Search Results

Search found 23316 results on 933 pages for 'content generation'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 571/933 | < Previous Page | 567 568 569 570 571 572 573 574 575 576 577 578  | Next Page >

  • Flex graph printing

    - by vanzylv
    Hi Guys I'm looking for a way to print / save flex graphs, preferably without changing the flex code.Is this possible to to from the client with some kind of JavaScript library.If I need to change the flex,is ALIVEPDF the way to go (converting content to pdf first) or are there simpler solutions to this. Thanks

    Read the article

  • How do I do a cross domain GET of an XML feed in a WordPress plugin?

    - by MM.
    I would like to use AJAX to display dynamic content via my wordpress plugin. The data source is an xml feed from a remote domain (not owned by me). I have tried using JQuery plugins that use YQL to do cross domain Ajax calls; however, they are geared towards json and tend to return the data to me in a mangled state. My question is, is there a way of obtaining an xml feed using ajax from a remote domain?

    Read the article

  • query on custom field via webservice

    - by Roberto Parrotto
    I customized the content of Defect in my Rally workspace adding a new custom field. This custom field is of type string, its name is CustomTest and its display name is CustomAttribute. I added the value "test" on a defect, but I can't create a working query on that custom field (I'm developing in Java and using the ws api for rally). the query I tried are String query8 = "(CustomAttribute = \"test\")"; String query9 = "(CustomAttribute = \"test\")";

    Read the article

  • domain name vs ip address, same server, but different speed

    - by bn
    I have two similar sites: - two of them have almost exactly the same codes, and running on the same server - both sites are the same, they just use different language. - database of the slower site is populated (maybe only the user table) the other tables for site content is the same - the faster uses root to access database one of the sites is not released yet, so it uses IP Address to access the site instead of domain name the site that is using IP address is faster (lot faster) the site that is using domain name is slower do you know why is this happening what could be the reason?

    Read the article

  • How do you hide an image tag based on an ajax response?

    - by Chris
    What is the correct jquery statement to replace the "//Needed magic" comments below so that the image tags are hidden or unhidden based on the AJAX responses? <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <title>JQuery</title> <style type="text/css"> .isSolvedImage{ width: 68px; height: 47px; border: 1px solid red; cursor: pointer; } </style> <script src="_js/jquery-1.4.2.min.js" type="text/javascript"> </script> </head> <body> <div id='true1.txt' class='isSolvedImage'> <img src="_images/solved.png"> </div> <div id='false1.txt' class='isSolvedImage'> <img src="_images/solved.png"> </div> <div id='true2.txt' class='isSolvedImage'> <img src="_images/solved.png"> </div> <div id='false2.txt' class='isSolvedImage'> <img src="_images/solved.png"> </div> <script type="text/javascript"> $(function(){ var getDivs = 0; //iterate div with class isSolvedImage $("div.isSolvedImage").each(function() { alert('div id--'+this.id); // send ajax requrest $.get(this.id, function(data) { // check if ajax response is 1 alert('div id--'+this.url+'--ajax response--'+data); if(data == 1){ alert('div id--'+this.url+'--Unhiding image--'); //Needed magic //Show image if data==1 } else{ alert('div id--'+this.url+'--Hiding image--'); //Needed magic //Hide image if data!=1 } }); }); }); </script> </body> </html>

    Read the article

  • SimpleModal Strange ASP.NET Button problem

    - by bhsstudio
    Hi I have the following codes $('#<%= btnOpen.ClientID %>').click(function() { $('#content').modal(); }); <asp:Button ID="btnOpen" runat="server" Text="Open" /> When I click on the button, the modal window will appear for about 0.5 second and disappear right away.Can anyone help me please? Thanks a lot!

    Read the article

  • Fill all avaible space.

    - by Neir0
    Hi! I have a xaml code: <Grid> <WrapPanel> <TextBox ></TextBox> <Button Content="GetIt" /> </WrapPanel> </Grid> How i can to get all avaible space for textBox? i want to do something like that: |[__________][GetIt]|

    Read the article

  • How to retrieve an input's value without the browser interpreting html special entities?

    - by CaptainQwyx
    Is there a way in JavaScript or MooTools to retrieve the actual text in the value from an input element without the browser interpreting any html special entites? Please see the example included below. My desired outcome is: <div id="output"> <p>Your text is: <b>[&lt;script&gt;alert('scrubbed');&lt;/script&gt;]</b></p> </div> Note that it works if I type/copy &lt;script&gt;alert('scrubbed');&lt;/script&gt; directly into the text input box, but fails if I insert right after loading the page. <html> <head> <meta http-equiv="Content-type" content="text/html; charset=utf-8"> <title>scrubtest</title> </head> <body id="scrubtest" onload=""> <script type="text/javascript" language="JavaScript" src="/js/mootools-core.js"></script> <input type="text" name="scrubtext" value="&lt;script&gt;alert('scrubbed');&lt;/script&gt;" id="scrubtext"/><br /> <input type="button" value="Insert" onclick="insertText();"/><br /> <input type="button" value="Get via MooTools" onclick="alert($('scrubtext').get('value'));"/><br /> <input type="button" value="Get via JavaScript" onclick="alert(document.getElementById('scrubtext').value);"/><br /> <div id="output"> </div> <script type="text/javascript" charset="utf-8"> function insertText() { var stext = $('scrubtext').get('value'); var result = new Element( 'p', {html: "Your text is: <b>["+stext+"]</b>"} ); result.inject($('output')); } </script> </body> </html>

    Read the article

  • How to get structure of a Google Protobuf message without the definition

    - by dqminh
    I have to get the message structure of a protobuf message transfered to me without the message's definition. Using UnknownFieldSet methods, I was able to get a string representation of the message as below: 1: "a" 2: { 3:"b" 4:"c" } What data structure does field 2 represent ? Using UnknownFieldSet.Field.getGroupList i was able to get the content of field 3 and 4, does that means field 2 has the "deprecated" group structure ?

    Read the article

  • Get main article image with PHP

    - by PaulAdamDavis
    Hello! I'd like to get the main image for an article, much like Facebook does when you post a link (but without the choosing image part). The data we have to work with is the whole pages HTML as a variable. The page & URL will be different for every time this function runs. Are there any libraries or classes that are particularly good at getting the main body of content, much like Instapaper that would be of any help?

    Read the article

  • Why does this vertical-align:middle fails in Jquery mobile

    - by SJ GJ
    Am trying to middle a set of icons to the middle of screen, below is the code: <div data-role="content" class="ui-content ui-body-a" style="vertical-align: middle" data-theme="a"> <fieldset class="ui-grid-a icon-set" style="vertical-align: middle" data-theme="b"> <div class="ui-block-a center" style="vertical-align: middle"> <a href="test"> <div> <img src="css/images/test5.png" style="width: 80px;height: 80px"/> </div> <div> Login </div> </a> </div> <div class="ui-block-b center"> <a href="#settings" data-transition='slide'> <div> <img src="css/images/test4.png" style="width: 80px;height: 80px"/></div> <div>Settings</div> </a> </div> <div class="ui-block-a center"> <a href="test"> <div> <img src="css/images/test2.png" style="width: 80px;height: 80px"/></div> <div>Aboutus</div> </a> </div> <div class="ui-block-b center"> <a href="test"> <div> <img src="css/images/test1.png" style="width: 80px;height: 80px"/></div> <div>Contact Us</div> </a> </div> </fieldset> </div>

    Read the article

  • jQuery equivalent of PHP's file_exists()?

    - by Scott B
    In the code snippet below, from my jQuery setup, I need to check if the image file actually exists and if not, I'd like to substitute a default image. Currently if the file does not exist, I just get a broken image placeholder... $('#myTheme').change ( function() { var myImage = $('#myTheme :selected').text(); $('.selectedImage img').attr('src','../wp-content/themes/myTheme/styles/'+myImage+'/screenshot.jpg'); //if screenshot.jpg does not exist, use "../../default.jpg" instead } );

    Read the article

  • ipad saving excel sheet opened in uiwebview

    - by satyam
    I've few excel sheets and i want to distribut them along with ap. I want to create an application that open those excel sheets, allow user to modify the content and save the excel sheet as new file. For that purpose, I think I can open excel sheets in UIWebView that allows editing as well. But the trouble is, can I save edited Excel sheet in UIWebView back on to iPad? If Possible, how?

    Read the article

  • Unstructured database design

    - by Linh
    Hi all, According to normal way, we design the table with fields. Example with an article the table can contain fields as follows: title, content, author..... But how does everybody think if we add up some fields to a field?

    Read the article

  • Why does one column seem to load first in Wordpress?

    - by Cynthia
    I have a Wordpress site that is doing something very bizarre. If you go to: http://digitaldemo.net/joy/krippen-a-b-c/ When it loads, the main content div loads on the right hand side of the page and then once the sidebar loads, THEN it gets pushed over to where it ought to be. It's only really noticable in Firefox, but I'd like to find out what is causing it and fix the issue. Any ideas? Many thanks!

    Read the article

  • How can I create an http response from scratch?

    - by ispiro
    I have code that returns an http response, but it also includes the content of the page. How can I create a response from scratch so it won't include anything except what I put in it? My code now: GCheckout.AutoGen.NotificationAcknowledgment response = new GCheckout.AutoGen.NotificationAcknowledgment(); response.serialnumber = serialNumber; HttpContext.Current.Response.Clear(); HttpContext.Current.Response.BinaryWrite(GCheckout.Util.EncodeHelper.Serialize(response)); HttpContext.Current.Response.StatusCode = 200;

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • Long task in Javascript / jQuery

    - by Misha Moroshko
    I have a long task in Javascript that should be performed before the web page content is displayed. During the execution of this task I would like to show an image whose opacity will grow up to 100% (when the task is done). How this can be achieved ?

    Read the article

  • Java writes bad wave files

    - by Cliff
    I'm writing out wave files in Java using AudioInputStream output = new AudioInputStream(new ByteArrayInputStream(rawPCMSamples), new AudioFormat(22000,16,1,true,false), rawPCMSamples.length) AudioSystem.write(output, AudioFileFormat.Type.WAVE, new FileOutputStream('somefile.wav')) And I get what appears to be corrupt wave files on OSX. They won't play from Finder however using the same code behind a servlet writing directly to the response stream and setting the Content-Type to audio/wave seems to play fine in quicktime. What gives?

    Read the article

  • Include code file into C#? Create library for others?

    - by Tomas
    Hi, I would like to know how can I embedd a code source file (if possible), something like that: class X { include "ClassXsource" } My second question - Can I build DLL or something like that for my colleagues to use? I need them to be able to call methods from my "part" but do not modify or view their content. Basically just use namespace "MyNamespace" and call its methods, but I have never done anything like that. Thanks

    Read the article

  • Free ASP.Net (MVC/WebForms) based CMS which has plugins built in for connecting to Orkut and Faceboo

    - by SharePoint Newbie
    I looking for free ASP.NET based content management system (CMS) which has the following features: Blogs (Admin, some super users can have their own blogs) Forums (Admins can create forums. Some moderation features) Admin Dashboard Integration with LinkedIn, Orkut and Facebook (native or through freely available add-ons) Support for moderated user registration (moderated by Admin) Windows Sharepoint services 3.0 is an option. With some tweaking, it supports all the above and there are free third party web parts available. NB: The CMS listed must be free, as in beer.

    Read the article

  • Mod_rewrite on all website images

    - by Esteve Camps
    I'm designing an image repository. I want to uncouple the filename from the image html link. For instance: image in filesystem is called images/items/12543.jpg HTML is <img src="images/car.jpg" /> Does anyone strongly discourages me to rewrite all image requests using PHP so when retrieving images/car.jpg, Apache really replies content from images/items/12543.jpg? I don't know if I may get performance problems.

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 567 568 569 570 571 572 573 574 575 576 577 578  | Next Page >