding Oracle's stewardship was almost universally positive, and the push for "openness" is deep and wide within the current Java environs. Few would probably have imagined it to be this good, this soon. Someone observed that "Larry (Ellison) is competitive, and he wants to be the best...so if he wants to have a community, it will be the best community on the planet." Like any company, Oracle is bound to make missteps, but leadership seems to be striking an excellent balance between embracing open efforts and innovating in competitive paid offerings. JavaFX (2.x) isn't perfect or comprehensive, but a great many people (myself included) see great potential, are developing for it, and are really excited about where it is and where it may be headed. This is another part of the Java ecosystem that has impressive depth for being so new (JavaFX 1.x aside). If you haven't kicked the tires yet, give it a try! You'll be surprised at how capable and versatile it is, and you'll probably catch yourself smiling while coding again.  :-) JavaEE is everywhere. Not exactly a newsflash, but there is a lot of buzz around EE still/again/anew. Sessions ranged from updated component specs/technologies to Websockets/HTML5, from frameworks to profiles and application servers. Programming "server-side" Java isn't confined to the server (as you no doubt realize), and if you still consider JavaEE a cumbersome beast, you clearly haven't been using the last couple of versions. Download GlassFish or the WebLogic Zip distro (or another JavaEE 6 implementation) and treat yourself. JavaOne is not inexpensive, but to paraphrase an old saying, "If you think that's expensive, you should try ignorance." :-) I suppose it's possible to attend J1 and learn nothing, but you'd have to really work at it! Attending even a single session is bound to expand your horizons and make you approach your code, your problem domain, differently...even if it's a session about something you already know quite well. The various presenters offer vastly different perspectives and challenge you to re-think your own approach(es). And finally, if you think the scheduled sessions are great - and make no mistake, most are clearly outstanding - wait until you see what you pick up from what I like to call the "hallway sessions". Between the presentations, people freely mingle in the hallways, go to lunch and dinner together, and talk. And talk. And talk. Ideas flow freely, sparking other ideas and the "crowdsourcing" of knowledge in a way that is hard to imagine outside of a conference of this magnitude. Consider this the "GO" part of a "BOGO" (Buy One, Get One) offer: you buy the ticket to the "structured" part of JavaOne and get the hallway sessions at no additional charge. They're really that good. If you weren't able to make it to JavaOne this year, you can still watch/listen to the sessions online by visiting the JavaOne course catalog and clicking the media link(s) in the right column - another demonstration of Oracle's commitment to the Java community. But make plans to be there next year to get the full benefit! You'll be glad you did. All the best,Mark P.S. - I didn't mention several other exciting developments in areas like the embedded space and the "internet of things" (M2M), robotics, optimization, and the cloud (among others), but I think you get the idea. JavaOne == brainExpansion;  Hope to see you there next year!

  Read the article

• When is my View too smart?

  - by Kyle Burns

  In this posting, I will discuss the motivation behind keeping View code as thin as possible when using patterns such as MVC, MVVM, and MVP.  Once the motivation is identified, I will examine some ways to determine whether a View contains logic that belongs in another part of the application.  While the concepts that I will discuss are applicable to most any pattern which favors a thin View, any concrete examples that I present will center on ASP.NET MVC. Design patterns that include a Model, a View, and other components such as a Controller, ViewModel, or Presenter are not new to application development.  These patterns have, in fact, been around since the early days of building applications with graphical interfaces.  The reason that these patterns emerged is simple – the code running closest to the user tends to be littered with logic and library calls that center around implementation details of showing and manipulating user interface widgets and when this type of code is interspersed with application domain logic it becomes difficult to understand and much more difficult to adequately test.  By removing domain logic from the View, we ensure that the View has a single responsibility of drawing the screen which, in turn, makes our application easier to understand and maintain. I was recently asked to take a look at an ASP.NET MVC View because the developer reviewing it thought that it possibly had too much going on in the view.  I looked at the .CSHTML file and the first thing that occurred to me was that it began with 40 lines of code declaring member variables and performing the necessary calculations to populate these variables, which were later either output directly to the page or used to control some conditional rendering action (such as adding a class name to an HTML element or not rendering another element at all).  This exhibited both of what I consider the primary heuristics (or code smells) indicating that the View is too smart: Member variables – in general, variables in View code are an indication that the Model to which the View is being bound is not sufficient for the needs of the View and that the View has had to augment that Model.  Notable exceptions to this guideline include variables used to hold information specifically related to rendering (such as a dynamically determined CSS class name or the depth within a recursive structure for indentation purposes) and variables which are used to facilitate looping through collections while binding. Arithmetic – as with member variables, the presence of arithmetic operators within View code are an indication that the Model servicing the View is insufficient for its needs.  For example, if the Model represents a line item in a sales order, it might seem perfectly natural to “normalize” the Model by storing the quantity and unit price in the Model and multiply these within the View to show the line total.  While this does seem natural, it introduces a business rule to the View code and makes it impossible to test that the rounding of the result meets the requirement of the business without executing the View.  Within View code, arithmetic should only be used for activities such as incrementing loop counters and calculating element widths. In addition to the two characteristics of a “Smart View” that I’ve discussed already, this View also exhibited another heuristic that commonly indicates to me the need to refactor a View and make it a bit less smart.  That characteristic is the existence of Boolean logic that either does not work directly with properties of the Model or works with too many properties of the Model.  Consider the following code and consider how logic that does not work directly with properties of the Model is just another form of the “member variable” heuristic covered earlier: @if(DateTime.Now.Hour < 12) {     <div>Good Morning!</div> } else {     <div>Greetings</div> } This code performs business logic to determine whether it is morning.  A possible refactoring would be to add an IsMorning property to the Model, but in this particular case there is enough similarity between the branches that the entire branching structure could be collapsed by adding a Greeting property to the Model and using it similarly to the following: <div>@Model.Greeting</div> Now let’s look at some complex logic around multiple Model properties: @if (ModelPageNumber + Model.NumbersToDisplay == Model.PageCount         || (Model.PageCount != Model.CurrentPage             && !Model.DisplayValues.Contains(Model.PageCount))) {     <div>There's more to see!</div> } In this scenario, not only is the View code difficult to read (you shouldn’t have to play “human compiler” to determine the purpose of the code), but it also complex enough to be at risk for logical errors that cannot be detected without executing the View.  Conditional logic that requires more than a single logical operator should be looked at more closely to determine whether the condition should be evaluated elsewhere and exposed as a single property of the Model.  Moving the logic above outside of the View and exposing a new Model property would simplify the View code to: @if(Model.HasMoreToSee) {     <div>There’s more to see!</div> } In this posting I have briefly discussed some of the more prominent heuristics that indicate a need to push code from the View into other pieces of the application.  You should now be able to recognize these symptoms when building or maintaining Views (or the Models that support them) in your applications.

  Read the article

• Interpretation of Greek characters by FOP

  - by Geek

  Hi, Can you please help me interpret the Greek Characters with HTML display as HTML= & #8062; and Hex value 01F7E Details of these characters can be found on the below URL http://www.isthisthingon.org/unicode/index.php?page=01&subpage=F&hilite=01F7E When I run this character in Apache FOP, they give me an ArrayIndexOut of Bounds Exception Caused by: java.lang.ArrayIndexOutOfBoundsException: -1 at org.apache.fop.text.linebreak.LineBreakUtils.getLineBreakPairProperty(LineBreakUtils.java:668) at org.apache.fop.text.linebreak.LineBreakStatus.nextChar(LineBreakStatus.java:117) When I looked into the FOP Code, I was unable to understand the need for lineBreakProperties[][] Array in LineBreakUtils.java. I also noticed that FOP fails for all the Greek characters mentioned on the above page which are non-displayable with the similar error. What are these special characters ? Why is their no display for these characters are these Line Breaks or TAB’s ? Has anyone solved a similar issue with FOP ?

  Read the article

• Help needed with Javascript Variable Scope / OOP and Call Back Functions

  - by gargantaun

  I think this issue goes beyond typical variable scope and closure stuff, or maybe I'm an idiot. Here goes anyway... I'm creating a bunch of objects on the fly in a jQuery plugin. The object look something like this function WedgePath(canvas){ this.targetCanvas = canvas; this.label; this.logLabel = function(){ console.log(this.label) } } the jQuery plugin looks something like this (function($) { $.fn.myPlugin = function() { return $(this).each(function() { // Create Wedge Objects for(var i = 1; i <= 30; i++){ var newWedge = new WedgePath(canvas); newWedge.label = "my_wedge_"+i; globalFunction(i, newWedge]); } }); } })(jQuery); So... the plugin creates a bunch of wedgeObjects, then calls 'globalFunction' for each one, passing in the latest WedgePath instance. Global function looks like this. function globalFunction(indicator_id, pWedge){ var targetWedge = pWedge; targetWedge.logLabel(); } What happens next is that the console logs each wedges label correctly. However, I need a bit more complexity inside globalFunction. So it actually looks like this... function globalFunction(indicator_id, pWedge){ var targetWedge = pWedge; someSql = "SELECT * FROM myTable WHERE id = ?"; dbInterface.executeSql(someSql, [indicator_id], function(transaction, result){ targetWedge.logLabel(); }) } There's a lot going on here so i'll explain. I'm using client side database storage (WebSQL i call it). 'dbInterface' an instance of a simple javascript object I created which handles the basics of interacting with a client side database [shown at the end of this question]. the executeSql method takes up to 4 arguments The SQL String an optional arguments array an optional onSuccess handler an optional onError handler (not used in this example) What I need to happen is: When the WebSQL query has completed, it takes some of that data and manipulates some attribute of a particular wedge. But, when I call 'logLabel' on an instance of WedgePath inside the onSuccess handler, I get the label of the very last instance of WedgePath that was created way back in the plugin code. Now I suspect that the problem lies in the var newWedge = new WedgePath(canvas); line. So I tried pushing each newWedge into an array, which I thought would prevent that line from replacing or overwriting the WedgePath instance at every iteration... wedgeArray = []; // Inside the plugin... for(var i = 1; i <= 30; i++){ var newWedge = new WedgePath(canvas); newWedge.label = "my_wedge_"+i; wedgeArray.push(newWedge); } for(var i = 0; i < wedgeArray.length; i++){ wedgeArray[i].logLabel() } But again, I get the last instance of WedgePath to be created. This is driving me nuts. I apologise for the length of the question but I wanted to be as clear as possible. END ============================================================== Also, here's the code for dbInterface object should it be relevant. function DatabaseInterface(db){ var DB = db; this.sql = function(sql, arr, pSuccessHandler, pErrorHandler){ successHandler = (pSuccessHandler) ? pSuccessHandler : this.defaultSuccessHandler; errorHandler = (pErrorHandler) ? pErrorHandler : this.defaultErrorHandler; DB.transaction(function(tx){ if(!arr || arr.length == 0){ tx.executeSql(sql, [], successHandler, errorHandler); }else{ tx.executeSql(sql,arr, successHandler, errorHandler) } }); } // ---------------------------------------------------------------- // A Default Error Handler // ---------------------------------------------------------------- this.defaultErrorHandler = function(transaction, error){ // error.message is a human-readable string. // error.code is a numeric error code console.log('WebSQL Error: '+error.message+' (Code '+error.code+')'); // Handle errors here var we_think_this_error_is_fatal = true; if (we_think_this_error_is_fatal) return true; return false; } // ---------------------------------------------------------------- // A Default Success Handler // This doesn't do anything except log a success message // ---------------------------------------------------------------- this.defaultSuccessHandler = function(transaction, results) { console.log("WebSQL Success. Default success handler. No action taken."); } }

  Read the article

• Binding Many-to-Many Core Data relationships in UI

  - by Kevin

  Basically my setup is this. I have a many-to-many relationship in Core Data where a student entity can have multiple courses, and a course entity can have multiple students. My problem is in trying to figure out how to bind this relationship to the UI in Interface Builder. I want to be able to add courses to a course array controller, then have those courses displayed in a popup menu in a NSTableView in the Edit Student window where you can add courses to a student. This is what I have so far: http://vimeo.com/10671726 It's probably easier to understand from the video. Thanks

  Read the article

• Powershell GUI: Adding multiple instances of .tooltipseperate to menu

  - by obious

  So, I'm having a problem whereby for some reason I can only add one instance of a .tooltipseperator to a drop down menu. E.g. I have to create a new .tooltipseperator if I want to add another to a different menu list. I have this: $seperator = new-object System.Windows.Forms.Toolstripseparator $seperator1 = new-object System.Windows.Forms.Toolstripseparator which correlates to this: [Void]$packages_menu_bar.DropDownItems.Add($seperator1) [Void]$packages_menu_bar.DropDownItems.Add($Remove_from_AD) [Void]$process.DropDownItems.Add($Kill_process) [Void]$process.DropDownItems.Add($seperator) My question is this: how can I add the same instance on a .tooltipseperater to different menu items? Some sort of array? Thanks

  Read the article

• Custom validation works in development but not in unit test

  - by Geolev

  I want to validate that at least one of two columns have a value in my model. I found somewhere on the web that I could create a custom validator as follows: # Check for the presence of one or another field: # :validates_presence_of_at_least_one_field :last_name, :company_name - would require either last_name or company_name to be filled in # also works with arrays # :validates_presence_of_at_least_one_field :email, [:name, :address, :city, :state] - would require email or a mailing type address module ActiveRecord module Validations module ClassMethods def validates_presence_of_at_least_one_field(*attr_names) msg = attr_names.collect {|a| a.is_a?(Array) ? " ( #{a.join(", ")} ) " : a.to_s}.join(", ") + "can't all be blank. At least one field must be filled in." configuration = { :on => :save, :message => msg } configuration.update(attr_names.extract_options!) send(validation_method(configuration[:on]), configuration) do |record| found = false attr_names.each do |a| a = [a] unless a.is_a?(Array) found = true a.each do |attr| value = record.respond_to?(attr.to_s) ? record.send(attr.to_s) : record[attr.to_s] found = !value.blank? end break if found end record.errors.add_to_base(configuration[:message]) unless found end end end end end I put this in a file called lib/acs_validator.rb in my project and added "require 'acs_validator'" to my environment.rb. This does exactly what I want. It works perfectly when I manually test it in the development environment but when I write a unit test it breaks my test environment. This is my unit test: require 'test_helper' class CustomerTest < ActiveSupport::TestCase # Replace this with your real tests. test "the truth" do assert true end test "customer not valid" do puts "customer not valid" customer = Customer.new assert !customer.valid? assert customer.errors.invalid?(:subdomain) assert_equal "Company Name and Last Name can't both be blank.", customer.errors.on(:contact_lname) end end This is my model: class Customer < ActiveRecord::Base validates_presence_of :subdomain validates_presence_of_at_least_one_field :customer_company_name, :contact_lname, :message => "Company Name and Last Name can't both be blank." has_one :service_plan end When I run the unit test, I get the following error: DEPRECATION WARNING: Rake tasks in vendor/plugins/admin_data/tasks, vendor/plugins/admin_data/tasks, and vendor/plugins/admin_data/tasks are deprecated. Use lib/tasks instead. (called from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/tasks/rails.rb:10) Couldn't drop acs_test : #<ActiveRecord::StatementInvalid: PGError: ERROR: database "acs_test" is being accessed by other users DETAIL: There are 1 other session(s) using the database. : DROP DATABASE IF EXISTS "acs_test"> acs_test already exists NOTICE: CREATE TABLE will create implicit sequence "customers_id_seq" for serial column "customers.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "customers_pkey" for table "customers" NOTICE: CREATE TABLE will create implicit sequence "service_plans_id_seq" for serial column "service_plans.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "service_plans_pkey" for table "service_plans" /usr/bin/ruby1.8 -I"lib:test" "/usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb" "test/unit/customer_test.rb" "test/unit/service_plan_test.rb" "test/unit/helpers/dashboard_helper_test.rb" "test/unit/helpers/customers_helper_test.rb" "test/unit/helpers/service_plans_helper_test.rb" /usr/lib/ruby/gems/1.8/gems/activerecord-2.3.8/lib/active_record/base.rb:1994:in `method_missing_without_paginate': undefined method `validates_presence_of_at_least_one_field' for #<Class:0xb7076bd0> (NoMethodError) from /usr/lib/ruby/gems/1.8/gems/will_paginate-2.3.12/lib/will_paginate/finder.rb:170:in `method_missing' from /home/george/projects/advancedcomfortcs/app/models/customer.rb:3 from /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' from /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `require' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:158:in `require' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:265:in `require_or_load' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:224:in `depend_on' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:136:in `require_dependency' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:414:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:413:in `each' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:413:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:411:in `each' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:411:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:197:in `process' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:113:in `send' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:113:in `run' from /home/george/projects/advancedcomfortcs/config/environment.rb:9 from ./test/test_helper.rb:2:in `require' from ./test/test_helper.rb:2 from ./test/unit/customer_test.rb:1:in `require' from ./test/unit/customer_test.rb:1 from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5:in `load' from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5 from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5:in `each' from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5 rake aborted! Command failed with status (1): [/usr/bin/ruby1.8 -I"lib:test" "/usr/lib/ru...] (See full trace by running task with --trace) It seems to have stepped on will_paginate somehow. Does anyone have any suggestions? Is there another way to do the validation I'm attempting to do? Thanks, George

  Read the article

• Marshal a list of objects from VB6 to C#

  - by Andrew

  I have a development which requires the passing of objects between a VB6 application and a C# class library. The objects are defined in the C# class library and are used as parameters for methods exposed by other classes in the same library. The objects all contain simple string/numeric properties and so marshaling has been relatively painless. We now have a requirement to pass an object which contains a list of other objects. If I was coding this in VB6 I might have a class containing a collection as a member variable. In C# I might have a class with a List member variable. Is it possible to construct a C# class in such a way that the VB6 application could populate this inner list and marshal it successfully? I don't have a lot of experience here but I would guess Id have to use an array of Object types.

  Read the article

• How to draw/manage a hexagon grid?

  - by W.N.

  I've read this article: generating/creating hexagon grid in C . But look like both the author and answerer have already abandoned it. v(hexagonSide - hexagonWidth * hexagonWidth): What's hexagonSide and hexagonWidth? Isn't it will < 0 (so square root can't be calculated). And, can I put a hexagon into a rectangle? I need to create a grid like this: One more thing, how can I arrange my array to store data, as well as get which cells are next to one cell? I have never been taught about hexagon, so I know nothing about it, but I can easily learn new thing, so if you can explain or give me a clue, I may do it myself.

  Read the article

• Make object available within php functions without passing them or making them global

  - by Matt

  Hey all, This requirement is just for simplicity for developers and beautiful code. I'm building a template system and I really would just like an object variable to simply be there in all functions. Here's some code: Librarian.php: $class = "slideshow"; $function = "basic"; $args = array(...); $librarian = $this; // I WOULD LIKE THIS TO BE PRESENT IN CALLED FUNCTION ... return call_user_func($class.'::'.$function, $args); ... Slideshow.php: public static function basic($args) { echo $librarian; // "Librarian Object" } Thanks! Matt Mueller

  Read the article

• How do I include 2 tables in one LocalStorage item?

  - by Noor

  I've got a table that you can edit, and I've got a simple code saving that list when you're done with editing it. (the tables have the contenteditable on) The problem I've stumbled upon is that if I double click on enter, the table gets divided into two separate tables with the same ID. This causes the code I'm using to set the localStorage to only store one of the tables (I assume the first).. I've thought of different solutions and I wonder if someone could point out the pro's and con's (if the solutions even works that is). Make a loop that checks the page after tables and stores them into an array of localStorage-items.. I'd have to dynamically create a localStorage item for each table. Take the whole div that the tables are in, and store that in the localStorage, when a user revisits the page, the page checks after the items in storage and displays the whole divs. Any suggestions you have that can beat this :).. (but no cache, it has to be with the localStorage!) Thanks

  Read the article

• Replacing backslash with another symbol in PHP

  - by Skyfe

  Hi there, Been struggling with replacing a backslash by another symbol such as '.-.' just to indicate the position of backslashes as I could not send a string such as 'C\xampp\etc.' through url as GET variable so I thought I'd first replace the backslashes in that string by another symbol, then send through url, and then replace them back to backslashes in the PHP file that handles it. Though would there be a better way to send such strings through url? Because when I try a script such as: $tmp_name = preg_replace("\", ".-.", $_FILES['uploadfile']['tmp_name']); It turns out into a php error as \ is also used as delimiter.. Could anyone help me out on this? Thanks in advanced! Btw, if I'd be able to send a full array through url, this whole problem would be solved, but I don't think it's possible?

  Read the article

• runtime loading of ValidateAntiForgeryToken Salt value

  - by p.campbell

  Consider an ASP.NET MVC application using the Salt parameter in the [ValidateAntiForgeryToken] directive. The scenario is such that the app will be used by many customers. It's not terribly desirable to have the Salt known at compile time. The current strategy is to locate the Salt value in the web.config. [ValidateAntiForgeryToken(Salt = Config.AppSalt)] //Config.AppSalt is a static property that reads the web.config. This leads to a compile-time exception suggesting that the Salt must be a const at compile time. An attribute argument must be a constant expression, typeof expression or array creation expression of an attribute parameter type How can I modify the application to allow for a runtime loading of the Salt so that the app doesn't have to be re-salted and recompiled for each customer? Consider that the Salt won't change frequently, if at all, thereby removing the possibility of invalidating form

  Read the article

• Defining a dd/mm/yyyy field within an abstract table model

  - by Simon Andi

  I have defined an abstract table model but one of the columns should house date values as dd/mm/yyyy format not sure how to do this. I have a external global file and have hard coded the dates as dd/mm/yyyy. How can I define this column within my abstract table model so that to only allow only dates having dd/mm/yyyy format. public class OptraderGlobalParameters { public static boolean DEBUG = true; //Set DEBUG = true for Debugging /*=========================*/ /*Table Array For Dividends*/ /*=========================*/ public static String[] columnNames = {"Date", "Dividend", "Actual", "Yield (%)" }; public static Object[][] data = { {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, }; }

  Read the article

• Memory in Eclipse

  - by user247866

  I'm getting the java.lang.OutOfMemoryError exception in Eclipse. I know that Eclipse by default uses heap size of 256M. I'm trying to increase it but nothing happens. For example: eclipse -vmargs -Xmx16g -XX:PermSize=2g -XX:MaxPermSize=2g I also tried different settings, using only the -Xmx option, using different cases of g, G, m, M, different memory sizes, but nothing helps. Does not matter which params I specify, the heap exception is thrown at the same time, so I assume there's something I'm doing wrong that Eclipse ignores the -Xmx parameter. I'm using a 32GB RAM machine and trying to execute something very simple such as: double[][] a = new double[15000][15000]; It only works when I reduce the array size to something around 10000 on 10000. I'm working on Linux and using the top command I can see how much memory the Java process is consuming; it's less than 2%. Thanks!

  Read the article

< Previous Page | 561 562 563 564 565 566 567 568 569 570 571 572  | Next Page >