Search Results

Search found 268 results on 11 pages for 'fileinputstream'.

Page 6/11 | < Previous Page | 2 3 4 5 6 7 8 9 10 11  | Next Page >

  • Referencing java resource files for cold fusion

    - by Chimeara
    I am using a .Jar file containing a .properties file in my CF code, however it seems unable to find the .properties file when run from CF. My java code is: String key =""; String value =""; try { File file = new File("src/test.properties"); FileInputStream fileInput = new FileInputStream(file); Properties properties = new Properties(); properties.load(fileInput); fileInput.close(); Enumeration enuKeys = properties.keys(); while (enuKeys.hasMoreElements()) { key = (String) enuKeys.nextElement(); value = properties.getProperty(key); //System.out.println(key + ": " + value); } } catch (FileNotFoundException e) { e.printStackTrace(); key ="error"; } catch (IOException e) { e.printStackTrace(); key ="error"; } return(key + ": " + value); I have my test.properties file in the project src folder, and make sure it is selected when compiling, when run from eclipse it gives the expected key and value, however when run from CF I get the caught errors. My CF code is simply: propTest = CreateObject("java","package.class"); testResults = propTest.main2(); Is there a special way to reference the .properties file so CF can access it, or do I need to include the file outside the .jar somewhere?

    Read the article

  • download large files using servlet

    - by niks
    I am using Apache Tomcat Server 6 and Java 1.6 and am trying to write large mp3 files to the ServletOutputStream for a user to download. Files are ranging from a 50-750MB at the moment. The smaller files aren't causing too much of a problem but with the larger files it and getting socket exception broken pipe. File fileMp3 = new File(objDownloadSong.getStrSongFolder() + "/" + strSongIdName); FileInputStream fis = new FileInputStream(fileMp3); response.setContentType("audio/mpeg"); response.setHeader("Content-Disposition", "attachment; filename=\"" + strSongName + ".mp3\";"); response.setContentLength((int) fileMp3.length()); OutputStream os = response.getOutputStream(); try { int byteRead = 0; while ((byteRead = fis.read()) != -1) { os.write(byteRead); } os.flush(); } catch (Exception excp) { downloadComplete = "-1"; excp.printStackTrace(); } finally { os.close(); fis.close(); }

    Read the article

  • Pass the return type as a parameter in java?

    - by jonderry
    I have some files that contain logs of objects. Each file can store objects of a different type, but a single file is homogeneous -- it only stores objects of a single type. I would like to write a method that returns an array of these objects, and have the array be of a specified type (the type of objects in a file is known and can be passed as a parameter). Roughly, what I want is something like the following: public static <T> T[] parseLog(File log, Class<T> cls) throws Exception { ArrayList<T> objList = new ArrayList<T>(); FileInputStream fis = new FileInputStream(log); ObjectInputStream in = new ObjectInputStream(fis); try { Object obj; while (!((obj = in.readObject()) instanceof EOFObject)) { T tobj = (T) obj; objList.add(tobj); } } finally { in.close(); } return objList.toArray(new T[0]); } The above code doesn't compile (there's an error on the return statement, and a warning on the cast), but it should give you the idea of what I'm trying to do. Any suggestions for the best way to do this?

    Read the article

  • displaying a physical webpage with frames in iframe

    - by ksa
    i have iframe in my webpage, i have done the coding part for browsing the folders and viewing files in iframe.each folder has a index.html.now i need to display the index.html in iframe.index.html page contains frames divided into 2,each from different sources.i tried to display a sample webpage without frames and it was a success,page with frames spoils the party. my code for getting the html file <% String path=request.getParameter("name"); File directory = new File(path); FileFilter fileFilter=new FileFilter() { @Override public boolean accept(File file) { return file.getName().endsWith("html"); } }; File[] files = directory.listFiles(fileFilter); for (int index = 0; index < files.length; index++) { String s= files[index].getName(); String s1=files[index].getAbsolutePath(); %> <a href="fileview?name=<%=s1%>" target="sss"><%=s%></a> <% } %> mycode for displaying the page in iframe. public void doGet(HttpServletRequest req,HttpServletResponse res) throws ServletException,IOException { res.setContentType("text/html"); PrintWriter out=res.getWriter(); String name=req.getParameter("name"); res.setHeader("Content-Disposition", "inline; filename=\""+name+"\""); java.io.FileInputStream fis=new java.io.FileInputStream(name); int i; while((i=fis.read())!=-1) { out.write(i); } fis.close(); out.close(); }

    Read the article

  • FileInput Help/Advice

    - by user559142
    I have a fileinput class. It has a string parameter in the constructor to load the filename supplied. However it just exits if the file doesn't exist. I would like it to output a message if the file doesn't exist - but not sure how.... Here is the class: public class FileInput extends Input { /** * Construct <code>FileInput</code> object given a file name. */ public FileInput(final String fileName) { try { scanner = new Scanner(new FileInputStream(fileName)); } catch (FileNotFoundException e) { System.err.println("File " + fileName + " could not be found."); System.exit(1); } } /** * Construct <code>FileInput</code> object given a file name. */ public FileInput(final FileInputStream fileStream) { super(fileStream); } } And its implementation: private void loadFamilyTree() { out.print("Enter file name: "); String fileName = in.nextLine(); FileInput input = new FileInput(fileName); family.load(input); input.close(); }

    Read the article

  • junit test error - ClassCastException

    - by Josepth Vodary
    When trying to run a junit test I get the following error - java.lang.ClassCastException: business.Factory cannot be cast to services.itemservice.IItemsService at business.ItemManager.get(ItemManager.java:56) at business.ItemMgrTest.testGet(ItemMgrTest.java:49) The specific test that is causing the problem is @Test public void testGet() { Assert.assertTrue(itemmgr.get(items)); } The code it is testing is... public boolean get(Items item) { boolean gotItems = false; Factory factory = Factory.getInstance(); @SuppressWarnings("static-access") IItemsService getItem = (IItemsService)factory.getInstance(); try { getItem.getItems("pens", 15, "red", "gel"); gotItems = true; } catch (ItemNotFoundException e) { // catch e.printStackTrace(); System.out.println("Error - Item Not Found"); } return gotItems; } The test to store items, which is nearly identical, works just fine... The factory class is.. public class Factory { private Factory() {} private static Factory Factory = new Factory(); public static Factory getInstance() {return Factory;} public static IService getService(String serviceName) throws ServiceLoadException { try { Class<?> c = Class.forName(getImplName(serviceName)); return (IService)c.newInstance(); } catch (Exception e) { throw new ServiceLoadException(serviceName + "not loaded"); } } private static String getImplName (String serviceName) throws Exception { java.util.Properties props = new java.util.Properties(); java.io.FileInputStream fis = new java.io.FileInputStream("config\\application.properties"); props.load(fis); fis.close(); return props.getProperty(serviceName); } }

    Read the article

  • Java - Display % of upload done

    - by tr-raziel
    I have a java applet for uploading files to server. I want to display the % of data sent but when I use ObjectOutputStream.write() it just writes to the buffer, does not wait until the data has actually been sent. How can I achieve this. Perhaps I need to use thread synchronization or something. Any clues would be most helpful. This is the code I'm using right now: try{ for(File file : ficheiros){ FileInputStream stream = new FileInputStream (file); int bytesRead1 = 0;; int off1 = 0; int len1 = 100000; if(file.length() < 100000) len1 = new Long(file.length()).intValue(); byte[] bytes1 = new byte[len1]; while (off1 < file.length()) { bytes1 = new byte[len1]; if((file.length() - off1) < len1){ len1 = (new Long(file.length()).intValue() - off1); bytes1 = new byte[len1]; } if((bytesRead1 = stream.read(bytes1)) != -1){ //I want this to block until all data has been sent outputToServlet.write(bytes1, 0, bytesRead1 ); System.out.println("off1: " + off1); off1 = off1 + len1; outputToServlet.flush(); } sent += len1; if(sent>totalLength) sent = (int)totalLength; updateFeedback(sent,totalLength,false);//calls method to display % } updateFeedback(-1,-1,true); } }catch(Exception e){ e.printStackTrace(); } Thanks

    Read the article

  • java: how to compress data into a String and uncompress data from the String

    - by Guillaume
    I want to put some compressed data into a remote repository. To put data on this repository I can only use a method that take the name of the resource and its content as a String. (like data.txt + "hello world"). The repository is moking a filesystem but is not, so I can not use File directly. I want to be able to do the following: client send to server a file 'data.txt' server compress 'data.txt' into data.zip server send to repository content of data.zip repository store data.zip client download from repository data.zip and his able to open it with its favorite zip tool I have tried a lots of compressing example found on the web but each time a send the data to the repository, my resulting zip file is corrupted. Here is a sample class, using the zip*stream and that emulate the repository showcasing my problem. The created zip file is working, but after its 'serialization' it's get corrupted. (the sample class use jakarta commons.io ) Many thanks for your help. package zip; import java.io.File; import java.io.FileInputStream; import java.io.FileOutputStream; import java.io.IOException; import java.io.InputStream; import java.util.zip.ZipEntry; import java.util.zip.ZipInputStream; import java.util.zip.ZipOutputStream; import org.apache.commons.io.FileUtils; /** * Date: May 19, 2010 - 6:13:07 PM * * @author Guillaume AME. */ public class ZipMe { public static void addOrUpdate(File zipFile, File ... files) throws IOException { File tempFile = File.createTempFile(zipFile.getName(), null); // delete it, otherwise you cannot rename your existing zip to it. tempFile.delete(); boolean renameOk = zipFile.renameTo(tempFile); if (!renameOk) { throw new RuntimeException("could not rename the file " + zipFile.getAbsolutePath() + " to " + tempFile.getAbsolutePath()); } byte[] buf = new byte[1024]; ZipInputStream zin = new ZipInputStream(new FileInputStream(tempFile)); ZipOutputStream out = new ZipOutputStream(new FileOutputStream(zipFile)); ZipEntry entry = zin.getNextEntry(); while (entry != null) { String name = entry.getName(); boolean notInFiles = true; for (File f : files) { if (f.getName().equals(name)) { notInFiles = false; break; } } if (notInFiles) { // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(name)); // Transfer bytes from the ZIP file to the output file int len; while ((len = zin.read(buf)) > 0) { out.write(buf, 0, len); } } entry = zin.getNextEntry(); } // Close the streams zin.close(); // Compress the files if (files != null) { for (File file : files) { InputStream in = new FileInputStream(file); // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(file.getName())); // Transfer bytes from the file to the ZIP file int len; while ((len = in.read(buf)) > 0) { out.write(buf, 0, len); } // Complete the entry out.closeEntry(); in.close(); } // Complete the ZIP file } tempFile.delete(); out.close(); } public static void main(String[] args) throws IOException { final String zipArchivePath = "c:/temp/archive.zip"; final String tempFilePath = "c:/temp/data.txt"; final String resultZipFile = "c:/temp/resultingArchive.zip"; File zipArchive = new File(zipArchivePath); FileUtils.touch(zipArchive); File tempFile = new File(tempFilePath); FileUtils.writeStringToFile(tempFile, "hello world"); addOrUpdate(zipArchive, tempFile); //archive.zip exists and contains a compressed data.txt that can be read using winrar //now simulate writing of the zip into a in memory cache String archiveText = FileUtils.readFileToString(zipArchive); FileUtils.writeStringToFile(new File(resultZipFile), archiveText); //resultingArchive.zip exists, contains a compressed data.txt, but it can not //be read using winrar: CRC failed in data.txt. The file is corrupt } }

    Read the article

  • java: how to get a string representation of a compressed byte array ?

    - by Guillaume
    I want to put some compressed data into a remote repository. To put data on this repository I can only use a method that take the name of the resource and its content as a String. (like data.txt + "hello world"). The repository is moking a filesystem but is not, so I can not use File directly. I want to be able to do the following: client send to server a file 'data.txt' server compress 'data.txt' into a compressed file 'data.zip' server send a string representation of data.zip to the repository repository store data.zip client download from repository data.zip and his able to open it with its favorite zip tool The problem arise at step 3 when I try to get a string representation of my compressed file. Here is a sample class, using the zip*stream and that emulate the repository showcasing my problem. The created zip file is working, but after its 'serialization' it's get corrupted. (the sample class use jakarta commons.io ) Many thanks for your help. package zip; import java.io.File; import java.io.FileInputStream; import java.io.FileOutputStream; import java.io.IOException; import java.io.InputStream; import java.util.zip.ZipEntry; import java.util.zip.ZipInputStream; import java.util.zip.ZipOutputStream; import org.apache.commons.io.FileUtils; /** * Date: May 19, 2010 - 6:13:07 PM * * @author Guillaume AME. */ public class ZipMe { public static void addOrUpdate(File zipFile, File ... files) throws IOException { File tempFile = File.createTempFile(zipFile.getName(), null); // delete it, otherwise you cannot rename your existing zip to it. tempFile.delete(); boolean renameOk = zipFile.renameTo(tempFile); if (!renameOk) { throw new RuntimeException("could not rename the file " + zipFile.getAbsolutePath() + " to " + tempFile.getAbsolutePath()); } byte[] buf = new byte[1024]; ZipInputStream zin = new ZipInputStream(new FileInputStream(tempFile)); ZipOutputStream out = new ZipOutputStream(new FileOutputStream(zipFile)); ZipEntry entry = zin.getNextEntry(); while (entry != null) { String name = entry.getName(); boolean notInFiles = true; for (File f : files) { if (f.getName().equals(name)) { notInFiles = false; break; } } if (notInFiles) { // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(name)); // Transfer bytes from the ZIP file to the output file int len; while ((len = zin.read(buf)) > 0) { out.write(buf, 0, len); } } entry = zin.getNextEntry(); } // Close the streams zin.close(); // Compress the files if (files != null) { for (File file : files) { InputStream in = new FileInputStream(file); // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(file.getName())); // Transfer bytes from the file to the ZIP file int len; while ((len = in.read(buf)) > 0) { out.write(buf, 0, len); } // Complete the entry out.closeEntry(); in.close(); } // Complete the ZIP file } tempFile.delete(); out.close(); } public static void main(String[] args) throws IOException { final String zipArchivePath = "c:/temp/archive.zip"; final String tempFilePath = "c:/temp/data.txt"; final String resultZipFile = "c:/temp/resultingArchive.zip"; File zipArchive = new File(zipArchivePath); FileUtils.touch(zipArchive); File tempFile = new File(tempFilePath); FileUtils.writeStringToFile(tempFile, "hello world"); addOrUpdate(zipArchive, tempFile); //archive.zip exists and contains a compressed data.txt that can be read using winrar //now simulate writing of the zip into a in memory cache String archiveText = FileUtils.readFileToString(zipArchive); FileUtils.writeStringToFile(new File(resultZipFile), archiveText); //resultingArchive.zip exists, contains a compressed data.txt, but it can not //be read using winrar: CRC failed in data.txt. The file is corrupt } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • lwjgl custom icon

    - by melchor629
    I have a little problem with the icon in lwjgl, it doesn't work. I google about it, but i haven't found anything that works for me yet. This is my code for now: PNGDecoder imageDecoder = new PNGDecoder(new FileInputStream("res/images/Icon.png")); ByteBuffer imageData = BufferUtils.createByteBuffer(4 * imageDecoder.getWidth() * imageDecoder.getHeight()); imageDecoder.decode(imageData, imageDecoder.getWidth() * 4, PNGDecoder.Format.RGBA); imageData.flip(); System.err.println(Display.setIcon(new ByteBuffer[]{imageData}) == 0 ? "No se ha creado el icono" : "Se ha creado el icono"); The png file is a 128x128px with transparency. PNGDecoder is from the matthiasmann utility (de.matthiasmann.twl.utils). I'm using Mac OS, 10.8.4 with lwjgl 2.9.0. Thanks :)

    Read the article

  • How do I put different textures on different walls? LWJGL

    - by lehermj
    So far I have it so you are running around in a box, but all of the walls are the same texture! I've loaded up other textures for the walls (I want the walls a different texture than the floor) but it seems as if its being ignored... Here's my code: int floorTexture = glGenTextures(); { InputStream in = null; try { in = new FileInputStream("floor.png"); PNGDecoder decoder = new PNGDecoder(in); ByteBuffer buffer = BufferUtils.createByteBuffer(4 * decoder.getWidth() * decoder.getHeight()); decoder.decode(buffer, decoder.getWidth() * 4, Format.RGBA); buffer.flip(); glBindTexture(GL_TEXTURE_2D, floorTexture); glTexParameteri(GL_TEXTURE_2D, GL_TEXTURE_MAG_FILTER, GL_NEAREST); glTexParameteri(GL_TEXTURE_2D, GL_TEXTURE_MIN_FILTER, GL_NEAREST); glTexImage2D(GL_TEXTURE_2D, 0, GL_RGBA, decoder.getWidth(), decoder.getHeight(), 0, GL_RGBA, GL_UNSIGNED_BYTE, buffer); glBindTexture(GL_TEXTURE_2D, floorTexture); } catch (FileNotFoundException ex) { System.err.println("Failed to find the texture files."); ex.printStackTrace(); Display.destroy(); System.exit(1); } catch (IOException ex) { System.err.println("Failed to load the texture files."); ex.printStackTrace(); Display.destroy(); System.exit(1); } finally { if (in != null) { try { in.close(); } catch (IOException e) { e.printStackTrace(); } } } } int wallTexture = glGenTextures(); { InputStream in = null; try { in = new FileInputStream("walls.png"); PNGDecoder decoder = new PNGDecoder(in); ByteBuffer buffer = BufferUtils.createByteBuffer(4 * decoder.getWidth() * decoder.getHeight()); decoder.decode(buffer, decoder.getWidth() * 4, Format.RGBA); buffer.flip(); glBindTexture(GL_TEXTURE_2D, wallTexture); glTexParameteri(GL_TEXTURE_2D, GL_TEXTURE_MAG_FILTER, GL_NEAREST); glTexParameteri(GL_TEXTURE_2D, GL_TEXTURE_MIN_FILTER, GL_NEAREST); glTexImage2D(GL_TEXTURE_2D, 0, GL_RGBA, decoder.getWidth(), decoder.getHeight(), 0, GL_RGBA, GL_UNSIGNED_BYTE, buffer); glBindTexture(GL_TEXTURE_2D, wallTexture); } catch (FileNotFoundException ex) { System.err.println("Failed to find the texture files."); ex.printStackTrace(); Display.destroy(); System.exit(1); } catch (IOException ex) { System.err.println("Failed to load the texture files."); ex.printStackTrace(); Display.destroy(); System.exit(1); } finally { if (in != null) { try { in.close(); } catch (IOException e) { e.printStackTrace(); } } } } int ceilingDisplayList = glGenLists(1); glNewList(ceilingDisplayList, GL_COMPILE); glBegin(GL_QUADS); glTexCoord2f(0, 0); glVertex3f(-gridSize, ceilingHeight, -gridSize); glTexCoord2f(gridSize * 10 * tileSize, 0); glVertex3f(gridSize, ceilingHeight, -gridSize); glTexCoord2f(gridSize * 10 * tileSize, gridSize * 10 * tileSize); glVertex3f(gridSize, ceilingHeight, gridSize); glTexCoord2f(0, gridSize * 10 * tileSize); glVertex3f(-gridSize, ceilingHeight, gridSize); glEnd(); glEndList(); int wallDisplayList = glGenLists(1); glNewList(wallDisplayList, GL_COMPILE); glBegin(GL_QUADS); // North wall glTexCoord2f(0, 0); glVertex3f(-gridSize, floorHeight, -gridSize); glTexCoord2f(0, gridSize * 10 * tileSize); glVertex3f(gridSize, floorHeight, -gridSize); glTexCoord2f(gridSize * 10 * tileSize, gridSize * 10 * tileSize); glVertex3f(gridSize, ceilingHeight, -gridSize); glTexCoord2f(gridSize * 10 * tileSize, 0); glVertex3f(-gridSize, ceilingHeight, -gridSize); // West wall glTexCoord2f(0, 0); glVertex3f(-gridSize, floorHeight, -gridSize); glTexCoord2f(gridSize * 10 * tileSize, 0); glVertex3f(-gridSize, ceilingHeight, -gridSize); glTexCoord2f(gridSize * 10 * tileSize, gridSize * 10 * tileSize); glVertex3f(-gridSize, ceilingHeight, +gridSize); glTexCoord2f(0, gridSize * 10 * tileSize); glVertex3f(-gridSize, floorHeight, +gridSize); // East wall glTexCoord2f(0, 0); glVertex3f(+gridSize, floorHeight, -gridSize); glTexCoord2f(gridSize * 10 * tileSize, 0); glVertex3f(+gridSize, floorHeight, +gridSize); glTexCoord2f(gridSize * 10 * tileSize, gridSize * 10 * tileSize); glVertex3f(+gridSize, ceilingHeight, +gridSize); glTexCoord2f(0, gridSize * 10 * tileSize); glVertex3f(+gridSize, ceilingHeight, -gridSize); // South wall glTexCoord2f(0, 0); glVertex3f(-gridSize, floorHeight, +gridSize); glTexCoord2f(gridSize * 10 * tileSize, 0); glVertex3f(-gridSize, ceilingHeight, +gridSize); glTexCoord2f(gridSize * 10 * tileSize, gridSize * 10 * tileSize); glVertex3f(+gridSize, ceilingHeight, +gridSize); glTexCoord2f(0, gridSize * 10 * tileSize); glVertex3f(+gridSize, floorHeight, +gridSize); glEnd(); glEndList(); int floorDisplayList = glGenLists(1); glNewList(floorDisplayList, GL_COMPILE); glBegin(GL_QUADS); glTexCoord2f(0, 0); glVertex3f(-gridSize, floorHeight, -gridSize); glTexCoord2f(0, gridSize * 10 * tileSize); glVertex3f(-gridSize, floorHeight, gridSize); glTexCoord2f(gridSize * 10 * tileSize, gridSize * 10 * tileSize); glVertex3f(gridSize, floorHeight, gridSize); glTexCoord2f(gridSize * 10 * tileSize, 0); glVertex3f(gridSize, floorHeight, -gridSize); glEnd(); glEndList();

    Read the article

  • [Java] RSA BadPaddingException : data must start with zero

    - by Robin Monjo
    Hello everyone. I try to implement an RSA algorithm in a Java program. I am facing the "BadPaddingException : data must start with zero". Here are the methods used to encrypt and decrypt my data : public byte[] encrypt(byte[] input) throws Exception { Cipher cipher = Cipher.getInstance("RSA/ECB/PKCS1Padding");// cipher.init(Cipher.ENCRYPT_MODE, this.publicKey); return cipher.doFinal(input); } public byte[] decrypt(byte[] input) throws Exception { Cipher cipher = Cipher.getInstance("RSA/ECB/PKCS1Padding");/// cipher.init(Cipher.DECRYPT_MODE, this.privateKey); return cipher.doFinal(input); } privateKey and publicKey attributes are read from files this way : public PrivateKey readPrivKeyFromFile(String keyFileName) throws IOException { PrivateKey key = null; try { FileInputStream fin = new FileInputStream(keyFileName); ObjectInputStream ois = new ObjectInputStream(fin); BigInteger m = (BigInteger) ois.readObject(); BigInteger e = (BigInteger) ois.readObject(); RSAPrivateKeySpec keySpec = new RSAPrivateKeySpec(m, e); KeyFactory fact = KeyFactory.getInstance("RSA"); key = fact.generatePrivate(keySpec); ois.close(); } catch (Exception e) { e.printStackTrace(); } return key; } Private key and Public key are created this way : public void Initialize() throws Exception { KeyPairGenerator keygen = KeyPairGenerator.getInstance("RSA"); keygen.initialize(2048); keyPair = keygen.generateKeyPair(); KeyFactory fact = KeyFactory.getInstance("RSA"); RSAPublicKeySpec pub = fact.getKeySpec(keyPair.getPublic(), RSAPublicKeySpec.class); RSAPrivateKeySpec priv = fact.getKeySpec(keyPair.getPrivate(), RSAPrivateKeySpec.class); saveToFile("public.key", pub.getModulus(), pub.getPublicExponent()); saveToFile("private.key", priv.getModulus(), priv.getPrivateExponent()); } and then saved in files : public void saveToFile(String fileName, BigInteger mod, BigInteger exp) throws IOException { FileOutputStream f = new FileOutputStream(fileName); ObjectOutputStream oos = new ObjectOutputStream(f); oos.writeObject(mod); oos.writeObject(exp); oos.close(); } I can't figured out how the problem come from. Any help would be appreciate ! Thanks in advance.

    Read the article

  • How to use GWT when downloading Files with a Servlet?

    - by molleman
    Hello Guys I am creating a simple project that will allow me to upload and download files using gwt. i am having trouble with the downloading of files that are on my server. For the file upload i used http://code.google.com/p/gwtupload/ and followed the instructions there. My file is stored on the server outside of the website container(on the hard drive), Now when it comes to the downloading of a file, i want a user to press a download button and whatever item is currently selected will download. i dont really know how this will be done i know i need a download servlet public class DownloadAttachmentServlet extends HttpServlet { @Override protected void doPost(HttpServletRequest req, HttpServletResponse resp) throws ServletException, IOException { // TODO Auto-generated method stub super.doGet(req, resp); } @Override protected void doGet(HttpServletRequest req, HttpServletResponse resp) throws ServletException, IOException { String fileName = (String) req.getSession().getAttribute("fileName"); YFUser user = (YFUser) req.getSession().getAttribute(TestServiceImpl.SESSION_USER); if (user == null) throw new ServletException("Invalid Session"); InputStream in = null; OutputStream out = resp.getOutputStream(); FileInputStream fIn = new FileInputStream(fileName); byte[] buffer = new byte[4096]; int length; while ((length = in.read(buffer)) > 0){ out.write(buffer, 0, length); } in.close(); out.flush(); } } for the moment i will just pass a fileName string to retrieve the file for testing now i am lost at what to do on the client side, i have a simple public class DownloadFilePanel extends Composite { public DownloadFilePanel(final YFUser user , final String fileName){ final Element downloadIframe = RootPanel.get("__download").getElement(); VerticalPanel content = new VerticalPanel(); content.add(new Label("Download For this File : " + fileName)); Button button = new Button("Download"); button.addClickHandler(new ClickHandler(){ @Override public void onClick(ClickEvent event) { // i do not know what to do here }); content.add(button); initWidget(content); } } above is a simple widget that will supply a panel that will allow for the download of a file based on a fileName as you can see above, i do not know what to do to be able to download the file is there any one that can point me in the right direction?

    Read the article

  • Android - Custom Icons in ListView

    - by Ryan
    Is there any way to place a custom icon for each group item? Like for phone I'd like to place a phone, for housing I'd like to place a house. Here is my code, but it keeps throwing a Warning and locks up on me. ListView myList = (ListView) findViewById(R.id.myList); //ExpandableListAdapter adapter = new MyExpandableListAdapter(data); List<Map<String, Object>> groupData = new ArrayList<Map<String, Object>>(); Iterator it = data.entrySet().iterator(); while (it.hasNext()) { //Get the key name and value for it Map.Entry pair = (Map.Entry)it.next(); String keyName = (String) pair.getKey(); String value = pair.getValue().toString(); //Add the parents -- aka main categories Map<String, Object> curGroupMap = new HashMap<String, Object>(); groupData.add(curGroupMap); if (value == "Phone") curGroupMap.put("ICON", findViewById(R.drawable.phone)); else if (value == "Housing") curGroupMap.put("NAME", keyName); curGroupMap.put("VALUE", value); } // Set up our adapter mAdapter = new SimpleAdapter( mContext, groupData, R.layout.exp_list_parent, new String[] { "ICON", "NAME", "VALUE" }, new int[] { R.id.iconImg, R.id.rowText1, R.id.rowText2 } ); myList.setAdapter(mAdapter); The error i'm getting: 05-28 17:36:21.738: WARN/System.err(494): java.io.IOException: Is a directory 05-28 17:36:21.809: WARN/System.err(494): at org.apache.harmony.luni.platform.OSFileSystem.readImpl(Native Method) 05-28 17:36:21.838: WARN/System.err(494): at org.apache.harmony.luni.platform.OSFileSystem.read(OSFileSystem.java:158) 05-28 17:36:21.851: WARN/System.err(494): at java.io.FileInputStream.read(FileInputStream.java:319) 05-28 17:36:21.879: WARN/System.err(494): at java.io.BufferedInputStream.fillbuf(BufferedInputStream.java:183) 05-28 17:36:21.908: WARN/System.err(494): at java.io.BufferedInputStream.read(BufferedInputStream.java:346) 05-28 17:36:21.918: WARN/System.err(494): at android.graphics.BitmapFactory.nativeDecodeStream(Native Method) 05-28 17:36:21.937: WARN/System.err(494): at android.graphics.BitmapFactory.decodeStream(BitmapFactory.java:459) 05-28 17:36:21.948: WARN/System.err(494): at android.graphics.BitmapFactory.decodeFile(BitmapFactory.java:271) 05-28 17:36:21.958: WARN/System.err(494): at android.graphics.BitmapFactory.decodeFile(BitmapFactory.java:296) 05-28 17:36:21.978: WARN/System.err(494): at android.graphics.drawable.Drawable.createFromPath(Drawable.java:801) 05-28 17:36:21.988: WARN/System.err(494): at android.widget.ImageView.resolveUri(ImageView.java:501) 05-28 17:36:21.998: WARN/System.err(494): at android.widget.ImageView.setImageURI(ImageView.java:289) Thanks in advance for your help!!

    Read the article

  • Out of memory exception during scrolling of listview

    - by user1761316
    I am using facebook data like postedpicture,profile picture,name,message in my listview.I am getting an OOM error while doing fast scrolling of listview. I am also having scrollviewlistener in my application that loads more data when the scrollbar reaches the bottom of the screen.I just want to know whether I need to change anything in this class. imageLoader.DisplayImage(postimage.get(position).replace(" ", "%20"), postimg) ; I am using the above line to call the method in this imageloader class to set the bitmap to imageview. Here is my imageloader class import java.io.File; import java.io.FileInputStream; import java.io.FileNotFoundException; import java.io.FileOutputStream; import java.io.InputStream; import java.io.OutputStream; import java.net.HttpURLConnection; import java.net.URL; import java.util.Collections; import java.util.Map; import java.util.Stack; import java.util.WeakHashMap; import com.stellent.beerbro.Wall; import android.app.Activity; import android.content.Context; import android.graphics.Bitmap; import android.graphics.Bitmap.Config; import android.graphics.BitmapFactory; import android.graphics.Canvas; import android.graphics.Paint; import android.graphics.PorterDuff.Mode; import android.graphics.PorterDuffXfermode; import android.graphics.Rect; import android.graphics.RectF; import android.graphics.drawable.BitmapDrawable; import android.util.Log; import android.widget.ImageView; public class ImageLoader { MemoryCache memoryCache=new MemoryCache(); FileCache fileCache; private Map<ImageView, String> imageViews=Collections.synchronizedMap(new WeakHashMap<ImageView, String>()); public ImageLoader(Context context){ //Make the background thead low priority. This way it will not affect the UI performance photoLoaderThread.setPriority(Thread.NORM_PRIORITY-1); fileCache=new FileCache(context); } // final int stub_id=R.drawable.stub; public void DisplayImage(String url,ImageView imageView) { imageViews.put(imageView, url); System.gc(); // Bitmap bitmap=createScaledBitmap(memoryCache.get(url), 100,100,0); Bitmap bitmap=memoryCache.get(url); // Bitmap bitmaps=bitmap.createScaledBitmap(bitmap, 0, 100, 100); if(bitmap!=null) { imageView.setBackgroundDrawable(new BitmapDrawable(bitmap)); // imageView.setImageBitmap(getRoundedCornerBitmap( bitmap, 10,70,70)); // imageView.setImageBitmap(bitmap); // Log.v("first", "first"); } else { queuePhoto(url, imageView); // Log.v("second", "second"); } } private Bitmap createScaledBitmap(Bitmap bitmap, int i, int j, int k) { // TODO Auto-generated method stub return null; } private void queuePhoto(String url, ImageView imageView) { //This ImageView may be used for other images before. So there may be some old tasks in the queue. We need to discard them. photosQueue.Clean(imageView); PhotoToLoad p=new PhotoToLoad(url, imageView); synchronized(photosQueue.photosToLoad){ photosQueue.photosToLoad.push(p); photosQueue.photosToLoad.notifyAll(); } //start thread if it's not started yet if(photoLoaderThread.getState()==Thread.State.NEW) photoLoaderThread.start(); } public Bitmap getBitmap(String url) { File f=fileCache.getFile(url); //from SD cache Bitmap b = decodeFile(f); if(b!=null) return b; //from web try { Bitmap bitmap=null; URL imageUrl = new URL(url); HttpURLConnection conn = (HttpURLConnection)imageUrl.openConnection(); conn.setConnectTimeout(30000); conn.setReadTimeout(30000); InputStream is=conn.getInputStream(); OutputStream os = new FileOutputStream(f); Utils.CopyStream(is, os); os.close(); bitmap = decodeFile(f); return bitmap; } catch (Exception ex){ ex.printStackTrace(); return null; } }//Lalit //decodes image and scales it to reduce memory consumption private Bitmap decodeFile(File f){ try { //decode image size BitmapFactory.Options o = new BitmapFactory.Options(); o.inJustDecodeBounds = true; BitmapFactory.decodeStream(new FileInputStream(f),null,o); //Find the correct scale value. It should be the power of 2. final int REQUIRED_SIZE=Wall.width; final int REQUIRED_SIZE1=Wall.height; // final int REQUIRED_SIZE=250; // int width_tmp=o.outWidth, height_tmp=o.outHeight; int scale=1; // while(o.outWidth/scale/2>=REQUIRED_SIZE && o.outHeight/scale/2>=REQUIRED_SIZE) //// scale*=2; while(true){ if(width_tmp/2<REQUIRED_SIZE && height_tmp/2<REQUIRED_SIZE1) break; width_tmp/=2; height_tmp/=2; scale*=2; } //decode with inSampleSize BitmapFactory.Options o2 = new BitmapFactory.Options(); o2.inSampleSize=scale; // o2.inSampleSize=2; return BitmapFactory.decodeStream(new FileInputStream(f), null, o2); } catch (FileNotFoundException e) {} return null; } //Task for the queue private class PhotoToLoad { public String url; public ImageView imageView; public PhotoToLoad(String u, ImageView i){ url=u; imageView=i; } } PhotosQueue photosQueue=new PhotosQueue(); public void stopThread() { photoLoaderThread.interrupt(); } //stores list of photos to download class PhotosQueue { private Stack<PhotoToLoad> photosToLoad=new Stack<PhotoToLoad>(); //removes all instances of this ImageView public void Clean(ImageView image) { for(int j=0 ;j<photosToLoad.size();){ if(photosToLoad.get(j).imageView==image) photosToLoad.remove(j); else ++j; } } } class PhotosLoader extends Thread { public void run() { try { while(true) { //thread waits until there are any images to load in the queue if(photosQueue.photosToLoad.size()==0) synchronized(photosQueue.photosToLoad){ photosQueue.photosToLoad.wait(); } if(photosQueue.photosToLoad.size()!=0) { PhotoToLoad photoToLoad; synchronized(photosQueue.photosToLoad){ photoToLoad=photosQueue.photosToLoad.pop(); } Bitmap bmp=getBitmap(photoToLoad.url); memoryCache.put(photoToLoad.url, bmp); String tag=imageViews.get(photoToLoad.imageView); if(tag!=null && tag.equals(photoToLoad.url)){ BitmapDisplayer bd=new BitmapDisplayer(bmp, photoToLoad.imageView); Activity a=(Activity)photoToLoad.imageView.getContext(); a.runOnUiThread(bd); } } if(Thread.interrupted()) break; } } catch (InterruptedException e) { //allow thread to exit } } } PhotosLoader photoLoaderThread=new PhotosLoader(); //Used to display bitmap in the UI thread class BitmapDisplayer implements Runnable { Bitmap bitmap; ImageView imageView; public BitmapDisplayer(Bitmap b, ImageView i){bitmap=b;imageView=i;} public void run() { if(bitmap!=null) imageView.setBackgroundDrawable(new BitmapDrawable(bitmap)); } } public void clearCache() { memoryCache.clear(); fileCache.clear(); } public static Bitmap getRoundedCornerBitmap(Bitmap bitmap, int pixels,int width,int height) { Bitmap output = Bitmap.createBitmap(width,height, Config.ARGB_8888); Canvas canvas = new Canvas(output); final int color = 0xff424242; final Paint paint = new Paint(); final Rect rect = new Rect(0, 0, bitmap.getWidth(), bitmap.getHeight()); final RectF rectF = new RectF(rect); final float roundPx = pixels; paint.setAntiAlias(true); canvas.drawARGB(0, 0, 0, 0); paint.setColor(color); canvas.drawRoundRect(rectF, roundPx, roundPx, paint); paint.setXfermode(new PorterDuffXfermode(Mode.SRC_IN)); canvas.drawBitmap(bitmap, rect, rect, paint); return output; } }

    Read the article

  • Saxon XSLT-Transformation: How to change serialization of an empty tag from <x/> to <x></x>?

    - by Ben
    Hello folks! I do some XSLT-Transformation using Saxon HE 9.2 with the output later being unmarshalled by Castor 1.3.1. The whole thing runs with Java at the JDK 6. My XSLT-Transformation looks like this: <xsl:transform version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform" xmlns:ns="http://my/own/custom/namespace/for/the/target/document"> <xsl:output method="xml" encoding="UTF-8" indent="no" /> <xsl:template match="/"> <ns:item> <ns:property name="id"> <xsl:value-of select="/some/complicated/xpath" /> </ns:property> <!-- ... more ... --> </xsl:template> So the thing is: if the XPath-expression /some/complicated/xpath evaluates to an empty sequence, the Saxon serializer writes <ns:property/> instead of <ns:property></ns:property>. This, however, confuses the Castor unmarshaller, which is next in the pipeline and which unmarshals the output of the transformation to instances of XSD-generated Java-code. So my question is: How can I tell the Saxon-serializer to output empty tags not as standalone tags? Here is what I am proximately currently doing to execute the transformation: import net.sf.saxon.s9api.*; import javax.xml.transform.*; import javax.xml.transform.sax.SAXSource; // ... // read data XMLReader xmlReader = XMLReaderFactory.createXMLReader(); // ... there is some more setting up the xmlReader here ... InputStream xsltStream = new FileInputStream(xsltFile); InputStream inputStream = new FileInputStream(inputFile); Source xsltSource = new SAXSource(xmlReader, new InputSource(xsltStream)); Source inputSource = new SAXSource(xmlReader, new InputSource(inputStream)); XdmNode input = processor.newDocumentBuilder().build(inputSource); // initialize transformation configuration Processor processor = new Processor(false); XsltCompiler compiler = processor.newXsltCompiler(); compiler.setErrorListener(this); XsltExecutable executable = compiler.compile(xsltSource); Serializer serializer = new Serializer(); serializer.setOutputProperty(Serializer.Property.METHOD, "xml"); serializer.setOutputProperty(Serializer.Property.INDENT, "no"); serializer.setOutputStream(output); // execute transformation XsltTransformer transformer = executable.load(); transformer.setInitialContextNode(input); transformer.setErrorListener(this); transformer.setDestination(serializer); transformer.setSchemaValidationMode(ValidationMode.STRIP); transformer.transform(); I'd appreciate any hint pointing in the direction of a solution. :-) In case of any unclarity I'd be happy to give more details. Nightly greetings from Germany, Benjamin

    Read the article

  • Vaadin: Downloaded file has whole path as file name

    - by javydreamercsw
    I have a download action implemented on my Vaadin application but for some reason the downloaded file has the original file's full path as the file name. Any idea? You can see the code on this post. Edit: Here's the important part of the code: package com.bluecubs.xinco.core.server.vaadin; import com.bluecubs.xinco.core.server.XincoConfigSingletonServer; import com.vaadin.Application; import com.vaadin.terminal.DownloadStream; import com.vaadin.terminal.FileResource; import java.io.*; import java.net.URLEncoder; import java.util.UUID; import java.util.logging.Level; import java.util.logging.Logger; import java.util.zip.CRC32; import java.util.zip.CheckedInputStream; /** * * @author Javier A. Ortiz Bultrón<[email protected]> */ public class FileDownloadResource extends FileResource { private final String fileName; private File download; private File newFile; public FileDownloadResource(File sourceFile, String fileName, Application application) { super(sourceFile, application); this.fileName = fileName; } protected void cleanup() { if (newFile != null && newFile.exists()) { newFile.delete(); } if (download != null && download.exists() && download.listFiles().length == 0) { download.delete(); } } @Override public DownloadStream getStream() { try { //Copy file to directory for downloading InputStream in = new CheckedInputStream(new FileInputStream(getSourceFile()), new CRC32()); download = new File(XincoConfigSingletonServer.getInstance().FileRepositoryPath + System.getProperty("file.separator") + UUID.randomUUID().toString()); newFile = new File(download.getAbsolutePath() + System.getProperty("file.separator") + fileName); download.mkdirs(); OutputStream out = new FileOutputStream(newFile); newFile.deleteOnExit(); download.deleteOnExit(); byte[] buf = new byte[1024]; int len; while ((len = in.read(buf)) > 0) { out.write(buf, 0, len); } in.close(); out.close(); final DownloadStream ds = new DownloadStream( new FileInputStream(newFile), getMIMEType(), fileName); ds.setParameter("Content-Disposition", "attachment; filename=" + URLEncoder.encode(fileName, "utf-8")); ds.setCacheTime(getCacheTime()); return ds; } catch (final FileNotFoundException ex) { Logger.getLogger(FileDownloadResource.class.getName()).log(Level.SEVERE, null, ex); return null; } catch (IOException ex) { Logger.getLogger(FileDownloadResource.class.getName()).log(Level.SEVERE, null, ex); return null; } } } I already debugged and verified that fileName only contains the file's name not the whole path.

    Read the article

  • How to display specific data from a file

    - by user1067332
    My program is supposed to ask the user for firstname, lastname, and phone number till the users stops. Then when to display it asks for the first name and does a search in the text file to find all info with the same first name and display lastname and phones of the matches. import java.util.*; import java.io.*; import java.util.Scanner; public class WritePhoneList { public static void main(String[] args)throws IOException { BufferedWriter output = new BufferedWriter(new FileWriter(new File( "PhoneFile.txt"), true)); String name, lname, age; int pos,choice; try { do { Scanner input = new Scanner(System.in); System.out.print("Enter First name, last name, and phone number "); name = input.nextLine(); output.write(name); output.newLine(); System.out.print("Would you like to add another? yes(1)/no(2)"); choice = input.nextInt(); }while(choice == 1); output.close(); } catch(Exception e) { System.out.println("Message: " + e); } } } Here is the display code, when i search for a name, it finds a match but displays the last name and phone number of the same name 3 times, I want it to display all of the possible matches with the first name. import java.util.*; import java.io.*; import java.util.Scanner; public class DisplaySelectedNumbers { public static void main(String[] args)throws IOException { String name; String strLine; try { FileInputStream fstream = new FileInputStream("PhoneFile.txt"); // Get the object of DataInputStream DataInputStream in = new DataInputStream(fstream); BufferedReader br = new BufferedReader(new InputStreamReader(in)); Scanner input = new Scanner(System.in); System.out.print("Enter a first name"); name = input.nextLine(); strLine= br.readLine(); String[] line = strLine.split(" "); String part1 = line[0]; String part2 = line[1]; String part3 = line[2]; //Read File Line By Line while ((strLine= br.readLine()) != null) { if(name.equals(part1)) { // Print the content on the console System.out.print("\n" + part2 + " " + part3); } } }catch (Exception e) {//Catch exception if any System.out.println("Error: " + e.getMessage()); } } }

    Read the article

  • downloaded zip file returns zero has 0 bytes as size

    - by Yaw Reuben
    I have written a Java web application that allows a user to download files from a server. These files are quite large and so are zipped together before download. It works like this: 1. The user gets a list of files that match his/her criteria 2. If the user likes a file and wants to download he/she selects it by checking a checkbox 3. The user then clicks "download" 4. The files are then zipped and stored on a server 5. The user this then presented with a page which contains a link to the downloadable zip file 6. However on downloading the zip file the file that is downloaded is 0 bytes in size I have checked the remote server and the zip file is being created properly, all that is left is to serve the file the user somehow, can you see where I might be going wrong, or suggest a better way to serve the zip file. The code that creates the link is: <% String zipFileURL = (String) request.getAttribute("zipFileURL"); %> <p><a href="<% out.print(zipFileURL); %> ">Zip File Link</a></p> The code that creates the zipFileURL variable is: public static String zipFiles(ArrayList<String> fileList, String contextRootPath) { //time-stamping Date date = new Date(); Timestamp timeStamp = new Timestamp(date.getTime()); Iterator fileListIterator = fileList.iterator(); String zipFileURL = ""; try { String ZIP_LOC = contextRootPath + "WEB-INF" + SEP + "TempZipFiles" + SEP; BufferedInputStream origin = null; zipFileURL = ZIP_LOC + "FITS." + timeStamp.toString().replaceAll(":", ".").replaceAll(" ", ".") + ".zip"; FileOutputStream dest = new FileOutputStream(ZIP_LOC + "FITS." + timeStamp.toString().replaceAll(":", ".").replaceAll(" ", ".") + ".zip"); ZipOutputStream out = new ZipOutputStream(new BufferedOutputStream( dest)); // out.setMethod(ZipOutputStream.DEFLATED); byte data[] = new byte[BUFFER]; while(fileListIterator.hasNext()) { String fileName = (String) fileListIterator.next(); System.out.println("Adding: " + fileName); FileInputStream fi = new FileInputStream(fileName); origin = new BufferedInputStream(fi, BUFFER); ZipEntry entry = new ZipEntry(fileName); out.putNextEntry(entry); int count; while ((count = origin.read(data, 0, BUFFER)) != -1) { out.write(data, 0, count); } origin.close(); } out.close(); } catch (Exception e) { e.printStackTrace(); } return zipFileURL; }

    Read the article

  • Test if file exists

    - by klaus-vlad
    Hi, I'm trying to open a file in android like this : try { FileInputStream fIn = context.openFileInput(FILE); DataInputStream in = new DataInputStream(fIn); BufferedReader br = new BufferedReader(new InputStreamReader(in)); if(in!=null) in.close(); } catch(Exception e) { } , but in case the file does not exists a file not found exception is thrown . I'd like to know how could I test if the file exists before attempting to open it.

    Read the article

  • Saving file to phone in stead of SD-card

    - by Galip
    Hi guys, In my app I save an XML file to the users SD-card by doing File newxmlfile = new File(Environment.getExternalStorageDirectory() + "/Message.xml"); But not all users have SD-cards in their phone and therefore my app is likely to crash. How must I change my File creating method in order to save the file to the phone's memory instead of the SD-card? Also, how must I change the loading of the file? (currently: new InputSource(new FileInputStream(Environment.getExternalStorageDirectory() + "/Message.xml")))

    Read the article

  • Loading jar file using JCL(JarClassLoader ) : classpath in manifest is ignored ..

    - by Xinus
    I am trying to load jar file using JCL using following code FileInputStream fis = new FileInputStream(new File( "C:\\Users\\sunils\\glassfish-tests\\working\\test.jar") ); JarClassLoader jc = new JarClassLoader( ); jc.add(fis); Class main = jc.loadClass( "highmark.test.Main" ); String[] str={}; main.getMethod("test").invoke(null);//.getDeclaredMethod("main",String[].class).invoke(null,str); fis.close(); But when I try to run this program I get Exception as Exception in thread "main" java.lang.reflect.InvocationTargetException at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at Main.main(Main.java:21) Caused by: java.lang.RuntimeException: Embedded startup not found, classpath is probably incomplete at org.glassfish.api.embedded.Server.<init>(Server.java:292) at org.glassfish.api.embedded.Server.<init>(Server.java:75) at org.glassfish.api.embedded.Server$Builder.build(Server.java:185) at org.glassfish.api.embedded.Server$Builder.build(Server.java:167) at highmark.test.Main.test(Main.java:33) ... 5 more According to this it is not able to locate class, But when I run the jar file explicitly it runs fine. It seems like JCL is ignoring other classes present in the jar file, MANIFEST.MF file in jar file shows: Manifest-Version: 1.0 Class-Path: . Main-Class: highmark.test.Main It seems to be ignoring Class-Path: . , This jar file runs fine when I run it using Java explicitly, This is just a test, in reality this jar file is coming as a InputStream and it cannot be stored in filesystem, How can I overcome this problem , Is there any workaround ? Thanks for any help . UNDATE: Here is a jar Main class : package highmark.test; import org.glassfish.api.embedded.*; import java.io.*; import org.glassfish.api.deployment.*; import com.sun.enterprise.universal.io.FileUtils; public class Main { public static void main(String[] args) throws IOException, LifecycleException, ClassNotFoundException { test(); } public static void test() throws IOException, LifecycleException, ClassNotFoundException{ Server.Builder builder = new Server.Builder("test"); Server server = builder.build(); server.createPort(8080); ContainerBuilder containerBuilder = server.createConfig(ContainerBuilder.Type.web); server.addContainer(containerBuilder); server.start(); File war=new File("C:\\Users\\sunils\\maventests\\simple-webapp\\target\\simple-webapp.war");//(File) inputStream.readObject(); EmbeddedDeployer deployer = server.getDeployer(); DeployCommandParameters params = new DeployCommandParameters(); params.contextroot = "simple"; deployer.deploy(war, params); } }

    Read the article

  • Uploading file to DropBox causing UnlinkedException

    - by Boardy
    I am currently working on android project and trying to enable DropBox functionality. I've selected the access type to App Only, and I can successfully authenticate and it creates an Apps directory and inside that creates a directory with the name of my app. When I then try to put a file in the DropBox directory it goes into the DropBoxException catch and in the logcat prints com.dropbox.client2.exception.DropboxUnlinkedException. I've done a google and from what I've seen this happens if the apps directory has been deleted and so authentication is required to be re-done, but this isn't the case, I have deleted it and I am putting the file straight after doing the authentication. Below is the code that retrieves the keys and stores the file on dropbox. AccessTokenPair tokens = getTokens(); UploadFile uploadFile = new UploadFile(context, common, this, mDBApi); uploadFile.execute(mDBApi); Below is the code for the getTokens method (don't think this would help but you never know) private AccessTokenPair getTokens() { AccessTokenPair tokens; SharedPreferences prefs = context.getSharedPreferences("prefs", 0); String key = prefs.getString("dropbox_key", ""); String secret = prefs.getString("dropbox_secret", ""); tokens = new AccessTokenPair(key, secret); return tokens; } Below is the class that extends the AsyncTask to perform the upload class UploadFile extends AsyncTask<DropboxAPI<AndroidAuthSession>, Void, bool> { Context context; Common common; Synchronisation sync; DropboxAPI<AndroidAuthSession> mDBApi; public UploadFile(Context context, Common common, Synchronisation sync, DropboxAPI<AndroidAuthSession> mDBApi) { this.context = context; this.common = common; this.sync = sync; this.mDBApi = mDBApi; } @Override protected bool doInBackground(DropboxAPI<AndroidAuthSession>... params) { try { File file = new File(Environment.getExternalStorageDirectory() + "/BoardiesPasswordManager/dropbox_sync.xml"); FileInputStream inputStream = new FileInputStream(file); Entry newEntry = mDBApi.putFile("android_sync.xml", inputStream, file.length(), null, null); common.showToastMessage("Successfully uploade Rev: " + newEntry.rev, Toast.LENGTH_LONG); } catch (IOException ex) { Log.e("DropBoxError", ex.toString()); } catch (DropboxException e) { Log.e("DropBoxError", e.toString()); e.printStackTrace(); } return null; } I have no idea why it would display the UnlinkedException so any help would be greatly appreciated.

    Read the article

  • Java io ugly try-finally block

    - by Tom Brito
    Is there a not so ugly way of treat the close() exception to close both streams then: InputStream in = new FileInputStream(inputFileName); OutputStream out = new FileOutputStream(outputFileName); try { copy(in, out); } finally { try { in.close(); } catch (Exception e) { try { // event if in.close fails, need to close the out out.close(); } catch (Exception e2) {} throw e; // and throw the 'in' exception } out.close(); }

    Read the article

< Previous Page | 2 3 4 5 6 7 8 9 10 11  | Next Page >