Search Results

Search found 45324 results on 1813 pages for 'open source'.

Page 594/1813 | < Previous Page | 590 591 592 593 594 595 596 597 598 599 600 601  | Next Page >

  • Link to another file in chrome extension

    - by Hintswen
    I want to have a link in the popup.html file for my extension that loads another file (which will be included with the extension) how can I do this? or will I need to keep it in the same page? I tried using this code: <a href="/mail.html"> <img id="newmail_icon" src="" width="16" height="16" /> <span id="newmail">loading</span><br /> </a> But when I click the link nothing happens. I just found out that adding target="_blank" to the link will make it work and open in a new tab, but I can't get it to open in the popup. I have tried target="_self" but it didn't do anything.

    Read the article

  • hibernate c3p0 broken pipe

    - by raven_arkadon
    Hi, I'm using hibernate 3 with c3p0 for a program which constantly extracts data from some source and writes it to a database. Now the problem is, that the database might become unavailable for some reasons (in the simplest case: i simply shut it down). If anything is about to be written to the database there should not be any exception - the query should wait for all eternity until the database becomes available again. If I'm not mistaken this is one of the things the connection pool could do for me: if there is a problem with the db, just retry to connect - in the worst case for infinity. But instead i get a broken pipe exception, sometimes followed by connection refused and then the exception is passed to my own code, which shouldn't happen. Even if I catch the exception, how could i cleanly reinitialize hibernate again? (So far without c3p0 i simply built the session factory again, but i wouldn't be surprised if that could leak connections (or is it ok to do so?)). The database is Virtuoso open source edition. My hibernate.xml.cfg c3p0 config: <property name="hibernate.connection.provider_class">org.hibernate.connection.C3P0ConnectionProvider</property> <property name="hibernate.c3p0.breakAfterAcquireFailure">false</property> <property name="hibernate.c3p0.acquireRetryAttempts">-1</property> <property name="hibernate.c3p0.acquireRetryDelay">30000</property> <property name="hibernate.c3p0.automaticTestTable">my_test_table</property> <property name="hibernate.c3p0.initialPoolSize">3</property> <property name="hibernate.c3p0.minPoolSize">3</property> <property name="hibernate.c3p0.maxPoolSize">10</property> btw: The test table is created and i get tons of debug output- so it seems it actually reads the config.

    Read the article

  • Date Picker Control Not Displaying Proper Date (Access 2003)

    - by JPM
    Hi everyone, I just have a quick question. I am maintaining an app for my summer co-op position, and a new requirement came down today where the user requested to have a date control added to a form to mark the date of when an employee is "laid off". This control is enabled/disabled by a toggle button, and has its control source bound to a field that I added in the database. All the functionality has been added and tested, but.... The issue I am having is that the date picker is on a tab control (the 2nd page) and I am having problems trying to get the control to display the date that is stored in the field I created. I know the control is storing any changes made using it, but since the user asked to move the control over to the 2nd tab (it was on the first), it just shows today's date, not the date entered using the control. To make things a little more strange, if I place the control anywhere except the tab control, it seems to be working fine. I've even placed a textbox on the tab and set its control source to the database field, and it displays just fine. What gives? And I have registered the .ocx with Access, and as I mentioned before, the actual database is storing the data. Just not displaying it. Any ideas as to what I am doing wrong?

    Read the article

  • Excel macro send rich mail using LotusNotes

    - by CC
    Hi everybody. I'm working on a small macro to send mail from excel 2007 using my Lotus Notes session. The sending mail part is working fine. Now I need to send in the body part, a part of a stylesheet (for instance the area from A1:B20). This area has colors, bold font. To send my email here is the code: Set oSess = CreateObject("Notes.NotesSession") Set oDB = oSess.GETDATABASE("", "") Call oDB.OPENMAIL flag = True If Not (oDB.IsOpen) Then flag = oDB.Open("", "") If Not flag Then MsgBox "Can't open mail file: " & oDB.SERVER & " " & oDB.FILEPATH End If On Error GoTo err_handler 'Building Message Set oDoc = oDB.CREATEDOCUMENT Set oItem = oDoc.CREATERICHTEXTITEM("BODY") oDoc.Form = "Memo" 'mail subject oDoc.Subject = "subject" 'mail body oDoc.sendto = "[email protected]" oDoc.body = "my text" oDoc.postdate = Date oDoc.SaveMessageOnSend = True oDoc.visable = True 'Sending Message oDoc.SEND False Does anybody has an idea about how to send a stylesheet ? Thanks alot.

    Read the article

  • Operation is not valid due to the current state of the object?

    - by Bill
    I am programming in C#; the code was working about a week ago, however it throws an exception and I don't understand at all what could be wrong with it. Var root = new CalculationNode(); -> Throw exception. In the call stack thats the only thing listed, I've been told that it could be that I need a clean build, but I am open to any ideas or suggestions. Thanks, -Bill Update: Exception's Detail System.InvalidOperationException was unhandled by user code Message=Operation is not valid due to the current state of the object. Source=Calculator.Logic StackTrace: at ~.Calculator.Logic.MyBaseExpressionParser.Parse(String expression) in ~\Source\Calculator.Logic\MyBaseExpressionParser.cs:line 44 at ~.Calculator.Logic.Tests.MyBaseCalculatorServiceTests.BasicMathDivision() in ~\Projects\Tests\Calculator.Logic.Tests\MyBaseCalculatorServiceTests.cs:line 60 InnerException: CalculationNode's code: public sealed calss CalculationNode { public CalculationNode() { this.Left = null; this.Right = null; this.Element = new CalculationElement(); } public CalculationNode Left {get;set;} public CalculationNode Right {get;set;} public CalculationElement Element {get; set;} } CalculationElement's code: public sealed class CalculationElement { public CalculationElement() { Value = string.Empty; IsOperator = false; } public string Value {get; set} public bool IsOperator {get; set} }

    Read the article

  • How do I setup Linq to SQL and WCF

    - by Jisaak
    So I'm venturing out into the world of Linq and WCF web services and I can't seem to make the magic happen. I have a VERY basic WCF web service going and I can get my old SqlConnection calls to work and return a DataSet. But I can't/don't know how to get the Linq to SQL queries to work. I'm guessing it might be a permissions problem since I need to connect to the SQL Database with a specific set of credentials but I don't know how I can test if that is the issue. I've tried using both of these connection strings and neither seem to give me a different result. <add name="GeoDataConnectionString" connectionString="Data Source=SQLSERVER;Initial Catalog=GeoData;Integrated Security=True" providerName="System.Data.SqlClient" /> <add name="GeoDataConnectionString" connectionString="Data Source=SQLSERVER;Initial Catalog=GeoData;User ID=domain\userName; Password=blahblah; Trusted_Connection=true" providerName="System.Data.SqlClient" /> Here is the function in my service that does the query and I have the interface add the [OperationContract] public string GetCity(int cityId) { GeoDataContext db = new GeoDataContext(); var city = from c in db.Cities where c.CITY_ID == 30429 select c.DESCRIPTION; return city.ToString(); } The GeoData.dbml only has one simple table in it with a list of city id's and city names. I have also changed the "Serialization Mode" on the DataContext to "Unidirectional" which from what I've read needs to be done for WCF. When I run the service I get this as the return: SELECT [t0].[DESCRIPTION] FROM [dbo].[Cities] AS [t0] WHERE [t0].[CITY_ID] = @p0 Dang, so as I'm writing this I realize that maybe my query is all messed up?

    Read the article

  • Avoiding nesting two for loops

    - by chavanak
    Hi, Please have a look at the code below: import string from collections import defaultdict first_complex=open( "residue_a_chain_a_b_backup.txt", "r" ) first_complex_lines=first_complex.readlines() first_complex_lines=map( string.strip, first_complex_lines ) first_complex.close() second_complex=open( "residue_a_chain_a_c_backup.txt", "r" ) second_complex_lines=second_complex.readlines() second_complex_lines=map( string.strip, second_complex_lines ) second_complex.close() list_1=[] list_2=[] for x in first_complex_lines: if x[0]!="d": list_1.append( x ) for y in second_complex_lines: if y[0]!="d": list_2.append( y ) j=0 list_3=[] list_4=[] for a in list_1: pass for b in list_2: pass if a==b: list_3.append( a ) kvmap=defaultdict( int ) for k in list_3: kvmap[k]+=1 print kvmap Normally I use izip or izip_longest to club two for loops, but this time the length of the files are different. I don't want a None entry. If I use the above method, the run time becomes incremental and useless. How am I supposed to get the two for loops going? Cheers, Chavanak

    Read the article

  • How do I run a vim script that alters the current buffer?

    - by Dan
    I'm trying to write a beautify.vim script that makes C-like code adhere to a standard that I can easily read. My file contains only substitution commands that all begin with %s/... However, when I try to run the script with my file open, in the manner :source beautify.vim, or :runtime beautify.vim, it runs but all the substitute commands state that their pattern wasn't found (patterns were tested by entering them manually and should work). Is there some way to make vim run the commands in the context of the current buffer? beautify.vim: " add spaces before open braces sil! :%s/\%>1c>\s\@<!{/ {/g " beautify for sil! :%s/for *( *\([^;]*\) *; *\([^;]*\) *; *\([^;]*\) *)/for (\1; \2; \3)/ " add spaces after commas sil! :%s/,\s\@!/, /g In my tests the first :s command should match (it matches when applied manually).

    Read the article

  • ASP.NET MVC jQuery autocomplete with url.action helper in a script included in a page.

    - by Boob
    I have been building my first ASP.NET MVC web app. I have been using the jQuery autocomplete widget in a number of places like this: <head> $("#model").autocomplete({ source: '<%= Url.Action("Model", "AutoComplete") %>' }); </head> The thing is I have this jQuery code in a number of different places through my web app. So i thought I would create a seperate javascript script (script.js) where I could put this code and then just include it in the master page. Then i can put all these repeated pieces of code in that script and just call them where I need too. So I did this. My code is shown below: In the site.js script I put this function: function doAutoComplete() { $("#model").autocomplete({ source: '<%= Url.Action("Model", "AutoComplete") %>' }); } On the page I have: <head> <script src="../../Scripts/site.js" type="text/javascript"></script> doAutoComplete(); </head> But when I do this I get an Invalid Argument exception and the autocomplete doesnt work. What am I doing wrong? Any ideas?Do i need to pass something to the doAutoComplete function?

    Read the article

  • Advanced All In One .NET Framework

    - by alfredo dobrekk
    Hi, i m starting a new project that would basically take input from user and save them to database among about 30 screens, and i would like to find a framework that will allow the maximum number of these features out of the box : .net c#. windows form. unit testing continuous integration screens with lists, combo boxes, text boxes, add, delete, save, cancel that are easy to update when you add a property to your classes or a field to your database. auto completion on controls to help user find its way use of an orm like nhibernate easy multithreading and display of wait screens for user easy undo redo tabbed child windows search forms ability to grant access to some functionnalities according to user profiles mvp/mvvm or whatever design patterns either some code generation from database to c# classe or generation of database schema from c# classes some kind of database versioning / upgrade to easily update database when i release patches to application once in production automatic control resizing code metrics analysis some code generator i can use against my entities that would generate some rough form i can rearrange after code documentation generator ... Any ideas ? I know its lot but i really would like to use existing code to build upon so i can focus on business rules. Could splitting the requirements on 3 or 4 existing open source framework be possible ? Do u have any suggestion to add to the list before starting ? What open source tools would u use to achieve these ?

    Read the article

  • Python file input string: how to handle escaped unicode characters?

    - by Michi
    In a text file (test.txt), my string looks like this: Gro\u00DFbritannien Reading it, python escapes the backslash: >>> file = open('test.txt', 'r') >>> input = file.readline() >>> input 'Gro\\u00DFbritannien' How can I have this interpreted as unicode? decode() and unicode() won't do the job. The following code writes Gro\u00DFbritannien back to the file, but I want it to be Großbritannien >>> input.decode('latin-1') u'Gro\\u00DFbritannien' >>> out = codecs.open('out.txt', 'w', 'utf-8') >>> out.write(input)

    Read the article

  • Efficient Clojure workflow?

    - by Alex B
    I am developing a pet project with Clojure, but wonder if I can speed up my workflow a bit. My current workflow (with Compojure) is: Start Swank with lein swank. Go to Emacs, connect with M-x slime-connect. Load all existing source files one by one. This also starts a Jetty server and an application. Write some code in REPL. When satisfied with experiments, write a full version of a construct I had in mind. Eval (C-c C-c) it. Switch REPL to namespace where this construct resides and test it. Switch to browser and reload browser tab with the affected page. Tweak the code, eval it, check in the browser. Repeat any of the above. There are a number of annoyances with it: I have to switch between Emacs and the browser (or browsers if I am testing things like templating with multiple browsers) all the time. Is there a common idiom to automate this? I used to have a JavaScript bit that reloads the page continuously, but it's of limited utility, obviously, when I have to interact with the page for more than a few seconds. My JVM instance becomes "dirty" when I experiment and write test functions. Basically namespaces become polluted, especially if I'm refactoring and moving the functions between namespaces. This can lead to symbol collisions and I need to restart Swank. Can I undef a symbol? I load all source files one by one (C-c C-k) upon restarting Swank. I suspect I'm doing it all wrong. Switching between the REPL and the file editor can be a bit irritating, especially when I have a lot of Emacs tabs open, alongside the browser(s). I'm looking for ways to improve the above points and the entire workflow in general, so I'd appreciate if you'd share yours. P. S. I have also used Vimclojure before, so Vimclojure-based workflows are welcome too.

    Read the article

  • Upload and parse csv file with "universal newline" in python on Google App Engine

    - by greg
    Hi, I'm uploading a csv/tsv file from a form in GAE, and I try to parse the file with python csv module. Like describe here, uploaded files in GAE are strings. So I treat my uploaded string a file-like object : file = self.request.get('catalog') catalog = csv.reader(StringIO.StringIO(file),dialect=csv.excel_tab) But new lines in my files are not necessarily '\n' (thanks to excel..), and it generated an error : Error: new-line character seen in unquoted field - do you need to open the file in universal-newline mode? Does anyone know how to use StringIO.StringIO to treat strings like files open in universal-newline?

    Read the article

  • How do I make the manifest available during a Maven/Surefire unittest run "mvn test" ?

    - by Ernst de Haan
    How do I make the manifest available during a Maven/Surefire unittest run "mvn test" ? I have an open-source project that I am converting from Ant to Maven, including its unit tests. Here's the project source repository with the Maven project: http://github.com/znerd/logdoc My question pertains to the primary module, called "base". This module has a unit test that tests the behaviour of the static method getVersion() in the class org.znerd.logdoc.Library. This method returns: Library.class.getPackage().getImplementationVersion() The getImplementationVersion() method returns a value of a setting in the manifest file. So far, so good. I have tested this in the past and it works well, as long as the manifest is indeed available on the classpath at the path META-INF/MANIFEST.MF (either on the file system or inside a JAR file). Now my challenge is that the manifest file is not available when I run the unit tests: mvn test Surefire runs the unit tests, but my unit test fails with a mesage indicating that Library.getVersion() returned null. When I want to check the JAR, I find that it has not even been generated. Maven/Surefire runs the unit tests against the classes, before the resources are added to the classpath. So can I either run the unit tests against the JAR (implicitly requiring the JAR to be generated first) or can I make sure the resources (including the manifest file) are generated/copied under target/classes before the unit tests are run? Note that I use Maven 2.2.0, Java 1.6.0_17 on Mac OS X 10.6.2, with JUnit 4.8.1.

    Read the article

  • Posting an action works... but no image

    - by Brian Rice
    I'm able to post an open graph action to facebook using the following url: https://graph.facebook.com/me/video.watches with the following post data: video=http://eqnetwork.com/home/video.html?f=8e7b4f27-8cbd-4430-84df-d9ccb46da45f.mp4 It seems to be getting the title from the open graph metatags at the "video" object. But, it's not getting the image (even though one is specified in the metatag "og:image"). Also, if I add this to the post data: picture=http://eqnetwork.com/icons/mgen/overplayThumbnail.ms?drid=14282&subType=ljpg&w=120&h=120&o=1&thumbnail= still no image. Any thoughts? Brian

    Read the article

  • Creating and writing file from a FileOutputStream in Java

    - by Althane
    Okay, so I'm working on a project where I use a Java program to initiate a socket connection between two classes (a FileSender and FileReceiver). My basic idea was that the FileSender would look like this: try { writer = new DataOutputStream(connect.getOutputStream()); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } //While we have bytes to send while(filein.available() >0){ //We write them out to our buffer writer.write(filein.read(outBuffer)); writer.flush(); } //Then close our filein filein.close(); //And then our socket; connect.close(); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); The constructor contains code that checks to see if the file exists, and that the socket is connected, and so on. Inside my FileReader is this though: input = recvSocket.accept(); BufferedReader br = new BufferedReader(new InputStreamReader(input.getInputStream())); FileOutputStream fOut= new FileOutputStream(filename); String line = br.readLine(); while(line != null){ fOut.write(line.getBytes()); fOut.flush(); line = br.readLine(); } System.out.println("Before RECV close statements"); fOut.close(); input.close(); recvSocket.close(); System.out.println("After RECV clsoe statements"); All inside a try-catch block. So, what I'm trying to do is have the FileSender reading in the file, converting to bytes, sending and flushing it out. FileReceiver, then reads in the bytes, writes to the fileOut, flushes, and continues waiting for more. I make sure to close all the things that I open, so... here comes the weird part. When I try and open the created text file in Eclipse, it tells me "An SWT error has occured ... recommended to exit the workbench... see .log for more details.". Another window pops up saying "Unhandled event loop exception, (no more handles)". However, if I try to open the sent text file in notepad2, I get ThisIsASentTextfile Which is good (well, minus the fact that there should be line breaks, but I'm working on that...). Does anyone know why this is happening? And while we're checking, how to add the line breaks? (And is this a particularly bad way to transfer files over java without getting some other libraries?)

    Read the article

  • How to implement escape Sequence in SDL

    - by Sa'me Smd
    Im trying to use the STL library inside the SDL. but it gives me the error "undeclared identifier" Is there any way i can use "\n"or even cout<<endl; Can the function SDL_WarpMousewhich places the mouse cursor on a desired location on screen help me with this. Because i want to put a tile on the next line sequence. I hope you get the Question. Its very vague and messed up question though (sorry for that). EDIT: void putMap(SDL_Surface* tile, SDL_Surface* screen) { for(int y = 0; y < 21; y++) { for(int x = 0; x < 60; x++) { if(maze[x][y] != '#') { apply_surface( x*10 , y*10 , tile, screen); } } cout<<endl; } } c:\documents and settings\administrator\my documents\visual studio 2008\projects\craptest\craptest\main.cpp(605) : error C2065: 'cout' : undeclared identifier c:\documents and settings\administrator\my documents\visual studio 2008\projects\craptest\craptest\main.cpp(605) : error C2065: 'endl' : undeclared identifier This is my apply_surface funtion. void apply_surface( int x, int y, SDL_Surface* source, SDL_Surface* destination ) { //Make a temporary rectangle to hold the offsets SDL_Rect offset; //Give the offsets to the rectangle offset.x = x; offset.y = y; //Blit the surface SDL_BlitSurface( source, NULL, destination, &offset ); }

    Read the article

  • MS Access 2003 - Failure to create MDE file: error VBA is corrupt?

    - by Justin
    Ok so this is a brand new snag I have run into. I am trying to launch a new MDE from my source MDB file, and it is locking up Access. So in my mdb, I am first compacting and repairing, and then selecting create a new mde (just as I have done many times before). It looks like it is starting the process, but never gets to where it compacts when it is done, and access is not responding. So after I force close the app, I look in the folder where I am trying to create the MDE to and I see there is a new access db1 file there. If I try to open that it gives me an error that says file not found, and then it says the Visual Basic for Applications is corrupt. The thing is, I just made a very simple adjustment to the code since last launching an mde, and after this I double and triple checked it...its not that because its just a simple open this form and close this one addition. I did however have my source mdb file on a disc that I copied to my laptop, and then tried to re link the tables to the network drive (had them linked to other tables on my local drive so that I could develop offline)?? PLEASE HELP!!!

    Read the article

  • Reading a file with a supplied name in C++

    - by Cosmina
    I must read a file with a given name (it's caled "hamlet.txt"). The class used to read the file is defined like this #ifndef READWORDS_H #define READWORDS_H /** * ReadWords class. Provides mechanisms to read a text file, and return * capitalized words from that file. */ using namespace std; #include <string> #include <fstream> class ReadWords { public: /** * Constructor. Opens the file with the default name "text.txt". * Program exits with an error message if the file does not exist. */ ReadWords(); /** * Constructor. Opens the file with the given filename. * Program exits with an error message if the file does not exist. * @param filename - a C string naming the file to read. */ ReadWords(char *filename); My definition of the members of the classis this: #include<string> #include<fstream> #include<iostream> #include "ReadWords.h" using namespace std; ReadWords::ReadWords() { wordfile.open("text.txt"); if( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } } ReadWords::ReadWords(char *filename) { wordfile.open(filename); if ( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } wordfile>>nextword; } And the main to test it. using namespace std; #include #include #include "ReadWords.h" int main() { char name[30]; cout<<"Please input a name for the file that you wish to open"; cin>>name; ReadWords x( name[] ); } When I complie it gives me the error: main.cpp:14: error: expected primary-expression before ']' token I know it's got something to do with the function ReadWords( char *filename), but I do not know what. Any help please?

    Read the article

  • Rails - strip xml import from whitespace and line break

    - by val_to_many
    Hey folks, I am stuck with something quite simple but really annoying: I have an xml file with one node, where the content includes line breaks and whitspaces. Sadly I can't change the xml. <?xml version="1.0" encoding="utf-8" ?> <ProductFeed> ACME Ltd. Fooproduct Foo Root :: Bar Category I get to the node and can read from it without trouble: url = "http://feeds.somefeed/feed.xml.gz" @source = open((url), :http_basic_authentication=>["USER", "PW"]) @gz = Zlib::GzipReader.new(@source) @result = @gz.read @doc = Nokogiri::XML(@result) @doc.xpath("/ProductFeed/Vendors/Vendor").each do |manuf| vendor = manuf.css("Name").first.text manuf.xpath("//child::Product").each do |product| product_name = product.css("Name").text foocat = product.css("Category").text puts "#{vendor} ---- #{product_name} ---- #{foocat} " end end This results in: ACME Ltd. ---- Fooproduct ---- Foo Root :: Bar Category Obviously there are line breaks and tab stops or spaces in the string returned by product.css("Category").text. Does anyone know how to strip the result from linebreaks and taps or spaces right here? Alternatively I could do that in the next step, where I do a find on 'foocat' like barcat = Category.find_by_foocat(foocat) Thanks for helping! Val

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Maven compile plugin

    - by phanikiran
    Hi every body, in pom of a project, i have added dependency with scope compile . which is a jar file which contains some class file and jar's as well. my current java file needs internal jars of dependent jar to compile. But maven compile goal returning compilation error . :banghead: All the jar's needed to compile are in the single jar file which is added in dependency............................. Please help me! my pom: <dependency> <groupId>eagle</groupId> <artifactId>zkui</artifactId> <version>360LTS</version> <type>jar</type> <scope>compile</scope> </dependency> <build> <sourceDirectory>./src/main/java/</sourceDirectory> <outputDirectory>./target/classes/</outputDirectory> <finalName>${project.groupId}-${project.artifactId}</finalName> <plugins> <plugin> <groupId>org.apache.maven.plugins</groupId> <artifactId>maven-compiler-plugin</artifactId> <version>2.2</version> <configuration> <source>1.6</source> <target>1.6</target> </plugin> </plugins> </build> </project> error: package org.zkoss.zk.ui does not exist this package org.zkoss.zk.ui is in jar file zkex.jar which is in dependency jar eagle:zkui:360LTS jar file Please Help ME!!!! :jumpingjoy: Advance Thanks

    Read the article

  • Branch view for a file that has been split into multiple files

    - by ScottJ
    I have a large source file in Perforce that has been split up into several smaller files in a branch. I want to create a branch view that can handle this, but perforce (2009.1) only sees the last of the multiple files. For example, I created: p4 integrate //depot/original/huge_file.c //depot/new/huge_file.c Later I split the huge file into smaller ones: p4 integrate //depot/new/huge_file.c //depot/new/small_file_one.c p4 integrate //depot/new/huge_file.c //depot/new/small_file_two.c p4 integrate //depot/new/huge_file.c //depot/new/small_file_three.c Then edit each of those (including //depot/new/huge_file.c) and submit. Now I make changes to //depot/original/huge_file.c and I want to integrate those changes to //depot/new. If I do this manually, it works fine: p4 integrate //depot/original/huge_file.c //depot/new/huge_file.c p4 integrate //depot/original/huge_file.c //depot/new/small_file_one.c p4 integrate //depot/original/huge_file.c //depot/new/small_file_two.c p4 integrate //depot/original/huge_file.c //depot/new/small_file_three.c But I don't want to do that every time I integrate -- this kind of thing belongs in a branch view. Unfortunately if the branch view includes the same source file multiple times, the subsequent lines override the earlier ones. How can I create a branch view like this: //depot/original/huge_file.c //depot/new/huge_file.c //depot/original/huge_file.c //depot/new/small_file_one.c //depot/original/huge_file.c //depot/new/small_file_two.c //depot/original/huge_file.c //depot/new/small_file_three.c When I integrate using this branch spec, I get only small_file_three.c integrated.

    Read the article

  • Yes, another thread question...

    - by Michael
    I can't understand why I am loosing control of my GUI even though I am implementing a thread to play a .wav file. Can someone pin point what is incorrect? #!/usr/bin/env python import wx, pyaudio, wave, easygui, thread, time, os, sys, traceback, threading import wx.lib.delayedresult as inbg isPaused = False isStopped = False class Frame(wx.Frame): def __init__(self): print 'Frame' wx.Frame.__init__(self, parent=None, id=-1, title="Jasmine", size=(720, 300)) #initialize panel panel = wx.Panel(self, -1) #initialize grid bag sizer = wx.GridBagSizer(hgap=20, vgap=20) #initialize buttons exitButton = wx.Button(panel, wx.ID_ANY, "Exit") pauseButton = wx.Button(panel, wx.ID_ANY, 'Pause') prevButton = wx.Button(panel, wx.ID_ANY, 'Prev') nextButton = wx.Button(panel, wx.ID_ANY, 'Next') stopButton = wx.Button(panel, wx.ID_ANY, 'Stop') #add widgets to sizer sizer.Add(pauseButton, pos=(1,10)) sizer.Add(prevButton, pos=(1,11)) sizer.Add(nextButton, pos=(1,12)) sizer.Add(stopButton, pos=(1,13)) sizer.Add(exitButton, pos=(5,13)) #initialize song time gauge #timeGauge = wx.Gauge(panel, 20) #sizer.Add(timeGauge, pos=(3,10), span=(0, 0)) #initialize menuFile widget menuFile = wx.Menu() menuFile.Append(0, "L&oad") menuFile.Append(1, "E&xit") menuBar = wx.MenuBar() menuBar.Append(menuFile, "&File") menuAbout = wx.Menu() menuAbout.Append(2, "A&bout...") menuAbout.AppendSeparator() menuBar.Append(menuAbout, "Help") self.SetMenuBar(menuBar) self.CreateStatusBar() self.SetStatusText("Welcome to Jasime!") #place sizer on panel panel.SetSizer(sizer) #initialize icon self.cd_image = wx.Image('cd_icon.png', wx.BITMAP_TYPE_PNG) self.temp = self.cd_image.ConvertToBitmap() self.size = self.temp.GetWidth(), self.temp.GetHeight() wx.StaticBitmap(parent=panel, bitmap=self.temp) #set binding self.Bind(wx.EVT_BUTTON, self.OnQuit, id=exitButton.GetId()) self.Bind(wx.EVT_BUTTON, self.pause, id=pauseButton.GetId()) self.Bind(wx.EVT_BUTTON, self.stop, id=stopButton.GetId()) self.Bind(wx.EVT_MENU, self.loadFile, id=0) self.Bind(wx.EVT_MENU, self.OnQuit, id=1) self.Bind(wx.EVT_MENU, self.OnAbout, id=2) #Load file usiing FileDialog, and create a thread for user control while running the file def loadFile(self, event): foo = wx.FileDialog(self, message="Open a .wav file...", defaultDir=os.getcwd(), defaultFile="", style=wx.FD_MULTIPLE) foo.ShowModal() self.queue = foo.GetPaths() self.threadID = 1 while len(self.queue) != 0: self.song = myThread(self.threadID, self.queue[0]) self.song.start() while self.song.isAlive(): time.sleep(2) self.queue.pop(0) self.threadID += 1 def OnQuit(self, event): self.Close() def OnAbout(self, event): wx.MessageBox("This is a great cup of tea.", "About Jasmine", wx.OK | wx.ICON_INFORMATION, self) def pause(self, event): global isPaused isPaused = not isPaused def stop(self, event): global isStopped isStopped = not isStopped class myThread (threading.Thread): def __init__(self, threadID, wf): self.threadID = threadID self.wf = wf threading.Thread.__init__(self) def run(self): global isPaused global isStopped self.waveFile = wave.open(self.wf, 'rb') #initialize stream self.p = pyaudio.PyAudio() self.stream = self.p.open(format = self.p.get_format_from_width(self.waveFile.getsampwidth()), channels = self.waveFile.getnchannels(), rate = self.waveFile.getframerate(), output = True) self.data = self.waveFile.readframes(1024) isPaused = False isStopped = False #main play loop, with pause event checking while self.data != '': # while isPaused != True: # if isStopped == False: self.stream.write(self.data) self.data = self.waveFile.readframes(1024) # elif isStopped == True: # self.stream.close() # self.p.terminate() self.stream.close() self.p.terminate() class App(wx.App): def OnInit(self): self.frame = Frame() self.frame.Show() self.SetTopWindow(self.frame) return True def main(): app = App() app.MainLoop() if __name__=='__main__': main()

    Read the article

  • what's the purpose of fcntl with parameter F_DUPFD

    - by Daniel
    I traced an oracle process, and find it first open a file /etc/netconfig as file handle 11, and then duplicate it as 256 by calling fcntl with parameter F_DUPFD, and then close the original file handle 11. Later it read using file handle 256. So what's the point to duplicate the file handle? Why not just work on the original file handle? 12931: 0.0006 open("/etc/netconfig", O_RDONLY|O_LARGEFILE) = 11 12931: 0.0002 fcntl(11, F_DUPFD, 0x00000100) = 256 12931: 0.0001 close(11) = 0 12931: 0.0002 read(256, " # p r a g m a i d e n".., 1024) = 1024 12931: 0.0003 read(256, " t s t p i _ c".., 1024) = 215 12931: 0.0002 read(256, 0x106957054, 1024) = 0 12931: 0.0001 lseek(256, 0, SEEK_SET) = 0 12931: 0.0002 read(256, " # p r a g m a i d e n".., 1024) = 1024 12931: 0.0003 read(256, " t s t p i _ c".., 1024) = 215 12931: 0.0003 read(256, 0x106957054, 1024) = 0 12931: 0.0001 close(256) = 0

    Read the article

< Previous Page | 590 591 592 593 594 595 596 597 598 599 600 601  | Next Page >