Search Results

Search found 45324 results on 1813 pages for 'open source'.

Page 591/1813 | < Previous Page | 587 588 589 590 591 592 593 594 595 596 597 598  | Next Page >

  • VB.net httpwebrequest For loop hangs every 10 or so iterations

    - by user574632
    Hello, I am trying to loop through an array and perform an httpwebrequest in each iteration. The code seems to work, however it pauses for a while (eg alot longer than the set timeout. Tried setting that to 100 to check and it still pauses) after every 10 or so iterations, then carries on working. Here is what i have so far: For i As Integer = 0 To numberOfProxies - 1 Try 'create request to a proxyJudge php page using proxy Dim request As HttpWebRequest = HttpWebRequest.Create("http://www.pr0.net/deny/azenv.php") request.Proxy = New Net.WebProxy(proxies(i)) 'select the current proxie from the proxies array request.Timeout = 10000 'set timeout Dim response As HttpWebResponse = request.GetResponse() Dim sr As StreamReader = New StreamReader(response.GetResponseStream()) Dim pageSourceCode As String = sr.ReadToEnd() 'check the downloaded source for certain phrases, each identifies a type of proxy 'HTTP_X_FORWARDED_FOR identifies a transparent proxy If pageSourceCode.Contains("HTTP_X_FORWARDED_FOR") Then 'delegate method for cross thread safe UpdateListbox(ListBox3, proxies(i)) ElseIf pageSourceCode.Contains("HTTP_VIA") Then UpdateListbox(ListBox2, proxies(i)) Else UpdateListbox(ListBox1, proxies(i)) End If Catch ex As Exception 'MessageBox.Show(ex.ToString) used in testing UpdateListbox(ListBox4, proxies(i)) End Try completedProxyCheck += 1 lblTotalProxiesChecked.CustomInvoke(Sub(l) l.Text = completedProxyCheck) Next I have searched all over this site and via google, and most responses to this type of question say the response must be closed. I have tried a using block, eg: Using response As HttpWebResponse = request.GetResponse() Using sr As StreamReader = New StreamReader(response.GetResponseStream()) Dim pageSourceCode As String = sr.ReadToEnd() 'check the downloaded source for certain phrases, each identifies a type of proxy 'HTTP_X_FORWARDED_FOR identifies a transparent proxy If pageSourceCode.Contains("HTTP_X_FORWARDED_FOR") Then 'delegate method for cross thread safe UpdateListbox(ListBox3, proxies(i)) ElseIf pageSourceCode.Contains("HTTP_VIA") Then UpdateListbox(ListBox2, proxies(i)) Else UpdateListbox(ListBox1, proxies(i)) End If End Using End Using And it makes no difference (though i may have implemented it wrong) As you can tell im very new to VB or any OOP so its probably a simple problem but i cant work it out. Any suggestions or just tips on how to diagnose these types of problems would be really appreciated.

    Read the article

  • IE 8 dialog windows not decompressing files

    - by Mike
    Hi, I've got a website where we have pre-compressed all of our HTML files. In general this works fine, but since IE 8 has come out some people are finding that they can not use some parts of the website. We've used the showModalDialog command to open a dialog window and pointing to one of our pre-compressed files but it displays it just show up as strange characters (ie not decompressed). Now it only happens in the dialog. I'm pretty sure our compression is all fine because the page they are viewing to open the dialog is also compressed. Has anyone else come across this or got any suggestions cuz i'm stumped??? Thanks, Mike

    Read the article

  • Create an assembly in memory

    - by Jared I
    I'd like to create an assembly in memory, using an using the classes in Reflection.Emit Currently, I can create the assembly and get it's bytes using something like AssemblyBuilder builder = AppDomain.CurrentDomain.DefineDynamicAssembly(..., AssemblyBuilderAccess.Save); ... create the assembly ... builder.Save(targetFileName); using(FileStream fs = File.Open(targetFileName, FileMode.Open)) { ... read the bytes from the file stream ... } However, it does so by creating a file on the local filesystem. I don't actually need the file, just the bytes that would be in the file. Is it possible to create the assembly without writing any files?

    Read the article

  • Python character count

    - by user74283
    I have been going over python tutorials in this resource. Everything is pretty clear in the below code which counts number of characters. Only section that i dont understand is the section where count assigned to a list and multiplied by 120. Can anyone explain what is the purpose of this in plain english please. def display(i): if i == 10: return 'LF' if i == 13: return 'CR' if i == 32: return 'SPACE' return chr(i) infile = open('alice_in_wonderland.txt', 'r') text = infile.read() infile.close() counts = 128 * [0] for letter in text: counts[ord(letter)] += 1 outfile = open('alice_counts.dat', 'w') outfile.write("%-12s%s\n" % ("Character", "Count")) outfile.write("=================\n") for i in range(len(counts)): if counts[i]: outfile.write("%-12s%d\n" % (display(i), counts[i])) outfile.close()

    Read the article

  • If I select from an IQueryable then the Include is lost

    - by Connor Murphy
    The include does not work after I perform a select on the IQueryable query. Is there a way arround this? My query is public IQueryable<Network> GetAllNetworks() { var query = (from n in _db.NetworkSet .Include("NetworkContacts.Contact") .Include("NetworkContacts.Contact.RelationshipSource.Target") .Include("NetworkContacts.Contact.RelationshipSource.Source") select (n)); return query;; } I then try to populate mya ViewModel in my WebUI layer using the following code var projectedNetworks = from n in GetAllNetworks() select new NetworkViewModel { Name = n.Name, Contacts = from contact in networkList .SelectMany(nc => nc.NetworkContacts) .Where(nc => nc.Member == true) .Where(nc => nc.NetworkId == n.ID) .Select(c => c.Contact) select contact, }; return projectedNetworks; The problem now occurs in my newly createdNetworkViewModel The Contacts object does include any loaded data for RelationshipSource.Target or RelationshipSource.Source The data should is there when run from the original Repository IQueryable object. However the related include data does not seem to get transferred into the new Contacts collection that is created from this IQueryable using the Select New {} code above. Is there a way to preserve this Include data when it gets passed into a new object?

    Read the article

  • Retrieving dll version info via Win32 - VerQueryValue(...) crashes under Win7 x64

    - by user256890
    The respected open source .NET wrapper implementation (SharpBITS) of Windows BITS services fails identifying the underlying BITS version under Win7 x64. Here is the source code that fails. NativeMethods are native Win32 calls wrapped by .NET methods and decorated via DllImport attribute. private static BitsVersion GetBitsVersion() { try { string fileName = Path.Combine( System.Environment.SystemDirectory, "qmgr.dll"); int handle = 0; int size = NativeMethods.GetFileVersionInfoSize(fileName, out handle); if (size == 0) return BitsVersion.Bits0_0; byte[] buffer = new byte[size]; if (!NativeMethods.GetFileVersionInfo(fileName, handle, size, buffer)) { return BitsVersion.Bits0_0; } IntPtr subBlock = IntPtr.Zero; uint len = 0; if (!NativeMethods.VerQueryValue(buffer, @"\VarFileInfo\Translation", out subBlock, out len)) { return BitsVersion.Bits0_0; } int block1 = Marshal.ReadInt16(subBlock); int block2 = Marshal.ReadInt16((IntPtr)((int)subBlock + 2 )); string spv = string.Format( @"\StringFileInfo\{0:X4}{1:X4}\ProductVersion", block1, block2); string versionInfo; if (!NativeMethods.VerQueryValue(buffer, spv, out versionInfo, out len)) { return BitsVersion.Bits0_0; } ... The implementation follows the MSDN instructions by the letter. Still during the second VerQueryValue(...) call, the application crashes and kills the debug session without hesitation. Just a little more debug info right before the crash: spv = "\StringFileInfo\040904B0\ProductVersion" buffer = byte[1900] - full with binary data block1 = 1033 block2 = 1200 I looked at the targeted "C:\Windows\System32\qmgr.dll" file (The implementation of BITS) via Windows. It says that the Product Version is 7.5.7600.16385. Instead of crashing, this value should return in the verionInfo string. Any advice?

    Read the article

  • Better way to call superclass method in ExtJS

    - by Rene Saarsoo
    All the ExtJS documentation and examples I have read suggest calling superclass methods like this: MyApp.MyPanel = Ext.extend(Ext.Panel, { initComponent: function() { // do something MyPanel specific here... MyApp.MyPanel.superclass.initComponent.call(this); } }); I have been using this pattern for quite some time and the main problem is, that when you rename your class then you also have to change all the calls to superclass methods. That's quite inconvenient, often I will forget and then I have to track down strange errors. But reading the source of Ext.extend() I discovered, that instead I could use the superclass() or super() methods that Ext.extend() adds to the prototype: MyApp.MyPanel = Ext.extend(Ext.Panel, { initComponent: function() { // do something MyPanel specific here... this.superclass().initComponent.call(this); } }); In this code renaming MyPanel to something else is simple - I just have to change the one line. But I have doubts... I haven't seen this documented anywhere and the old wisdom says, I shouldn't rely on undocumented behaviour. I didn't found a single use of these superclass() and supr() methods in ExtJS source code. Why create them when you aren't going to use them? Maybe these methods were used in some older version of ExtJS but are deprecated now? But it seems such a useful feature, why would you deprecate it? So, should I use these methods or not?

    Read the article

  • slow SQL command

    - by Retrocoder
    I need to take some data from one table (and expand some XML on the way) and put it in another table. As the source table can have thousands or records which caused a timeout I decided to do it in batches of 100 records. The code is run on a schedule so doing it in batches works ok for the customer. If I have say 200 records in the source database the sproc runs very fast but if there are thousands it takes several minutes. I'm guessing that the "TOP 100" only takes the top 100 after it has gone through all the records. I need to change the whole code and sproc at some point as it doesn't scale but for now is there a quick fix to make this run quicker ? INSERT INTO [deviceManager].[TransactionLogStores] SELECT TOP 100 [EventId], [message].value('(/interface/mac)[1]', 'nvarchar(100)') AS mac, [message].value('(/interface/device) [1]', 'nvarchar(100)') AS device_type, [message].value('(/interface/id) [1]', 'nvarchar(100)') AS device_id, [message].value('substring(string((/interface/id)[1]), 1, 6)', 'nvarchar(100)') AS store_id, [message].value('(/interface/terminal/unit)[1]', 'nvarchar(100)') AS unit, [message].value('(/interface/terminal/trans/event)[1]', 'nvarchar(100)') AS event_id, [message].value('(/interface/terminal/trans/data)[1]', 'nvarchar(100)') AS event_data, [message].value('substring(string((/interface/terminal/trans/data)[1]), 9, 11)', 'nvarchar(100)') AS badge, [message].value('(/interface/terminal/trans/time)[1]', 'nvarchar(100)') AS terminal_time, MessageRecievedAt_UTC AS db_time FROM [deviceManager].[TransactionLog] WHERE EventId > @EventId --WHERE MessageRecievedAt_UTC > @StartTime AND MessageRecievedAt_UTC < @EndTime ORDER BY terminal_time DESC

    Read the article

  • SharePoint 2010 is forcing me to safe PDF when opening from doc library

    - by Tobias Funke
    I have a document library with a PDF file. Whenever I click on the PDF file, I am prompted to save the file. I do not get the option of opening the file, I am forced to save it. What I want is for the PDF file to open, either in the browser or in a separate Adobe Reader window, depending on the Adobe Reader settings. I'm pretty sure SharePoint is responsible for this behavior, because if I put the PDF on my hard drive, then create a HTML file with a link to the file, it opens in the browser when I click on it. Please note: I looked at this question and did not help. I don't care if the PDF opens in the browser or in a separate Adobe Reader window, I just want it to open.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • An unhandled exception of type 'System.StackOverflowException' occurred in mscorlib.dll

    - by Sahar
    Hello everybody i wrote a code in asp.net that read data from files and draw a graph. It worked but after awhile when i run the program, this exception arise "An unhandled exception of type 'System.StackOverflowException' occurred in mscorlib.dll" in this statement in the code: if (File.Exists(fName)) <----(here is the exception) { stream = File.Open(fName, FileMode.Open); g_day = Deserialize(stream); stream.Close(); int cn = 0; if (g_day.Values.Count != 0) cn = g_day.Values[g_day.Values.Count - 1].Value; Label1.Text = cn.ToString(); } can u help me

    Read the article

  • How can I load a file into a DataBag from within a Yahoo PigLatin UDF?

    - by Cervo
    I have a Pig program where I am trying to compute the minimum center between two bags. In order for it to work, I found I need to COGROUP the bags into a single dataset. The entire operation takes a long time. I want to either open one of the bags from disk within the UDF, or to be able to pass another relation into the UDF without needing to COGROUP...... Code: # **** Load files for iteration **** register myudfs.jar; wordcounts = LOAD 'input/wordcounts.txt' USING PigStorage('\t') AS (PatentNumber:chararray, word:chararray, frequency:double); centerassignments = load 'input/centerassignments/part-*' USING PigStorage('\t') AS (PatentNumber: chararray, oldCenter: chararray, newCenter: chararray); kcenters = LOAD 'input/kcenters/part-*' USING PigStorage('\t') AS (CenterID:chararray, word:chararray, frequency:double); kcentersa1 = CROSS centerassignments, kcenters; kcentersa = FOREACH kcentersa1 GENERATE centerassignments::PatentNumber as PatentNumber, kcenters::CenterID as CenterID, kcenters::word as word, kcenters::frequency as frequency; #***** Assign to nearest k-mean ******* assignpre1 = COGROUP wordcounts by PatentNumber, kcentersa by PatentNumber; assignwork2 = FOREACH assignpre1 GENERATE group as PatentNumber, myudfs.kmeans(wordcounts, kcentersa) as CenterID; basically my issue is that for each patent I need to pass the sub relations (wordcounts, kcenters). In order to do this, I do a cross and then a COGROUP by PatentNumber in order to get the set PatentNumber, {wordcounts}, {kcenters}. If I could figure a way to pass a relation or open up the centers from within the UDF, then I could just GROUP wordcounts by PatentNumber and run myudfs.kmeans(wordcount) which is hopefully much faster without the CROSS/COGROUP. This is an expensive operation. Currently this takes about 20 minutes and appears to tack the CPU/RAM. I was thinking it might be more efficient without the CROSS. I'm not sure it will be faster, so I'd like to experiment. Anyway it looks like calling the Loading functions from within Pig needs a PigContext object which I don't get from an evalfunc. And to use the hadoop file system, I need some initial objects as well, which I don't see how to get. So my question is how can I open a file from the hadoop file system from within a PIG UDF? I also run the UDF via main for debugging. So I need to load from the normal filesystem when in debug mode. Another better idea would be if there was a way to pass a relation into a UDF without needing to CROSS/COGROUP. This would be ideal, particularly if the relation resides in memory.. ie being able to do myudfs.kmeans(wordcounts, kcenters) without needing the CROSS/COGROUP with kcenters... But the basic idea is to trade IO for RAM/CPU cycles. Anyway any help will be much appreciated, the PIG UDFs aren't super well documented beyond the most simple ones, even in the UDF manual.

    Read the article

  • Overlay SVG diagrams on google maps

    - by ThibThib
    Hello I would like to add an overlay image on a google map. This image is a SVG file I have generated (python with svgfig). I am using the following code if (GBrowserIsCompatible()) { var map = new GMap2(document.getElementById("map_canvas")); map.setCenter(new GLatLng(48.8, 2.4), 12);     // ground overlay     var boundaries = new GLatLngBounds(new GLatLng(48.283188032632829, 1.9675270369830129), new GLatLng(49.187215000000002, 2.7771877478303999));     var oldmap = new GGroundOverlay("test.svg", boundaries); map.addControl(new GSmallMapControl()); map.addControl(new GMapTypeControl()); map.addOverlay(oldmap); } Surprisingly, it works with Safari 4, but it doesn't with Firefox (with Safari 3, the background is not transparent) Does anyone has an idea on how I could overlay a SVG ? Thanks PS1: I read some works like this or the source code of swa.ethz.ch/googlemaps, but it seems that they have to use javascript code to parse the SVG and add one by one all the elements (but I did not understood all the source...) PS2: The SVG is composed of different filled paths and circles, with transparency. If there is no solution to overlay my SVG, I can use 2 alternative solutions: rasterize the SVG convert the paths and circles in GPolygons But, I do not really like the 1st solution because of the poor quality of the bitmap and the time to generate it with antialiasing. And for the 2nd solutions, the arcs, ellipses and circles will have to be decomposed into small polylines. A lot of them will be necessary for a good result. But I have around 3000 arcs and circles to draw, so...

    Read the article

  • DesignTime data not showing in Blend when bound against CollectionViewSource

    - by bitbonk
    I have datatemplate for a viewmodel where an itemscontrol is bound again a CollectionViewSource (to enable sorting in xaml). <DataTemplate x:Key="equipmentDataTemplate"> <Viewbox> <Viewbox.Resources> <CollectionViewSource x:Key="viewSource" Source="{Binding Modules}"> <CollectionViewSource.SortDescriptions> <scm:SortDescription PropertyName="ID" Direction="Ascending"/> </CollectionViewSource.SortDescriptions> </CollectionViewSource> </Viewbox.Resources> <ItemsControl ItemsSource="{Binding Source={StaticResource viewSource}}" Height="{DynamicResource equipmentHeight}" ItemTemplate="{StaticResource moduleDataTemplate}"> <ItemsControl.ItemsPanel> <ItemsPanelTemplate> <StackPanel Orientation="Horizontal" /> </ItemsPanelTemplate> </ItemsControl.ItemsPanel> </ItemsControl> </Viewbox> </DataTemplate> I have also setup the UserControl where all of this is defined to provide designtime data d:DataContext="{x:Static vm:DesignTimeHelper.Equipment}"> This is basically a static property that gives me an EquipmentViewModel that has a list of ModuleViewModels (Equipment.Modules). Now as long as I bind to the CollectionViewSource the designtime data does not show up in blend 3. When I bind to the ViewModel collection directly <ItemsControl ItemsSource="{Binding Modules}" I can see the designtime data. Any idea what I could do?

    Read the article

  • A doubt on DOM parser used with Python

    - by fixxxer
    I'm using the following python code to search for a node in an XML file and changing the value of an attribute of one of it's children.Changes are happening correctly when the node is displayed using toxml().But, when it is written to a file, the attributes rearrange themselves(as seen in the Source and the Final XML below). Could anyone explain how and why this happen? Python code: #!/usr/bin/env python import xml from xml.dom.minidom import parse dom=parse("max.xml") #print "Please enter the store name:" for sku in dom.getElementsByTagName("node"): if sku.getAttribute("name") == "store": sku.childNodes[1].childNodes[5].setAttribute("value","Delhi,India") print sku.toxml() xml.dom.ext.PrettyPrint(dom, open("new.xml", "w")) a part of the Source XML: <node name='store' node_id='515' module='mpx.lib.node.simple_value.SimpleValue' config_builder='' inherant='false' description='Configurable Value'> <match> <property name='1' value='point'/> <property name='2' value='0'/> <property name='val' value='Store# 09204 Staten Island, NY'/> <property name='3' value='str'/> </match> </node> Final XML : <node config_builder="" description="Configurable Value" inherant="false" module="mpx.lib.node.simple_value.SimpleValue" name="store" node_id="515"> <match> <property name="1" value="point"/> <property name="2" value="0"/> <property name="val" value="Delhi,India"/> <property name="3" value="str"/> </match> </node>

    Read the article

  • Upload and parse csv file with "universal newline" in python on Google App Engine

    - by greg
    Hi, I'm uploading a csv/tsv file from a form in GAE, and I try to parse the file with python csv module. Like describe here, uploaded files in GAE are strings. So I treat my uploaded string a file-like object : file = self.request.get('catalog') catalog = csv.reader(StringIO.StringIO(file),dialect=csv.excel_tab) But new lines in my files are not necessarily '\n' (thanks to excel..), and it generated an error : Error: new-line character seen in unquoted field - do you need to open the file in universal-newline mode? Does anyone know how to use StringIO.StringIO to treat strings like files open in universal-newline?

    Read the article

  • Maven compile plugin

    - by phanikiran
    Hi every body, in pom of a project, i have added dependency with scope compile . which is a jar file which contains some class file and jar's as well. my current java file needs internal jars of dependent jar to compile. But maven compile goal returning compilation error . :banghead: All the jar's needed to compile are in the single jar file which is added in dependency............................. Please help me! my pom: <dependency> <groupId>eagle</groupId> <artifactId>zkui</artifactId> <version>360LTS</version> <type>jar</type> <scope>compile</scope> </dependency> <build> <sourceDirectory>./src/main/java/</sourceDirectory> <outputDirectory>./target/classes/</outputDirectory> <finalName>${project.groupId}-${project.artifactId}</finalName> <plugins> <plugin> <groupId>org.apache.maven.plugins</groupId> <artifactId>maven-compiler-plugin</artifactId> <version>2.2</version> <configuration> <source>1.6</source> <target>1.6</target> </plugin> </plugins> </build> </project> error: package org.zkoss.zk.ui does not exist this package org.zkoss.zk.ui is in jar file zkex.jar which is in dependency jar eagle:zkui:360LTS jar file Please Help ME!!!! :jumpingjoy: Advance Thanks

    Read the article

  • post data to a thickbox using ajax

    - by sqlchild
    I need to post data to a thickbox using ajax and open it immediately and display the posted data. The user would click on a link/button and the data i.e. value of the selected checkboxes would be posted to "my_thickbox.php" and the thickbox (url : my_thickbox.php) would open with checkbox values displayed. <div id="showthickbox" ><a href="my_thickbox.php" class="thickbox"></div> $('#showthickbox').click(function() { var data = $('input:checkbox:checked').map(function() { return this.value; }).get(); $.ajax({ type: 'POST', url: 'my_thickbox.php', data: data, success: success, dataType: dataType }); });

    Read the article

  • Castle Active Record - Working with the cache

    - by David
    Hi All, im new to the Castle Active Record Pattern and Im trying to get my head around how to effectivley use cache. So what im trying to do (or want to do) is when calling the GetAll, find out if I have called it before and check the cache, else load it, but I also want to pass a bool paramter that will force the cache to clear and requery the db. So Im just looking for the final bits. thanks public static List<Model.Resource> GetAll(bool forceReload) { List<Model.Resource> resources = new List<Model.Resource>(); //Request to force reload if (forceReload) { //need to specify to force a reload (how?) XmlConfigurationSource source = new XmlConfigurationSource("appconfig.xml"); ActiveRecordStarter.Initialize(source, typeof(Model.Resource)); resources = Model.Resource.FindAll().ToList(); } else { //Check the cache somehow and return the cache? } return resources; } public static List<Model.Resource> GetAll() { return GetAll(false); }

    Read the article

  • Copy SQL Server data from one server to another on a schedule

    - by rwmnau
    I have a pair of SQL Servers at different webhosts, and I'm looking for a way to periodically update the one server using the other. Here's what I'm looking for: As automated as possible - ideally, without any involvement on my part once it's set up. Pushes a number of databases, in their entirely (including any schema changes) from one server to the other Freely allows changes on the source server without breaking my process. For this reason, I don't want to use replication, as I'd have to break it every time there's an update on the source, and then recreate the publication and subscription One database is about 4GB in size and contains binary data. I'm not sure if there's a way to export this to a script, but it would be a mammoth file if I did. Originally, I was thinking of writing something that takes a scheduled full backup of each database, FTPs the backups from one server to the other once they're done, and then the new server picks it up and restores it. The only downside I can see to this is that there's no way to know that the backups are done before starting to transfer them - can these backups be done synchronously? Also, the server being refreshes is our test server, so if there's some downtime involved in moving the data, that's fine. Does anybody out there have a better idea, or is what I'm currently considering the best non-replication way to go? Thanks for your help, everybody. UPDATE: I ended up designing a custom solution to get this done using BAT files, 7Zip,command line FTP, and OSQL, so it runs in a completely automatic way and aggregates the data from a dozen servers across the country. I've detailed the steps in a blog entry. Thanks for all your input!

    Read the article

  • Posting an action works... but no image

    - by Brian Rice
    I'm able to post an open graph action to facebook using the following url: https://graph.facebook.com/me/video.watches with the following post data: video=http://eqnetwork.com/home/video.html?f=8e7b4f27-8cbd-4430-84df-d9ccb46da45f.mp4 It seems to be getting the title from the open graph metatags at the "video" object. But, it's not getting the image (even though one is specified in the metatag "og:image"). Also, if I add this to the post data: picture=http://eqnetwork.com/icons/mgen/overplayThumbnail.ms?drid=14282&subType=ljpg&w=120&h=120&o=1&thumbnail= still no image. Any thoughts? Brian

    Read the article

  • Raw types and subtyping

    - by Dmitrii
    We have generic class SomeClass<T>{ } We can write the line: SomeClass s= new SomeClass<String>(); It's ok, because raw type is supertype for generic type. But SomeClass<String> s= new SomeClass(); is correct to. Why is it correct? I thought that type erasure was before type checking, but it's wrong. From Hacker's Guide to Javac When the Java compiler is invoked with default compile policy it performs the following passes: parse: Reads a set of *.java source files and maps the resulting token sequence into AST-Nodes. enter: Enters symbols for the definitions into the symbol table. process annotations: If Requested, processes annotations found in the specified compilation units. attribute: Attributes the Syntax trees. This step includes name resolution, type checking and constant folding. flow: Performs data ow analysis on the trees from the previous step. This includes checks for assignments and reachability. desugar: Rewrites the AST and translates away some syntactic sugar. generate: Generates Source Files or Class Files. Generic is syntax sugar, hence type erasure invoked at 6 pass, after type checking, which invoked at 4 pass. I'm confused.

    Read the article

  • Help getting MVVM ViewModel to bind to the View

    - by cw
    Okay guys, I'm new to this model and Silverlight in general. I have the following code (changed object names, so syntax/spelling errors ignore). public class ViewModel { ViewModelSource m_vSource; public ViewModel(IViewModelSource source) { m_vSource= source; m_vSource.ItemArrived += new Action<Item>(m_vSource_ItemArrived); } void m_vSource_ItemArrived(Item obj) { Title = obj.Title; Subitems = obj.items; Description = obj.Description; } public void GetFeed(string serviceUrl) { m_vFeedSource.GetFeed(serviceUrl); } public string Title { get; set; } public IEnumerable<Subitems> Subitems { get; set; } public string Description { get; set; } } Here is the code I have in my page's codebehind. ViewModel m_vViewModel; public MainPage() { InitializeComponent(); m_vViewModel = new ViewModel(new ViewModelSource()); this.Loaded += new RoutedEventHandler(MainPage_Loaded); this.DataContext = m_vViewModel; } void MainPage_Loaded(object sender, RoutedEventArgs e) { m_vViewModel.GetItems("http://www.myserviceurl.com"); } Finally, here is a sample of what my xaml looks like. <!--TitleGrid is the name of the application and page title--> <Grid x:Name="TitleGrid" Grid.Row="0"> <TextBlock Text="My Super Title" x:Name="textBlockPageTitle" Style="{StaticResource PhoneTextPageTitle1Style}"/> <TextBlock Text="{Binding Path=Title}" x:Name="textBlockListTitle" Style="{StaticResource PhoneTextPageTitle2Style}"/> </Grid> I know I'm missing something, but I'm just not knowledgable enough which is why I'm asking you guys :) Is there anything I'm doing wrong here? Thanks!

    Read the article

  • ASP.NET membership db using integrated security problem

    - by rem
    I published ASP.NET MVC web site to a server on a virtual machine (Hyper-V). SQL Server Express installed on the same server. The problem is that ASP.Net Membership system doesn't work in integrated mode. When Web.config file contains records as follows: <connectionStrings> <remove name="LocalSqlServer" /> <add name="MyDBConnectionString" connectionString="data source=vm-1\SQLEXPRESS;Initial Catalog=testdb;Integrated Security=SSPI;" providerName="System.Data.SqlClient"/> </connectionStrings> I get an error when trying to register and login to the site. If I change connection string this way: <connectionStrings> <remove name="LocalSqlServer" /> <add name="MyDBConnectionString" connectionString="data source=vm-1\SQLEXPRESS;Initial Catalog=testdb;User ID=XX;Password=XXXXXXX;" providerName="System.Data.SqlClient"/> </connectionStrings> I could register and login without any problem. What could cause the problem with using ASP.NET membership database in integrated security mode?

    Read the article

  • When do you tag your software project?

    - by WilhelmTell of Purple-Magenta
    I realize there are various kinds of software projects: commercial (for John Doe) industrial (for Mr. Montgomery Burns) successful open-source (with audience larger than, say, 10 people) personal projects (with audience size in the vicinity of 1). each of which release a new version of their product on difference conditions. I'm particularly interested in the case of personal projects and open-source projects. When, or under what conditions, do you make a new release of any kind? Do you subscribe to a fixed recurring deadline such as every two weeks? Do you commit to a release of at least 10 minor fixes, or one major fix? Do you combine the two conditions such as at least one condition must hold, or both must hold? I reckon this is a subjective question. I ask this question in light of searching for tricks to keep my projects alive and kicking. Sometimes my projects are active but look as if they aren't because I don't have the confidence to make a release or a tag of any sort for a long time -- in the order of months.

    Read the article

< Previous Page | 587 588 589 590 591 592 593 594 595 596 597 598  | Next Page >