Search Results

Search found 15004 results on 601 pages for 'date parsing'.

Page 565/601 | < Previous Page | 561 562 563 564 565 566 567 568 569 570 571 572  | Next Page >

  • c#: Design advice. Using DataTable or List<MyObject> for a generic rule checker

    - by Andrew White
    Hi, I have about 100,000 lines of generic data. Columns/Properties of this data are user definable and are of the usual data types (string, int, double, date). There will be about 50 columns/properties. I have 2 needs: To be able to calculate new columns/properties using an expression e.g. Column3 = Column1 * Column2. Ultimately I would like to be able to use external data using a callback, e.g. Column3 = Column1 * GetTemperature The expression is relatively simple, maths operations, sum, count & IF are the only necessary functions. To be able to filter/group the data and perform aggregations e.g. Sum(Data.Column1) Where(Data.Column2 == "blah") As far as I can see I have two options: 1. Using a DataTable. = Point 1 above is achieved by using DataColumn.Expression = Point 2 above is acheived by using DataTable.DefaultView.RowFilter & C# code 2. Using a List of generic Objects each with a Dictionary< string, object to store the values. = Point 1 could be achieved by something like NCalc = Point 2 is achieved using LINQ DataTable: Pros: DataColumn.Expression is inbuilt Cons: RowFilter & coding c# is not as "nice" as LINQ, DataColumn.Expression does not support callbacks(?) = workaround could be to get & replace external value when creating the calculated column GenericList: Pros: LINQ syntax, NCalc supports callbacks Cons: Implementing NCalc/generic calc engine Based on the above I would think a GenericList approach would win, but something I have not factored in is the performance which for some reason I think would be better with a datatable. Does anyone have a gut feeling / experience with LINQ vs. DataTable performance? How about NCalc? As I said there are about 100,000 rows of data, with 50 columns, of which maybe 20 are calculated. In total about 50 rules will be run against the data, so in total there will be 5 million row/object scans. Would really appreciate any insights. Thx. ps. Of course using a database + SQL & Views etc. would be the easiest solution, but for various reasons can't be implemented.

    Read the article

  • iPhone App is leaking memory; Instruments and Clang cannot find the leak

    - by Norbert
    Hi, i've developed an iPhone program which is kind of an image manipulation program: The user get an UIImagePickerController and selects an image. Then the program does some heavy calculating in a new thread (for responsiveness of the application). The thread has, of course, its own autorelease pool. When calculation is done, the seperated thread signals the main thread that the result can be presented. The app creates a new view controller, pushes it onto the navigation controller. In short: UIImagePickerController new thread (autorelease pool) does some heavy calculation with image data signal to main thread that it's done main thread creates view controller and pushes it onto navigation controller view controller presents image result My program works well, but if I dismiss the navigation controller's top view controller by tapping on the back button and repeat the whole process several times, my app crashes. But only on the device! Instruments cannot find any leaks (except for some minor ones which I don't feel responsible for: thread creation, NSCFString; overall about 10 kB). Even Clang static analyzer tells me that my could seems to be all right. I know that the UIImage class can cache images and objects returned from convenience methods get freed only whet their autorelease pool gets drained. But most of the time I work with CGImageRef and I use UIImage' alloc, init & release methods to free memory as soon as possible. Currently, I don't know how to isolate the problem. How would you approach this problem? Crash Log: Incident Identifier: F4C202C9-1338-48FC-80AD-46248E6C7154 CrashReporter Key: bb6f526d8b9bb680f25ea8e93bb071566ccf1776 OS Version: iPhone OS 3.1.1 (7C145) Date: 2009-09-26 14:18:57 +0200 Free pages: 372 Wired pages: 7754 Purgeable pages: 0 Largest process: _MY_APP_ Processes Name UUID Count resident pages _MY_APP_ <032690e5a9b396058418d183480a9ab3> 17766 (jettisoned) (active) debugserver <ec29691560aa0e2994f82f822181bffd> 107 syslog_relay <21e13fa2b777218bdb93982e23fb65d3> 62 notification_pro <8a7725017106a28b545fd13ed58bf98c> 64 notification_pro <8a7725017106a28b545fd13ed58bf98c> 64 afcd <98b45027fbb1350977bf1ca313dee527> 65 mediaserverd <eb8fe997a752407bea573cd3adf568d3> 319 ptpd <b17af9cf6c4ad16a557d6377378e8a1e> 142 syslogd <ec8a5bc4483638539fa1266363dee8b8> 68 BTServer <1bb74831f93b1d07c48fb46cc31c15da> 119 apsd <a639ba83e666cc1d539223923ce59581> 165 notifyd <2ed3a1166da84d8d8868e64d549cae9d> 101 CommCenter <f4239480a623fb1c35fa6c725f75b166> 161 SpringBoard <8919df8091fdfab94d9ae05f513c0ce5> 2681 (active) accessoryd <b66bcf6e77c3ee740c6a017f54226200> 90 configd <41e9d763e71dc0eda19b0afec1daee1d> 275 fairplayd <cdce5393153c3d69d23c05de1d492bd4> 108 mDNSResponder <f3ef7a6b24d4f203ed147f476385ec53> 103 lockdownd <6543492543ad16ff0707a46e512944ff> 297 launchd <73ce695fee09fc37dd70b1378af1c818> 71 **End**

    Read the article

  • Same data being returned by linq for 2 different executions of a stored procedure?

    - by Paul
    Hello I have a stored procedure that I am calling through Entity Framework. The stored procedure has 2 date parameters. I supply different argument in the 2 times I call the stored procedure. I have verified using SQL Profiler that the stored procedure is being called correctly and returning the correct results. When I call my method the second time with different arguments, even though the stored procedure is bringing back the correct results, the table created contains the same data as the first time I called it. dtStart = 01/08/2009 dtEnd = 31/08/2009 public List<dataRecord> GetData(DateTime dtStart, DateTime dtEnd) { var tbl = from t in db.SP(dtStart, dtEnd) select t; return tbl.ToList(); } GetData((new DateTime(2009, 8, 1), new DateTime(2009, 8, 31)) // tbl.field1 value = 45450 - CORRECT GetData(new DateTime(2009, 7, 1), new DateTime(2009, 7, 31)) // tbl.field1 value = 45450 - WRONG 27456 expected Is this a case of Entity Framework being clever and caching? I can't see why it would cache this though as it has executed the stored procedure twice. Do I have to do something to close tbl? using Visual Studio 2008 + Entity Framework. I also get the message "query cannot be enumerated more than once" a few times every now and then, am not sure if that is relevant? FULL CODE LISTING namespace ProfileDataService { public partial class DataService { public static List<MeterTotalConsumpRecord> GetTotalAllTimesConsumption(DateTime dtStart, DateTime dtEnd, EUtilityGroup ug, int nMeterSelectionType, int nCustomerID, int nUserID, string strSelection, bool bClosedLocations, bool bDisposedLocations) { dbChildDataContext db = DBManager.ChildDataConext(nCustomerID); var tbl = from t in db.GetTotalConsumptionByMeter(dtStart, dtEnd, (int) ug, nMeterSelectionType, nCustomerID, nUserID, strSelection, bClosedLocations, bDisposedLocations, 1) select t; return tbl.ToList(); } } } /// CALLER List<MeterTotalConsumpRecord> _P1Totals; List<MeterTotalConsumpRecord> _P2Totals; public void LoadData(int nUserID, int nCustomerID, ELocationSelectionMethod locationSelectionMethod, string strLocations, bool bIncludeClosedLocations, bool bIncludeDisposedLocations, DateTime dtStart, DateTime dtEnd, ReportsBusinessLogic.Lists.EPeriodType durMainPeriodType, ReportsBusinessLogic.Lists.EPeriodType durCompareToPeriodType, ReportsBusinessLogic.Lists.EIncreaseReportType rptType, bool bIncludeDecreases) { ///Code for setting properties using parameters.. _P2Totals = ProfileDataService.DataService.GetTotalAllTimesConsumption(_P2StartDate, _P2EndDate, EUtilityGroup.Electricity, 1, nCustomerID, nUserID, strLocations, bIncludeClosedLocations, bIncludeDisposedLocations); _P1Totals = ProfileDataService.DataService.GetTotalAllTimesConsumption(_StartDate, _EndDate, EUtilityGroup.Electricity, 1, nCustomerID, nUserID, strLocations, bIncludeClosedLocations, bIncludeDisposedLocations); PopulateLines() //This fills up a list of objects with information for my report ready for the totals to be added PopulateTotals(_P1Totals, 1); PopulateTotals(_P2Totals, 2); } void PopulateTotals(List<MeterTotalConsumpRecord> objTotals, int nPeriod) { MeterTotalConsumpRecord objMeterConsumption = null; foreach (IncreaseReportDataRecord objLine in _Lines) { objMeterConsumption = objTotals.Find(delegate(MeterTotalConsumpRecord t) { return t.MeterID == objLine.MeterID; }); if (objMeterConsumption != null) { if (nPeriod == 1) { objLine.P1Consumption = (double)objMeterConsumption.Consumption; } else { objLine.P2Consumption = (double)objMeterConsumption.Consumption; } objMeterConsumption = null; } } } }

    Read the article

  • With logback not able to send mail..? any body please help.....with is

    - by Urvish
    please go through following.... <appender name="stdout" class="ch.qos.logback.core.ConsoleAppender"> <layout class="ch.qos.logback.classic.PatternLayout"> <Pattern>%d %p %c - %m%n</Pattern> </layout> </appender> <!-- --> <!-- Declare the SMTPAppender --> <!-- --> <appender name="EMAIL" class="ch.qos.logback.classic.net.SMTPAppender"> <SMTPHost>smtp.gmail.com</SMTPHost> <To>[email protected]</To> <From>[email protected]</From> <Subject>ERROR: %logger{20} - %m</Subject> <Username>******</Username> <Password>******</Password> <layout class="ch.qos.logback.classic.PatternLayout"> <Pattern>%date %-5level %logger{35} - %message%n</Pattern> </layout> </appender> <appender name="R" class="ch.qos.logback.core.rolling.RollingFileAppender"> <!--See also http://logback.qos.ch/manual/appenders.html#RollingFileAppender--> <File>example.log</File> <layout class="ch.qos.logback.classic.PatternLayout"> <Pattern>%d %p - %m%n</Pattern> </layout> <rollingPolicy class="ch.qos.logback.core.rolling.FixedWindowRollingPolicy"> <maxIndex>4</maxIndex> <FileNamePattern>example.log.%i</FileNamePattern> </rollingPolicy> <triggeringPolicy class="ch.qos.logback.core.rolling.SizeBasedTriggeringPolicy"> <MaxFileSize>500KB</MaxFileSize> </triggeringPolicy> </appender> <logger name="org.springframework" level="WARN"/> <logger name="org.springframework.jdbc.core.JdbcTemplate" level="WARN"/> <logger name="org.springframework.jdbc.core.StatementCreatorUtils" level="WARN"/> <logger name="org.springframework.security.web.FilterChainProxy" level="WARN"/> <logger name="com.logicwind" level="INFO"/> <logger name="performance" level="INFO"/> <!--<logger name="org.apache.struts2" level="DEBUG"/> -- -- </root>

    Read the article

  • "Unable to find any mappings for the given content, keyPath=null" RestKit 0.2

    - by abisson
    So I switched to using RestKit 0.2 and CoreData and I've been having a lot of trouble trying to get the mappings correct... I don't understand why. The JSON Response of my server is like this: { "meta": { "limit": 20, "next": null, "offset": 0, "previous": null, "total_count": 2 }, "objects": [{ "creation_date": "2012-10-15T20:16:47", "description": "", "id": 1, "last_modified": "2012-10-15T20:16:47", "order": 1, "other_names": "", "primary_name": "Mixing", "production_line": "/api/rest/productionlines/1/", "resource_uri": "/api/rest/cells/1/" }, { "creation_date": "2012-10-15T20:16:47", "description": "", "id": 2, "last_modified": "2012-10-15T20:16:47", "order": 2, "other_names": "", "primary_name": "Packaging", "production_line": "/api/rest/productionlines/1/", "resource_uri": "/api/rest/cells/2/" }] } Then in XCode I have: RKObjectManager *objectManager = [RKObjectManager sharedManager]; [AFNetworkActivityIndicatorManager sharedManager].enabled = YES; NSManagedObjectModel *managedObjectModel = [NSManagedObjectModel mergedModelFromBundles:nil]; RKManagedObjectStore *managedObjectStore = [[RKManagedObjectStore alloc] initWithManagedObjectModel:managedObjectModel]; objectManager.managedObjectStore = managedObjectStore; RKEntityMapping *cellMapping = [RKEntityMapping mappingForEntityForName:@"Cell" inManagedObjectStore:managedObjectStore]; cellMapping.primaryKeyAttribute = @"identifier"; [cellMapping addAttributeMappingsFromDictionary:@{ @"id": @"identifier", @"primary_name": @"primaryName", }]; RKResponseDescriptor *responseCell = [RKResponseDescriptor responseDescriptorWithMapping:cellMapping pathPattern:@"/api/rest/cells/?format=json" keyPath:@"objects" statusCodes:RKStatusCodeIndexSetForClass(RKStatusCodeClassSuccessful)]; [objectManager addResponseDescriptorsFromArray:@[responseCell, responseUser, responseCompany]]; [managedObjectStore createPersistentStoreCoordinator]; NSString *storePath = [RKApplicationDataDirectory() stringByAppendingPathComponent:@"AppDB.sqlite"]; NSString *seedPath = [[NSBundle mainBundle] pathForResource:@"SeedDatabase" ofType:@"sqlite"]; NSError *error; NSPersistentStore *persistentStore = [managedObjectStore addSQLitePersistentStoreAtPath:storePath fromSeedDatabaseAtPath:seedPath withConfiguration:nil options:nil error:&error]; NSAssert(persistentStore, @"Failed to add persistent store with error: %@", error); // Create the managed object contexts [managedObjectStore createManagedObjectContexts]; // Configure a managed object cache to ensure we do not create duplicate objects managedObjectStore.managedObjectCache = [[RKInMemoryManagedObjectCache alloc] initWithManagedObjectContext:managedObjectStore.persistentStoreManagedObjectContext]; My request is: [[RKObjectManager sharedManager] getObjectsAtPath:@"/api/rest/cells/?format=json" parameters:nil success:^(RKObjectRequestOperation *operation, RKMappingResult *mappingResult) { RKLogInfo(@"Load complete: Table should refresh..."); [[NSUserDefaults standardUserDefaults] setObject:[NSDate date] forKey:@"LastUpdatedAt"]; [[NSUserDefaults standardUserDefaults] synchronize]; } failure:^(RKObjectRequestOperation *operation, NSError *error) { RKLogError(@"Load failed with error: %@", error); }]; And I always get the following error: **Error Domain=org.restkit.RestKit.ErrorDomain Code=1001 "Unable to find any mappings for the given content" UserInfo=0x1102d500 {DetailedErrors=(), NSLocalizedDescription=Unable to find any mappings for the given content, keyPath=null}** Thanks a lot!

    Read the article

  • Many-To-Many Query with Linq-To-NHibernate

    - by rjygraham
    Ok guys (and gals), this one has been driving me nuts all night and I'm turning to your collective wisdom for help. I'm using Fluent Nhibernate and Linq-To-NHibernate as my data access story and I have the following simplified DB structure: CREATE TABLE [dbo].[Classes]( [Id] [bigint] IDENTITY(1,1) NOT NULL, [Name] [nvarchar](100) NOT NULL, [StartDate] [datetime2](7) NOT NULL, [EndDate] [datetime2](7) NOT NULL, CONSTRAINT [PK_Classes] PRIMARY KEY CLUSTERED ( [Id] ASC ) CREATE TABLE [dbo].[Sections]( [Id] [bigint] IDENTITY(1,1) NOT NULL, [ClassId] [bigint] NOT NULL, [InternalCode] [varchar](10) NOT NULL, CONSTRAINT [PK_Sections] PRIMARY KEY CLUSTERED ( [Id] ASC ) CREATE TABLE [dbo].[SectionStudents]( [SectionId] [bigint] NOT NULL, [UserId] [uniqueidentifier] NOT NULL, CONSTRAINT [PK_SectionStudents] PRIMARY KEY CLUSTERED ( [SectionId] ASC, [UserId] ASC ) CREATE TABLE [dbo].[aspnet_Users]( [ApplicationId] [uniqueidentifier] NOT NULL, [UserId] [uniqueidentifier] NOT NULL, [UserName] [nvarchar](256) NOT NULL, [LoweredUserName] [nvarchar](256) NOT NULL, [MobileAlias] [nvarchar](16) NULL, [IsAnonymous] [bit] NOT NULL, [LastActivityDate] [datetime] NOT NULL, PRIMARY KEY NONCLUSTERED ( [UserId] ASC ) I omitted the foreign keys for brevity, but essentially this boils down to: A Class can have many Sections. A Section can belong to only 1 Class but can have many Students. A Student (aspnet_Users) can belong to many Sections. I've setup the corresponding Model classes and Fluent NHibernate Mapping classes, all that is working fine. Here's where I'm getting stuck. I need to write a query which will return the sections a student is enrolled in based on the student's UserId and the dates of the class. Here's what I've tried so far: 1. var sections = (from s in this.Session.Linq<Sections>() where s.Class.StartDate <= DateTime.UtcNow && s.Class.EndDate > DateTime.UtcNow && s.Students.First(f => f.UserId == userId) != null select s); 2. var sections = (from s in this.Session.Linq<Sections>() where s.Class.StartDate <= DateTime.UtcNow && s.Class.EndDate > DateTime.UtcNow && s.Students.Where(w => w.UserId == userId).FirstOrDefault().Id == userId select s); Obviously, 2 above will fail miserably if there are no students matching userId for classes the current date between it's start and end dates...but I just wanted to try. The filters for the Class StartDate and EndDate work fine, but the many-to-many relation with Students is proving to be difficult. Everytime I try running the query I get an ArgumentNullException with the message: Value cannot be null. Parameter name: session I've considered going down the path of making the SectionStudents relation a Model class with a reference to Section and a reference to Student instead of a many-to-many. I'd like to avoid that if I can, and I'm not even sure it would work that way. Thanks in advance to anyone who can help. Ryan

    Read the article

  • WordPress: Using custom field to define posts to display in loop

    - by j-man86
    Hi, I'm trying to use a custom field in which I input the post ID numbers of the posts I want to show, seperated by commas. For some reason though, only the first post of the series of the post IDs are displaying. Can someone help? The value of $nlPostIds is (minus the quotes): "1542,1534,1546". Here's the code... the most important part is the 4th line 'post__in' => array($nlPostIds) <?php $nlPostIds = get_post_meta($post->ID, 'nlPostIds', true); $args=array( 'post__in' => array($nlPostIds) ); query_posts($args); if ( $wp_query->have_posts() ) : while ( $wp_query->have_posts() ) : $wp_query->the_post(); ?> <div class="entry"> <div class="post" id="post-<?php the_ID(); ?>"> <h2><a href="<?php the_permalink() ?>" rel="bookmark" title="Permanent Link to <?php the_title_attribute(); ?>"><?php the_title(); ?></a></h2> <div class="allinfos"><span class="date"><?php the_time('F jS, Y') ?></span> | <span class="comments"><?php comments_popup_link('No Comments', '1 Comment', '% Comments'); ?> </span> | <span class="category">Posted in <?php the_category(', ') ?></span> <!-- by <?php the_author() ?> --></div> <?php the_content('More &raquo;'); ?> <?php the_tags('Tags: ', ', ', ' '); ?> <?php edit_post_link('Edit', '[ ', ' ]'); ?> <div class="clear"></div> </div></div> <?php endwhile; endif; ?> Thanks!

    Read the article

  • If Then Statement Condition Being Ignored With Optimisations On

    - by Matma
    I think im going mad but can some show me what im missing, it must be some stupidly simple i just cant see the wood for the trees. BOTH side of this if then else statement are being executed? Ive tried commenting out the true side and moving the condition to a seperate variable with the same result. However if i explicitly set the condition to 1=0 or 1=1 then the if then statement is operating as i would expect. i.e. only executing one side of the equation... The only time ive seen this sort of thing is when the compiler has crashed and is no longer compiling (without visible indication that its not) but ive restarted studio with the same results, ive cleaned the solution, built and rebuilt with no change? please show me the stupid mistake im making using vs2005 if it matters. Dim dset As DataSet = New DataSet If (CboCustomers.SelectedValue IsNot Nothing) AndAlso (CboCustomers.SelectedValue <> "") Then Dim Sql As String = "Select sal.SalesOrderNo As SalesOrder,cus.CustomerName,has.SerialNo, convert(varchar,sal.Dateofpurchase,103) as Date from [dbo].[Customer_Table] as cus " & _ " inner join [dbo].[Hasp_table] as has on has.CustomerID=cus.CustomerTag " & _ " inner join [dbo].[salesorder_table] as sal On sal.Hasp_ID =has.Hasp_ID Where cus.CustomerTag = '" & CboCustomers.SelectedValue.ToString & "'" Dim dap As SqlDataAdapter = New SqlDataAdapter(Sql, FormConnection) dap.Fill(dset, "dbo.Customer_Table") DGCustomer.DataSource = dset.Tables("dbo.Customer_Table") Else Dim erm As String = "wtf" End If EDIT: i have found that this is something to do with the release config settings im using, i guesing its the optimisations bit. does anyone know of any utils/addons for vs that show if a line has been optimised out. delphi, my former language showed blue dots in the left margin to show that it was a compiled line, no dot meaning it wasnt compiled in, is there anything like that for vs? alternatively can someone explain how optimisations would affect this simple if statement causeing it to run both sides? EDIT2: using this thread as possible causes/solutions : http://stackoverflow.com/questions/2135509/bug-only-occurring-when-compile-optimization-enabled. It does the same with release = optimisations on, x86, x64 and AnyCPU Goes away with optimisations off. Im using V2005 on a x64 win7 machine, if that matters. Thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • MVC3/Razor Client Validation Not firing

    - by Jason Gerstorff
    I am trying to get client validation working in MVC3 using data annotations. I have looked at similar posts including this MVC3 Client side validation not working for the answer. I'm using an EF data model. I created a partial class like this for my validations. [MetadataType(typeof(Post_Validation))] public partial class Post { } public class Post_Validation { [Required(ErrorMessage = "Title is required")] [StringLength(5, ErrorMessage = "Title may not be longer than 5 characters")] public string Title { get; set; } [Required(ErrorMessage = "Text is required")] [DataType(DataType.MultilineText)] public string Text { get; set; } [Required(ErrorMessage = "Publish Date is required")] [DataType(DataType.DateTime)] public DateTime PublishDate { get; set; } } My cshtml page includes the following. <h2>Create</h2> <script src="@Url.Content("~/Scripts/jquery.validate.min.js")" type="text/javascript"></script> <script src="@Url.Content("~/Scripts/jquery.validate.unobtrusive.min.js")" type="text/javascript"></script> @using (Html.BeginForm()) { @Html.ValidationSummary(true) Post <div class="editor-label"> @Html.LabelFor(model => model.Title) </div> <div class="editor-field"> @Html.EditorFor(model => model.Title) @Html.ValidationMessageFor(model => model.Title) </div> <div class="editor-label"> @Html.LabelFor(model => model.Text) </div> <div class="editor-field"> @Html.EditorFor(model => model.Text) @Html.ValidationMessageFor(model => model.Text) Web Config: <appSettings> <add key="ClientValidationEnabled" value="true" /> <add key="UnobtrusiveJavaScriptEnabled" value="true" /> Layout: <head> <title>@ViewBag.Title</title> <link href="@Url.Content("~/Content/Site.css")" rel="stylesheet" type="text/css" /> <script src="@Url.Content("~/Scripts/jquery-1.4.4.min.js")" type="text/javascript"></script> So, the Multiline Text annotation works and creates a text area. But none of the validations work client side. I don't know what i might be missing. Any ideas?? i can post more information if needed. Thanks!

    Read the article

  • How to do the processing and keep GUI refreshed using databinding?

    - by macias
    History of the problem This is continuation of my previous question How to start a thread to keep GUI refreshed? but since Jon shed new light on the problem, I would have to completely rewrite original question, which would make that topic unreadable. So, new, very specific question. The problem Two pieces: CPU hungry heavy-weight processing as a library (back-end) WPF GUI with databinding which serves as monitor for the processing (front-end) Current situation -- library sends so many notifications about data changes that despite it works within its own thread it completely jams WPF data binding mechanism, and in result not only monitoring the data does not work (it is not refreshed) but entire GUI is frozen while processing the data. The aim -- well-designed, polished way to keep GUI up to date -- I am not saying it should display the data immediately (it can skip some changes even), but it cannot freeze while doing computation. Example This is simplified example, but it shows the problem. XAML part: <StackPanel Orientation="Vertical"> <Button Click="Button_Click">Start</Button> <TextBlock Text="{Binding Path=Counter}"/> </StackPanel> C# part (please NOTE this is one piece code, but there are two sections of it): public partial class MainWindow : Window,INotifyPropertyChanged { // GUI part public MainWindow() { InitializeComponent(); DataContext = this; } private void Button_Click(object sender, RoutedEventArgs e) { var thread = new Thread(doProcessing); thread.IsBackground = true; thread.Start(); } // this is non-GUI part -- do not mess with GUI here public event PropertyChangedEventHandler PropertyChanged; public void OnPropertyChanged(string property_name) { if (PropertyChanged != null) PropertyChanged(this, new PropertyChangedEventArgs(property_name)); } long counter; public long Counter { get { return counter; } set { if (counter != value) { counter = value; OnPropertyChanged("Counter"); } } } void doProcessing() { var tmp = 10000.0; for (Counter = 0; Counter < 10000000; ++Counter) { if (Counter % 2 == 0) tmp = Math.Sqrt(tmp); else tmp = Math.Pow(tmp, 2.0); } } } Known workarounds (Please do not repost them as answers) Those two first are based on Jon ideas: pass GUI dispatcher to library and use it for sending notifications -- why it is ugly? because it could be no GUI at all give up with data binding COMPLETELY (one widget with databinding is enough for jamming), and instead check from time to time data and update the GUI manually -- well, I didn't learn WPF just to give up with it now ;-) and this is mine, it is ugly, but simplicity of it kills -- before sending notification freeze a thread -- Thread.Sleep(1) -- to let the potential receiver "breathe" -- it works, it is minimalistic, it is ugly though, and it ALWAYS slows down computation even if no GUI is there So... I am all ears for real solutions, not some tricks.

    Read the article

  • Speeding up templates in GAE-Py by aggregating RPC calls

    - by Sudhir Jonathan
    Here's my problem: class City(Model): name = StringProperty() class Author(Model): name = StringProperty() city = ReferenceProperty(City) class Post(Model): author = ReferenceProperty(Author) content = StringProperty() The code isn't important... its this django template: {% for post in posts %} <div>{{post.content}}</div> <div>by {{post.author.name}} from {{post.author.city.name}}</div> {% endfor %} Now lets say I get the first 100 posts using Post.all().fetch(limit=100), and pass this list to the template - what happens? It makes 200 more datastore gets - 100 to get each author, 100 to get each author's city. This is perfectly understandable, actually, since the post only has a reference to the author, and the author only has a reference to the city. The __get__ accessor on the post.author and author.city objects transparently do a get and pull the data back (See this question). Some ways around this are Use Post.author.get_value_for_datastore(post) to collect the author keys (see the link above), and then do a batch get to get them all - the trouble here is that we need to re-construct a template data object... something which needs extra code and maintenance for each model and handler. Write an accessor, say cached_author, that checks memcache for the author first and returns that - the problem here is that post.cached_author is going to be called 100 times, which could probably mean 100 memcache calls. Hold a static key to object map (and refresh it maybe once in five minutes) if the data doesn't have to be very up to date. The cached_author accessor can then just refer to this map. All these ideas need extra code and maintenance, and they're not very transparent. What if we could do @prefetch def render_template(path, data) template.render(path, data) Turns out we can... hooks and Guido's instrumentation module both prove it. If the @prefetch method wraps a template render by capturing which keys are requested we can (atleast to one level of depth) capture which keys are being requested, return mock objects, and do a batch get on them. This could be repeated for all depth levels, till no new keys are being requested. The final render could intercept the gets and return the objects from a map. This would change a total of 200 gets into 3, transparently and without any extra code. Not to mention greatly cut down the need for memcache and help in situations where memcache can't be used. Trouble is I don't know how to do it (yet). Before I start trying, has anyone else done this? Or does anyone want to help? Or do you see a massive flaw in the plan?

    Read the article

  • [Android] Force close when trying to parse JSON with AsyncTask in the background

    - by robs
    Hello everyone, i'm new to android development and i'm playing around with json data. I managed to get the parsing to work. I want to show a ProgressDialog and i read that i need to use AsyncTask that. But for some reason i get a force close as soon as i put the same working code inside doInBackground() eventhough eclipse says everything is fine. Here is the source code: public class HomeActivity extends Activity { public class BackgroundAsyncTask extends AsyncTask<Void, Integer, Void> { ProgressDialog dialog = new ProgressDialog (HomeActivity.this); @Override protected void onPreExecute() { dialog.setMessage("Loading...please wait"); dialog.setIndeterminate(true); dialog.setCancelable(false); dialog.show(); } protected void onPostExecute() { dialog.dismiss(); } @Override protected Void doInBackground(Void... params) { try { URL json = new URL("http://www.corps-marchia.de/jsontest.php"); URLConnection tc = json.openConnection(); BufferedReader in = new BufferedReader(new InputStreamReader(tc.getInputStream())); String line; while ((line = in.readLine()) != null) { JSONArray ja = new JSONArray(line); JSONObject jo = (JSONObject) ja.get(0); TextView txtView = (TextView)findViewById(R.id.TextView01); txtView.setText(jo.getString("text")); } } catch (MalformedURLException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (JSONException e) { e.printStackTrace(); } return null; } } @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); new BackgroundAsyncTask().execute(); } } Here is the error log: 01-08 12:33:48.225: ERROR/AndroidRuntime(815): FATAL EXCEPTION: AsyncTask #1 01-08 12:33:48.225: ERROR/AndroidRuntime(815): java.lang.RuntimeException: An error occured while executing doInBackground() 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.os.AsyncTask$3.done(AsyncTask.java:200) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerSetException(FutureTask.java:274) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask.setException(FutureTask.java:125) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:308) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask.run(FutureTask.java:138) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1088) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:581) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.lang.Thread.run(Thread.java:1019) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): Caused by: android.view.ViewRoot$CalledFromWrongThreadException: Only the original thread that created a view hierarchy can touch its views. 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.ViewRoot.checkThread(ViewRoot.java:2932) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.ViewRoot.requestLayout(ViewRoot.java:629) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.checkForRelayout(TextView.java:5521) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2724) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2592) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2567) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.doInBackground(HomeActivity.java:52) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.doInBackground(HomeActivity.java:1) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.os.AsyncTask$2.call(AsyncTask.java:185) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:306) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): ... 4 more 01-08 12:33:51.605: ERROR/WindowManager(815): Activity net.ajzele.demo.andy1.HomeActivity has leaked window com.android.internal.policy.impl.PhoneWindow$DecorView@4051d0c0 that was originally added here 01-08 12:33:51.605: ERROR/WindowManager(815): android.view.WindowLeaked: Activity net.ajzele.demo.andy1.HomeActivity has leaked window com.android.internal.policy.impl.PhoneWindow$DecorView@4051d0c0 that was originally added here 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.ViewRoot.<init>(ViewRoot.java:258) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.WindowManagerImpl.addView(WindowManagerImpl.java:148) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.WindowManagerImpl.addView(WindowManagerImpl.java:91) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.Window$LocalWindowManager.addView(Window.java:424) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.Dialog.show(Dialog.java:241) 01-08 12:33:51.605: ERROR/WindowManager(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.onPreExecute(HomeActivity.java:33) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.AsyncTask.execute(AsyncTask.java:391) 01-08 12:33:51.605: ERROR/WindowManager(815): at net.ajzele.demo.andy1.HomeActivity.onCreate(HomeActivity.java:72) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1047) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1586) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1638) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.access$1500(ActivityThread.java:117) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:928) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.Handler.dispatchMessage(Handler.java:99) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.Looper.loop(Looper.java:123) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.main(ActivityThread.java:3647) 01-08 12:33:51.605: ERROR/WindowManager(815): at java.lang.reflect.Method.invokeNative(Native Method) 01-08 12:33:51.605: ERROR/WindowManager(815): at java.lang.reflect.Method.invoke(Method.java:507) 01-08 12:33:51.605: ERROR/WindowManager(815): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:839) 01-08 12:33:51.605: ERROR/WindowManager(815): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:597) 01-08 12:33:51.605: ERROR/WindowManager(815): at dalvik.system.NativeStart.main(Native Method) Any hints? I hope you can help me out ive searched the net and didnt find any working solution...Thanks in advance

    Read the article

  • log4net initialisation

    - by Ruben Bartelink
    I've looked hard for duplicates but have to ask the following, no matter how basic it may seem, to get it clear once and for all! In a fresh Console app using log4net version 1.2.10.0 on VS28KSP1 on 64 bit W7, I have the following code:- using log4net; using log4net.Config; namespace ConsoleApplication1 { class Program { static readonly ILog _log = LogManager.GetLogger(typeof(Program)); static void Main(string[] args) { _log.Info("Ran"); } } } In my app.config, I have: <?xml version="1.0" encoding="utf-8" ?> <configuration> <configSections> <section name="log4net" type="log4net.Config.Log4NetConfigurationSectionHandler, log4net" /> </configSections> <log4net> <appender name="RollingFileAppender" type="log4net.Appender.RollingFileAppender"> <file value="Program.log" /> <lockingModel type="log4net.Appender.FileAppender+MinimalLock" /> <appendToFile value="true" /> <rollingStyle value="Size" /> <maxSizeRollBackups value="10" /> <maximumFileSize value="1MB" /> <staticLogFileName value="true" /> <layout type="log4net.Layout.PatternLayout"> <conversionPattern value="[%username] %date [%thread] %-5level %logger [%property{NDC}] - %message%newline" /> </layout> </appender> <root> <level value="DEBUG" /> <appender-ref ref="RollingFileAppender" /> </root> </log4net> </configuration> This doesnt write anything, unless I either add an attribute: [ assembly:XmlConfigurator ] Or explicitly initialise it in Main(): _log.Info("This will not go to the log"); XmlConfigurator.Configure(); _log.Info("Ran"); This raises the following questions: I'm almost certain I've seen it working somewhere on some version of log4net without the addition of the assembly attribute or call in Main. Can someone assure me I'm not imagining that? Can someone please point me to where in the doc it explicitly states that both the config section and the initialisation hook are required - hopefully with an explanation of when this changed, if it did? I can easily imagine why this might be the policy -- having the initialisation step explicit to avoid surprises etc., it's just that I seem to recall this not always being the case... (And normally I have the config in a separate file, which generally takes configsections out of the picture)

    Read the article

  • Parallel.For maintain input list order on output list

    - by romeozor
    I'd like some input on keeping the order of a list during heavy-duty operations that I decided to try to do in a parallel manner to see if it boosts performance. (It did!) I came up with a solution, but since this was my first attempt at anything parallel, I'd need someone to slap my hands if I did something very stupid. There's a query that returns a list of card owners, sorted by name, then by date of birth. This needs to be rendered in a table on a web page (ASP.Net WebForms). The original coder decided he would construct the table cell-by-cell (TableCell), add them to rows (TableRow), then each row to the table. So no GridView, allegedly its performance is bad, but the performance was very poor regardless :). The database query returns in no time, the most time is spent on looping through the results and adding table cells etc. I made the following method to maintain the original order of the list: private TableRow[] ComposeRows(List<CardHolder> queryResult) { int queryElementsCount = queryResult.Count(); // array with the query's size var rowArray = new TableRow[queryElementsCount]; Parallel.For(0, queryElementsCount, i => { var row = new TableRow(); var cell = new TableCell(); // various operations, including simple ones such as: cell.Text = queryResult[i].Name; row.Cells.Add(cell); // here I'm adding the current item to it's original index // to maintain order in the output list rowArray[i] = row; }); return rowArray; } So as you can see, because I'm returning a very different type of data (List<CardHolder> -> TableRow[]), I can't just simply omit the ordering from the original query to do it after the operations. Also, I also thought it would be a good idea to Dispose() the objects at the end of each loop, because the query can return a huge list and letting cell and row objects pile up in the heap could impact performance.(?) How badly did I do? Does anyone have a better solution in case mine is flawed?

    Read the article

  • USB windows xp final USB access issues

    - by Lex Dean
    I basically understand you C++ people, Please do not get distracted because I'm writing in Delphi. I have a stable USB Listing method that accesses all my USB devices I get the devicepath, and this structure: TSPDevInfoData = packed record Size: DWORD; ClassGuid: TGUID; DevInst: DWORD; // DEVINST handle Reserved: DWord; end; I get my ProductID and VenderID successfully from my DevicePath Lists all USB devices connected to the computer at the time That enables me to access the registry data to each device in a stable way. What I'm lacking is a little direction Is friendly name able to be written inside the connected USB Micro chips by the firmware programmer? (I'm thinking of this to identify the device even further, or is this to help identify Bulk data transfer devices like memory sticks and camera's) Can I use SPDRP_REMOVAL_POLICY_OVERRIDE to some how reset these polices What else can I do with the registry details. Identifying when some one unplugs a device The program is using (in windows XP standard) I used a documented windows event that did not respond. Can I read a registry value to identify if its still connected? using CreateFileA (DevicePath) to send and receive data I have read when some one unplugs in the middle of a data transfer its difficult clearing resources. what can IoCreateDevice do for me and how does one use it for that task This two way point of connection status and system lock up situations is very concerning. Has some one read anything about this subject recently? My objectives are to 1. list connected USB devices identify a in development Micro Controller from everything else send and receive data in a stable and fast way to the limits of the controller No lock up's transferring data Note I'm not using any service packs I understand everything USB is in ANSI when windows xp is not and .Net is all about ANSI (what a waste of memory) I plan to continue this project into a .net at a later date as an addition. MSDN gives me Structures and Functions and what should link to what ok but say little to what they get used for. What is available in my language Delphi is way over priced that it needs a major price drop.

    Read the article

  • Web image loaded by thread in android

    - by Bostjan
    I have an extended BaseAdapter in a ListActivity: private static class RequestAdapter extends BaseAdapter { and some handlers and runnables defined in it // Need handler for callbacks to the UI thread final Handler mHandler = new Handler(); // Create runnable for posting final Runnable mUpdateResults = new Runnable() { public void run() { loadAvatar(); } }; protected static void loadAvatar() { // TODO Auto-generated method stub //ava.setImageBitmap(getImageBitmap("URL"+pic)); buddyIcon.setImageBitmap(avatar); } In the getView function of the Adapter, I'm getting the view like this: if (convertView == null) { convertView = mInflater.inflate(R.layout.messageitem, null); // Creates a ViewHolder and store references to the two children views // we want to bind data to. holder = new ViewHolder(); holder.username = (TextView) convertView.findViewById(R.id.username); holder.date = (TextView) convertView.findViewById(R.id.dateValue); holder.time = (TextView) convertView.findViewById(R.id.timeValue); holder.notType = (TextView) convertView.findViewById(R.id.notType); holder.newMsg = (ImageView) convertView.findViewById(R.id.newMsg); holder.realUsername = (TextView) convertView.findViewById(R.id.realUsername); holder.replied = (ImageView) convertView.findViewById(R.id.replied); holder.msgID = (TextView) convertView.findViewById(R.id.msgID_fr); holder.avatar = (ImageView) convertView.findViewById(R.id.buddyIcon); holder.msgPreview = (TextView) convertView.findViewById(R.id.msgPreview); convertView.setTag(holder); } else { // Get the ViewHolder back to get fast access to the TextView // and the ImageView. holder = (ViewHolder) convertView.getTag(); } and the image is getting loaded this way: Thread sepThread = new Thread() { public void run() { String ava; ava = request[8].replace(".", "_micro."); Log.e("ava thread",ava+", username: "+request[0]); avatar = getImageBitmap(URL+ava); buddyIcon = holder.avatar; mHandler.post(mUpdateResults); //holder.avatar.setImageBitmap(getImageBitmap(URL+ava)); } }; sepThread.start(); Now, the problem I'm having is that if there are more items that need to display the same picture, not all of those pictures get displayed. When you scroll up and down the list maybe you end up filling all of them. When I tried the commented out line (holder.avatar.setImageBitmap...) the app sometimes force closes with "only the thread that created the view can request...". But only sometimes. Any idea how I can fix this? Either option.

    Read the article

  • Sending HTML email from PHP

    - by KevinM
    I am trying to send a simple HTML e-mail from PHP. The code below simply results in a blank e-mail in GMail. It also has an empty attachment called 'noname', which is not at all what I want; though that might just be a symptom of it not working. The code I am using is: <?php //define the receiver of the email $to = '[email protected]'; //define the subject of the email $subject = 'Test HTML email'; //create a boundary string. It must be unique //so we use the MD5 algorithm to generate a random hash $random_hash = md5(date('r', time())); //define the headers we want passed. Note that they are separated with \r\n $headers = "From: [email protected]\r\nReply-To: [email protected]"; //add boundary string and mime type specification $headers .= "\r\nContent-Type: multipart/alternative; boundary=\"PHP-alt-".$random_hash."\""; //define the body of the message. ob_start(); //Turn on output buffering ?> --PHP-alt-<?php echo $random_hash; ?> MIME-Version: 1.0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 7bit Hello World!!! This is simple text email message. --PHP-alt-<?php echo $random_hash; ?> MIME-Version: 1.0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 7bit <h2>Hello World!</h2> <p>This is something with <b>HTML</b>formatting.</p> --PHP-alt-<?php echo $random_hash; ?>-- <? //copy current buffer contents into $message variable and delete current output buffer $message = ob_get_clean(); //send the email $mail_sent = @mail( $to, $subject, $message, $headers ); //if the message is sent successfully print "Mail sent". Otherwise print "Mail failed" echo $mail_sent ? "Mail sent" : "Mail failed";

    Read the article

  • UTF-8 GET using Indy 10.5.8.0 and Delphi XE2

    - by Bogdan Botezatu
    I'm writing my first Unicode application with Delphi XE2 and I've stumbled upon an issue with GET requests to an Unicode URL. Shortly put, it's a routine in a MP3 tagging application that takes a track title and an artist and queries Last.FM for the corresponding album, track no and genre. I have the following code: function GetMP3Info(artist, track: string) : TMP3Data //<---(This is a record) var TrackTitle, ArtistTitle : WideString; webquery : WideString; [....] WebQuery := UTF8Encode('http://ws.audioscrobbler.com/2.0/?method=track.getcorrection&api_key=' + apikey + '&artist=' + artist + '&track=' + track); //[processing the result in the web query, getting the correction for the artist and title] // eg: for artist := Bucovina and track := Mestecanis, the corrected values are //ArtistTitle := Bucovina; // TrackTitle := Mestecani?; //Now here is the tricky part: webquery := UTF8Encode('http://ws.audioscrobbler.com/2.0/?method=track.getInfo&api_key=' + apikey + '&artist=' + unescape(ArtistTitle) + '&track=' + unescape(TrackTitle)); //the unescape function replaces spaces (' ') with '+' to comply with the last.fm requests [some more processing] end; The webquery looks in a TMemo just right (http://ws.audioscrobbler.com/2.0/?method=track.getInfo&api_key=e5565002840xxxxxxxxxxxxxx23b98ad&artist=Bucovina&track=Mestecani?) Yet, when I try to send a GET() to the webquery using IdHTTP (with the ContentEncoding property set to 'UTF-8'), I see in Wireshark that the component is GET-ing the data to the ANSI value '/2.0/?method=track.getInfo&api_key=e5565002840xxxxxxxxxxxxxx23b98ad&artist=Bucovina&track=Mestec?ni?' Here is the full headers for the GET requests and responses: GET /2.0/?method=track.getInfo&api_key=e5565002840xxxxxxxxxxxxxx23b98ad&artist=Bucovina&track=Mestec?ni? HTTP/1.1 Content-Encoding: UTF-8 Host: ws.audioscrobbler.com Accept: text/html, */* Accept-Encoding: identity User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.23) Gecko/20110920 Firefox/3.6.23 SearchToolbar/1.22011-10-16 20:20:07 HTTP/1.0 400 Bad Request Date: Tue, 09 Oct 2012 20:46:31 GMT Server: Apache/2.2.22 (Unix) X-Web-Node: www204 Access-Control-Allow-Origin: * Access-Control-Allow-Methods: POST, GET, OPTIONS Access-Control-Max-Age: 86400 Cache-Control: max-age=10 Expires: Tue, 09 Oct 2012 20:46:42 GMT Content-Length: 114 Connection: close Content-Type: text/xml; charset=utf-8; <?xml version="1.0" encoding="utf-8"?> <lfm status="failed"> <error code="6"> Track not found </error> </lfm> The question that puzzles me is am I overseeing anything related to setting the property of the tidhttp control? How can I stop the well-formated URL i'm composing in the application from getting wrongfully sent to the server? Thanks.

    Read the article

  • Php INNER JOING jqGrid help

    - by yanike
    I'm trying to get INNER JOIN to work with JQGRID, but I can't get it working. I want the code to get the first_name and last_name from members using the "efrom" from messages that matches the "id" from members. $col = array(); $col["title"] = "From"; $col["name"] = "messages.efrom"; $col["width"] = "70"; $col["hidden"] = false; $col["editable"] = false; $col["sortable"] = true; $col["search"] = true; $cols[] = $col; $col = array(); $col["title"] = "First Name"; $col["name"] = "members.first_name"; $col["width"] = "80"; $col["hidden"] = false; $col["editable"] = false; $col["sortable"] = true; $col["search"] = true; $cols[] = $col; $col = array(); $col["title"] = "Last Name"; $col["name"] = "members.last_name"; $col["width"] = "80"; $col["hidden"] = false; $col["editable"] = false; $col["sortable"] = true; $col["search"] = true; $cols[] = $col; $col = array(); $col["title"] = "Subject"; $col["name"] = "messages.esubject"; $col["width"] = "300"; $col["hidden"] = false; $col["editable"] = false; $col["sortable"] = true; $col["search"] = true; $cols[] = $col; $col = array(); $col["title"] = "Date"; $col["name"] = "messages.edatetime"; $col["width"] = "150"; $col["hidden"] = false; $col["editable"] = false; $col["sortable"] = true; $col["search"] = true; $cols[] = $col; $g = new jqgrid(); $grid["sortname"] = 'messages.edatetime'; $g->select_command = "SELECT messages.efrom, messages.esubject, messages.edatetime, members.first_name, members.last_name FROM messages INNER JOIN members ON messages.efrom = members.id";

    Read the article

  • Fastest way to parse XML files in C#?

    - by LifeH2O
    I have to load many XML files from internet. But for testing with better speed i downloaded all of them (more than 500 files) of the following format. <player-profile> <personal-information> <id>36</id> <fullname>Adam Gilchrist</fullname> <majorteam>Australia</majorteam> <nickname>Gilchrist</nickname> <shortName>A Gilchrist</shortName> <dateofbirth>Nov 14, 1971</dateofbirth> <battingstyle>Left-hand bat</battingstyle> <bowlingstyle>Right-arm offbreak</bowlingstyle> <role>Wicket-Keeper</role> <teams-played-for>Western Australia, New South Wales, ICC World XI, Deccan Chargers, Australia</teams-played-for> <iplteam>Deccan Chargers</iplteam> </personal-information> <batting-statistics> <odi-stats> <matchtype>ODI</matchtype> <matches>287</matches> <innings>279</innings> <notouts>11</notouts> <runsscored>9619</runsscored> <highestscore>172</highestscore> <ballstaken>9922</ballstaken> <sixes>149</sixes> <fours>1000+</fours> <ducks>0</ducks> <fifties>55</fifties> <catches>417</catches> <stumpings>55</stumpings> <hundreds>16</hundreds> <strikerate>96.95</strikerate> <average>35.89</average> </odi-stats> <test-stats> . . . </test-stats> <t20-stats> . . . </t20-stats> <ipl-stats> . . . </ipl-stats> </batting-statistics> <bowling-statistics> <odi-stats> . . . </odi-stats> <test-stats> . . . </test-stats> <t20-stats> . . . </t20-stats> <ipl-stats> . . . </ipl-stats> </bowling-statistics> </player-profile> I am using XmlNodeList list = _document.SelectNodes("/player-profile/batting-statistics/odi-stats"); And then loop this list with foreach as foreach (XmlNode stats in list) { _btMatchType = GetInnerString(stats, "matchtype"); //it returns null string if node not availible . . . . _btAvg = Convert.ToDouble(stats["average"].InnerText); } Even i am loading all files offline, parsing is very slow Is there any good faster way to parse them? Or is it problem with SQL? I am saving all extracted data from XML to database using DataSets, TableAdapters with insert command. I

    Read the article

  • Send Mail through Jsp page.

    - by sourabhtaletiya
    hi friends ,i have tried alot to send mail via jsp page but i am not succeded. A error is coming javax.servlet.ServletException: 530 5.7.0 Must issue a STARTTLS command first. x1sm5029316wbx.19 <html> <head> <title>JSP JavaMail Example </title> </head> <body> <%@ page import="java.util.*" %> <%@ page import="javax.mail.*" %> <%@ page import="javax.mail.internet.*" %> <%@ page import="javax.activation.*" %> <% java.security.Security.addProvider(new com.sun.net.ssl.internal.ssl.Provider()); Properties props = System.getProperties(); props.put("mail.smtp.starttls.enable","true"); props.put("mail.smtp.starttls.required","true"); String host = "smtp.gmail.com"; String to = request.getParameter("to"); String from = request.getParameter("from"); String subject = request.getParameter("subject"); String messageText = request.getParameter("body"); boolean sessionDebug = false; props.put("mail.smtp.host", "smtp.gmail.com"); props.put("mail.transport.protocol", "smtp"); props.put("mail.smtp.port", "25"); props.put("mail.smtp.auth", "true"); props.put("mail.debug", "true"); props.put("mail.smtp.socketFactory.port","25"); props.put("mail.smtp.starttls.enable","true"); Session mailSession = Session.getDefaultInstance(props, null); mailSession.setDebug(sessionDebug); Message msg = new MimeMessage(mailSession); props.put("mail.smtp.starttls.enable","true"); msg.setFrom(new InternetAddress(from)); InternetAddress[] address = {new InternetAddress(to)}; msg.setRecipients(Message.RecipientType.TO, address); msg.setSubject(subject); msg.setSentDate(new Date()); msg.setText(messageText); props.put("mail.smtp.starttls.enable","true"); Transport tr = mailSession.getTransport("smtp"); tr.connect(host, "sourabh.web7", "june251989"); msg.saveChanges(); // don't forget this props.put("mail.smtp.starttls.enable","true"); tr.sendMessage(msg, msg.getAllRecipients()); tr.close(); // Transport.send(msg); /* out.println("Mail was sent to " + to); out.println(" from " + from); out.println(" using host " + host + ".");*/ %> </table> </body> </html>

    Read the article

  • IP address numbers in MySQL subquery

    - by Iain Collins
    I have a problem with a subquery involving IPV4 addresses stored in MySQL (MySQL 5.0). The IP addresses are stored in two tables, both in network number format - e.g. the format output by MySQL's INET_ATON(). The first table ('events') contains lots of rows with IP addresses associated with them, the second table ('network_providers') contains a list of provider information for given netblocks. events table (~4,000,000 rows): event_id (int) event_name (varchar) ip_address (unsigned 4 byte int) network_providers table (~60,000 rows): ip_start (unsigned 4 byte int) ip_end (unsigned 4 byte int) provider_name (varchar) Simplified for the purposes of the problem I'm having, the goal is to create an export along the lines of: event_id,event_name,ip_address,provider_name If do a query along the lines of either of the following, I get the result I expect: SELECT provider_name FROM network_providers WHERE INET_ATON('192.168.0.1') >= network_providers.ip_start ORDER BY network_providers.ip_start DESC LIMIT 1 SELECT provider_name FROM network_providers WHERE 3232235521 >= network_providers.ip_start ORDER BY network_providers.ip_start DESC LIMIT 1 That is to say, it returns the correct provider_name for whatever IP I look up (of course I'm not really using 192.168.0.1 in my queries). However, when performing this same query as a subquery, in the following manner, it doesn't yield the result I would expect: SELECT event.id, event.event_name, (SELECT provider_name FROM network_providers WHERE event.ip_address >= network_providers.ip_start ORDER BY network_providers.ip_start DESC LIMIT 1) as provider FROM events Instead the a different (incorrect) value for network_provider is returned - over 90% (but curiously not all) values returned in the provider column contain the wrong provider information for that IP. Using event.ip_address in a subquery just to echo out the value confirms it contains the value I'd expect and that the subquery can parse it. Replacing event.ip_address with an actual network number also works, just using it dynamically in the subquery in this manner that doesn't work for me. I suspect the problem is there is something fundamental and important about subqueries in MySQL that I don't get. I've worked with IP addresses like this in MySQL quite a bit before, but haven't previously done lookups for them using a subquery. The question: I'd really appreciate an example of how I could get the output I want, and if someone here knows, some enlightenment as to why what I'm doing doesn't work so I can avoid making this mistake again. Notes: The actual real-world usage I'm trying to do is considerably more complicated (involving joining two or three tables). This is a simplified version, to avoid overly complicating the question. Additionally, I know I'm not using a between on ip_start & ip_end - that's intentional (the DB's can be out of date, and such cases the owner in the DB is almost always in the next specified range and 'best guess' is fine in this context) however I'm grateful for any suggestions for improvement that relate to the question. Efficiency is always nice, but in this case absolutely not essential - any help appreciated.

    Read the article

  • How to set and get the id for the items in the spinner in Android

    - by Haresh Chaudhary
    I have a problem in my project that i am displaying a activity which would contain the details of the project which is previously added in Project Management System.. Now the fields in it are like: Fields of the Activity Name Of Project: ABC(EditText) Name Of Developer : ________(Spinner) Deadline : ________(Date Picker) Created On : _______(TextView) . . Now, the Spinner contains the Names of all developers working in the Company..I have used the ArrayAdapter with a array having the names of all the developers which is fetched from the database.. The problem is that when i update the Name Of Developer field, i get Only the Name of the Developer which is not enough to update the data as their can be multiple developers with the same name in the Company..So now I require the id of the developers to update it.. How to store that id of the developers with the Spinner so that i can achieve this.. Please help me to sort this out. Actually what i want to do like is as that we do in html:: <select> <option id="1">Developer1</option> <option id="2">Developer2</option> <option id="3">Developer2</option> <option id="4">Developer2</option> </select> where the id attached would be the database id....I want to imitate this in our android.... This the code that i have used to store the names in the array:: String alldevelopers = null; try { ArrayList<NameValuePair> postP = new ArrayList<NameValuePair>(); alldevelopers = CustomHttpClient.executeHttpPost( "/fetchdevelopers.php", postP); String respcl = alldevelopers.toString(); alldevelopersParser dev = new alldevelopersParser(); ow = dev.parseByDOM(respcl); } catch (Exception e) { e.printStackTrace(); } String developers[] = new String[ow.length]; //dev is a class object for (int n = 0; n < ow.length; n++) { developers[n] = ow.developer[n][2]; } This is the Spinner that would spin the array.. final Spinner devl = (Spinner) findViewById(R.id.towner); devl.setOnItemSelectedListener(managetasks.this); ArrayAdapter<String> b = new ArrayAdapter<String>getApplicationContext(), android.R.layout.simple_spinner_item,developers); b.setDropDownViewResource(android.R.layout.simple_dropdown_item_1line); devl.setAdapter(b);

    Read the article

  • closing MQ connection

    - by OakvilleWork
    Good afternoon, I wrote a project to Get Park Queue Info from the IBM MQ, it has producing an error when attempting to close the connection though. It is written in java. Under application in Event Viewer on the MQ machine it displays two errors. They are: “Channel program ended abnormally. Channel program ‘system.def.surconn’ ended abnormally. Look at previous error messages for channel program ‘system.def.surconn’ in the error files to determine the cause of the failure. The other message states: “Error on receive from host rnanaj (10.10.12.34) An error occurred receiving data from rnanaj (10.10.12.34) over tcp/ip. This may be due to a communications failure. The return code from tcp/ip recv() call was 10054 (X’2746’). Record these values.” This must be something how I try to connect or close the connection, below I have my code to connect and close, any ideas?? Connect: _logger.info("Start"); File outputFile = new File(System.getProperty("PROJECT_HOME"), "run/" + this.getClass().getSimpleName() + "." + System.getProperty("qmgr") + ".txt"); FileUtils.mkdirs(outputFile.getParentFile()); Connection jmsConn = null; Session jmsSession = null; QueueBrowser queueBrowser = null; BufferedWriter commandsBw = null; try { // get queue connection MQConnectionFactory MQConn = new MQConnectionFactory(); MQConn.setHostName(System.getProperty("host")); MQConn.setPort(Integer.valueOf(System.getProperty("port"))); MQConn.setQueueManager(System.getProperty("qmgr")); MQConn.setChannel("SYSTEM.DEF.SVRCONN"); MQConn.setTransportType(JMSC.MQJMS_TP_CLIENT_MQ_TCPIP); jmsConn = (Connection) MQConn.createConnection(); jmsSession = jmsConn.createSession(false, Session.AUTO_ACKNOWLEDGE); Queue jmsQueue = jmsSession.createQueue("PARK"); // browse thru messages queueBrowser = jmsSession.createBrowser(jmsQueue); Enumeration msgEnum = queueBrowser.getEnumeration(); commandsBw = new BufferedWriter(new FileWriter(outputFile)); // String line = "DateTime\tMsgID\tOrigMsgID\tCorrelationID\tComputerName\tSubsystem\tDispatcherName\tProcessor\tJobID\tErrorMsg"; commandsBw.write(line); commandsBw.newLine(); while (msgEnum.hasMoreElements()) { Message message = (Message) msgEnum.nextElement(); line = dateFormatter.format(new Date(message.getJMSTimestamp())) + "\t" + message.getJMSMessageID() + "\t" + message.getStringProperty("pkd_orig_jms_msg_id") + "\t" + message.getJMSCorrelationID() + "\t" + message.getStringProperty("pkd_computer_name") + "\t" + message.getStringProperty("pkd_subsystem") + "\t" + message.getStringProperty("pkd_dispatcher_name") + "\t" + message.getStringProperty("pkd_processor") + "\t" + message.getStringProperty("pkd_job_id") + "\t" + message.getStringProperty("pkd_sysex_msg"); _logger.info(line); commandsBw.write(line); commandsBw.newLine(); } } Close: finally { IO.close(commandsBw); if (queueBrowser != null) { try { queueBrowser.close();} catch (Exception ignore) {}} if (jmsSession != null) { try { jmsSession.close();} catch (Exception ignore) {}} if (jmsConn != null) { try { jmsConn.stop();} catch (Exception ignore) {}} }

    Read the article

< Previous Page | 561 562 563 564 565 566 567 568 569 570 571 572  | Next Page >