Search Results

Search found 59326 results on 2374 pages for 'full text search'.

Page 61/2374 | < Previous Page | 57 58 59 60 61 62 63 64 65 66 67 68  | Next Page >

  • Best practice No1: inline search layout across browsers

    - by Sixfoot Studio
    Ok, I have managed to fix my version of this example using a multitude of hacks and I would like to see how others would tackle this problem making this cross-browser compatible without too many hacks. <div class="searchDiv"> <img src="Images/left.gif" class="left" height="19" width="3" /> <input id="TextBox" type="text" class="searchField" /> <img src="Images/right.gif" height="19"width="3" class="right" /> <a href="" class="submit">Submit</a> <img src="Images/box-arrow.gif" class="linkArrow" width="8" height="14" /> </div> I am using a Transitional DTD in my example. Based on the everyone else's CSS examples, comments and answers I will make the final vote. I'd love to see more of these scenarios come up so that people have a library of "best practice" methods which they can find on SO. Good luck

    Read the article

  • shell scripting: search/replace & check file exist

    - by johndashen
    I have a perl script (or any executable) E which will take a file foo.xml and write a file foo.txt. I use a Beowulf cluster to run E for a large number of XML files, but I'd like to write a simple job server script in shell (bash) which doesn't overwrite existing txt files. I'm currently doing something like #!/bin/sh PATTERN="[A-Z]*0[1-2][a-j]"; # this matches foo in all cases todo=`ls *.xml | grep $PATTERN -o`; isdone=`ls *.txt | grep $PATTERN -o`; whatsleft=todo - isdone; # what's the unix magic? #tack on the .xml prefix with sed or something #and then call the job server; jobserve E "$whatsleft"; and then I don't know how to get the difference between $todo and $isdone. I'd prefer using sort/uniq to something like a for loop with grep inside, but I'm not sure how to do it (pipes? temporary files?) As a bonus question, is there a way to do lookahead search in bash grep? To clarify: so the simplest way to do what i'm asking is (in pseudocode) for i in `/bin/ls *.xml` do replace xml suffix with txt if [that file exists] add to whatsleft list end done

    Read the article

  • What is the correct way to implement a massive hierarchical, geographical search for news?

    - by Philip Brocoum
    The company I work for is in the business of sending press releases. We want to make it possible for interested parties to search for press releases based on a number of criteria, the most important being location. For example, someone might search for all news sent to New York City, Massachusetts, or ZIP code 89134, sent from a governmental institution, under the topic of "traffic". Or whatever. The problem is, we've sent, literally, hundreds of thousands of press releases. Searching is slow and complex. For example, a press release sent to Queens, NY should show up in the search I mentioned above even though it wasn't specifically sent to New York City, because Queens is a subset of New York City. We may also want to implement "and" and "or" and negation and text search to the query to create complex searches. These searches also have to be fast enough to function as dynamic RSS feeds. I really don't know anything about search theory, or how it's properly done. The way we are getting by right now is using a data mart to store the locations the releases were sent to in a single table. However, because of the subset thing mentioned above, the data mart is gigantic with millions of rows. And we haven't even implemented cities yet, and there are about 50,000 cities in the United States, which will exponentially increase the size of the data mart by so much I'm afraid it just won't work anymore. Anyway, I realize this is not a simple question and there won't be a "do this" answer. However, I'm hoping one of you can point me in the right direction where I can learn about how massive searches are done? Because I really know nothing about it. And such a search engine is turning out to be incredibly difficult to make. Thanks! I know there must be a way because if Google can search the entire internet we must be able to search our own database :-)

    Read the article

  • average case running time of linear search algorithm

    - by Brahadeesh
    Hi all. I am trying to derive the average case running time for deterministic linear search algorithm. The algorithm searches an element x in an unsorted array A in the order A[1], A[2], A[3]...A[n]. It stops when it finds the element x or proceeds until it reaches the end of the array. I searched on wikipedia and the answer given was (n+1)/(k+1) where k is the number of times x is present in the array. I approached in another way and am getting a different answer. Can anyone please give me the correct proof and also let me know whats wrong with my method? E(T)= 1*P(1) + 2*P(2) + 3*P(3) ....+ n*P(n) where P(i) is the probability that the algorithm runs for 'i' time (i.e. compares 'i' elements). P(i)= (n-i)C(k-1) * (n-k)! / n! Here, (n-i)C(k-1) is (n-i) Choose (k-1). As the algorithm has reached the ith step, the rest of k-1 x's must be in the last n-i elements. Hence (n-i)C(k-i). (n-k)! is the total number of ways of arranging the rest non x numbers, and n! is the total number of ways of arranging the n elements in the array. I am not getting (n+1)/(k+1) on simplifying.

    Read the article

  • PHP: If no Results - Split the Searchrequest and Try to find Parts of the Search

    - by elmaso
    Hello, i want to split the searchrequest into parts, if there's nothing to find. example: "nelly furtado ft. jimmy jones" - no results - try to find with nelly, furtado, jimmy or jones.. i have an api url.. thats the difficult part.. i show you some of the actually snippets: $query = urlencode (strip_tags ($_GET[search])); and $found = '0'; if ($source == 'all') { if (!($res = @get_url ('http://api.example.com/?key=' . $API . '&phrase=' . $query . ' . '&sort=' . $sort))) { exit ('<error>Cannot get requested information.</error>'); ; } how can i put a else request in this snippet, like if nothing found take the first word, or the second word, is this possible? or maybe you can tell me were i can read stuff about this function? thank you!!

    Read the article

  • Inverted index in a search engine

    - by Ayman
    Hello there, I'm trying to write some code to make a small application for searching text from files. Files should be crawled, and I need to put an inverted index to boost searches. My problem is that I kind of have ideas about how the parser would be, I'm willing to implement the AND, NOT, OR in the query. Whereas, I couldn't figure out how my index should be... I have never created an inverted index so if any body could suggest a feasable way to do it I would be very grateful... I do know in theory how it works but my problem is I absolutely have no idea to make happen in MySql I need to give keywords being indexed a weight too... Thank you so much.

    Read the article

  • Binary Search Tree - Postorder logic

    - by daveb
    I am looking at implementing code to work out binary search tree. Before I do this I was wanting to verify my input data in postorder and preorder. I am having trouble working out what the following numbers would be in postorder and preorder I have the following numbers 4, 3, 14 ,8 ,1, 15, 9, 5, 13, 10, 2, 7, 6, 12, 11, that I am intending to put into an empty binary tree in that order. The order I arrived at for the numbers in POSTORDER is 2, 1, 6, 3, 7, 11, 12, 10, 9, 8, 13, 15, 14, 4. Have I got this right? I was wondering if anyone here would be able to kindly verify if the postorder sequence I came up with is indeed the correct sequence for my input i.e doing left subtree, right subtree and then root. The order I got for pre order (Visit root, do left subtree, do right subtree) is 4, 3, 1, 2, 5, 6, 14 , 8, 7, 9, 10, 12, 11, 15, 13. I can't be certain I got this right. Very grateful for any verification. Many Thanks

    Read the article

  • Text box creates gap when floated left in IE7

    - by Sixfoot Studio
    Hi, I've got a left rounded corner box - textbox - right rounded corner box which all make up part of a search box. All's well in FF, Chrome, IE8 but not IE7. I've checked it using the debug tool and and I have tried a number of options, none of which want to work at the moment, so I am hoping someone might know what this issue (bug) might be please? Here's a snippet of my code: <div class="roundBox4"> <img src="../App_Themes/MyChoice2010/Images/reality-box-top.gif" width="228" height="8" /><img src="../App_Themes/MyChoice2010/Images/reality-box-locate.gif" width="228" height="49" /> <asp:ContentPlaceHolder ID="Box4Content" runat="server"> </asp:ContentPlaceHolder> <div class="locateABroker"> <img src="../App_Themes/MyChoice2010/Images/locate-broker-left.gif" class="locateBrokerLeft" height="19" width="3" /><asp:TextBox ID="TextBox1" CssClass="locateBrokerCenter" runat="server"></asp:TextBox><img src="../App_Themes/MyChoice2010/Images/locate-broker-right.gif" height="19" width="3" class="locateBrokerRight" /> <a href="" class="locateBrokerSubmit">Submit</a><img src="../App_Themes/MyChoice2010/Images/box-arrow.gif" class="linkArrow" width="8" height="14" /> </div>

    Read the article

  • how do i filter my lucene search results?

    - by Andrew Bullock
    Say my requirement is "search for all users by name, who are over 18" If i were using SQL, i might write something like: Select * from [Users] Where ([firstname] like '%' + @searchTerm + '%' OR [lastname] like '%' + @searchTerm + '%') AND [age] >= 18 However, im having difficulty translating this into lucene.net. This is what i have so far: var parser = new MultiFieldQueryParser({ "firstname", "lastname"}, new StandardAnalyser()); var luceneQuery = parser.Parse(searchterm) var query = FullTextSession.CreateFullTextQuery(luceneQuery, typeof(User)); var results = query.List<User>(); How do i add in the "where age = 18" bit? I've heard about .SetFilter(), but this only accepts LuceneQueries, and not IQueries. If SetFilter is the right thing to use, how do I make the appropriate filter? If not, what do I use and how do i do it? Thanks! P.S. This is a vastly simplified version of what I'm trying to do for clarity, my WHERE clause is actually a lot more complicated than shown here. In reality i need to check if ids exist in subqueries and check a number of unindexed properties. Any solutions given need to support this. Thanks

    Read the article

  • ASP.NET Conditionally Change ButtonField text at runTime

    - by Rodney Vinyard
    ASP.NET Conditionally Change ButtonField text at runTime   <asp:ButtonField CommandName="Edit" HeaderText="" Text="Edit" ButtonType="Link" />       protected void gvRequests_RowDataBound(object sender, GridViewRowEventArgs e)     {         if (e.Row.RowType == DataControlRowType.DataRow)         {             //----------------------------------------------------             // If status = "Saved", change buttonField.LinkButton.Text to "Copy"             //----------------------------------------------------             if (e.Row.Cells[(int)gCol.Status].Text == "Saved")             {                 //----------------------------------------------------                 // no !                 //----------------------------------------------------                 //string x = e.Row.Cells[(int)gCol.EditLink].Text;                 //e.Row.Cells[(int)gCol.EditLink].Text = "Copy";                   //----------------------------------------------------                 // yes !                 //----------------------------------------------------                 LinkButton linkButton = (LinkButton)e.Row.Cells[(int)gCol.EditLink].Controls[0];                 linkButton.Text = "Copy";             }         }     }

    Read the article

  • Google Image Search Quick Fix

    - by Asian Angel
    Are you tired of unneeded webpage loading and extra link clicking just to access an image found using Google Image Search? Now you can jump directly to the image itself with the clickGOOGLEview extension for Google Chrome. The Problem When you find an image that you like using Google Image Search you always have to go through extra hassle just to get to the image itself. First you have an entire webpage loading in your browser and then you have to click through that irritating “See full size image” link. All that you need is the image, right? Problem Fixed Once you have installed the clickGOOGLEview extension you will absolutely love the result. Find an image that you like, click the link, and there is your new image without any of the hassle or extra link clicking. Big or small having direct access to the image is how it should have been from the beginning. Conclusion The clickGOOGLEview extension does one thing and does it extremely well…it gets you to those images without the extra hassle or additional link clicking. Links Download the clickGOOGLEview extension (Google Chrome Extensions) Similar Articles Productive Geek Tips Make Firefox Quick Search Use Google’s Beta Search KeysChange Internet Explorer in Windows Vista to Search Google by DefaultMake Firefox Built-In Search Box Use Google’s Experimental Search KeysQuick Tip: Show PageRank in Firefox while Google Toolbar is HiddenQuick Tip: Use Google Talk Sidebar in Firefox TouchFreeze Alternative in AutoHotkey The Icy Undertow Desktop Windows Home Server – Backup to LAN The Clear & Clean Desktop Use This Bookmarklet to Easily Get Albums Use AutoHotkey to Assign a Hotkey to a Specific Window Latest Software Reviews Tinyhacker Random Tips Revo Uninstaller Pro Registry Mechanic 9 for Windows PC Tools Internet Security Suite 2010 PCmover Professional Kill Processes Quickly with Process Assassin Need to Come Up with a Good Name? Try Wordoid StockFox puts a Lightweight Stock Ticker in your Statusbar Explore Google Public Data Visually The Ultimate Excel Cheatsheet Convert the Quick Launch Bar into a Super Application Launcher

    Read the article

  • Change input text to regular text on blur and ability to edit jQuery

    - by eknown
    I'm creating a form where I'm eliminating the use of a save button. The form is made up of input text boxes and textareas. After the user enters data into the input field, I want to trigger an onBlur function and change the input into a span that contains the information that the user entered. I also want to have the ability to edit this information, so if the user clicks on the newly created span with text, it will turn back into the input field with the current information for their editing pleasure. For reference, I'm looking to have a functionality pretty much like on editing a photo title on Flickr. If possible, I'd also like to have the textbox show "saving..." for half a second after the blur to reflect interaction with server.

    Read the article

  • Issue with parsed text with HTMLCleaner - spaces at the begining of text

    - by ansol90
    Im able to get text using HTMLCleaner from website. The problem is that when I set the text to a TextView it shows the beginning of the text with a big space on it. Here is the screenshot of what im talking about. I have tried android:gravity but nothing happened. Please help. Here is my Code: private class SiteParser extends AsyncTask<String, Void, String> { protected String doInBackground(String... arg) { String output = null; try { HtmlHelper hh = new HtmlHelper(new URL(arg[0])); List<TagNode> news = hh.getnewsByClass("TextoPrint"); for (Iterator<TagNode> iterator = newss.iterator(); iterator .hasNext();) { TagNode divElement = (TagNode) iterator.next(); output = divElement.getText().toString(); } } catch (Exception e) { e.printStackTrace(); } return output; } protected void onPostExecute(String output) { Bundle bundle=new Bundle(); bundle.putString("body",output); Intent mainIntent = new Intent(act, MyView.class); mainIntent.putExtras(bundle); startActivity(mainIntent); act.finish(); } } public class HtmlHelper { TagNode rootNode; public HtmlHelper(URL htmlPage) throws IOException, XPatherException { HtmlCleaner cleaner = new HtmlCleaner(); rootNode = cleaner.clean(htmlPage); } List<TagNode> getnewsByClass(String Classname){ List<TagNode> newsList = new ArrayList<TagNode>(); TagNode divElements[] = rootNode.getElementsByName("div", true); for (int i = 0; divElements != null && i < divElements.length; i++) { String classType = divElements[i].getAttributeByName("id"); if (classType != null && classType.equals(Classname)) { newsList.add(divElements[i]); } } return newsList; } }

    Read the article

  • knockout bind text label to dropdown value selected option text

    - by Adam Levitt
    Is there a simple way to bind the textbox of a div to change based on the text value of the selected option in a dropdown on the same page? <div data-bind="text: dropdownValue"></div> <select> <option value="1">Value1</option> <option value="2">Value2</option> </select> Please note, I don't want to put the values into the select element using javascript. I'd like to bind to the value straight from the HTML. I can also include jQuery to make it work.

    Read the article

  • does lucene search function work in large size document?

    - by shaon-fan
    Hi,there I have a problem when do search with lucene. First, in lucene indexing function, it works well to huge size document. such as .pst file, the outlook mail storage. It can build indexing file include all the information of .pst. The only problem is to large sometimes, include very much words. So when i search using lucene, it only can process the front part of this indexing file, if one word come out the back part of the indexing file, it couldn't find this word and no hits in result. But when i separate this indexing file to several parts in stupid way when debugging, and searching every parts, it can work well. So i want to know how to separate indexing file, how much size should be the limit of searching? cheers and wait 4 reply. ++++++++++++++++++++++++++++++++++++++++++++++++++ hi,there, follow Coady siad, i set the length to max 2^31-1. But the search result still can't include what i want. simply, i convert the doc word to string array[] to analyze, one doc word has 79680 words include the space and any symbol. when i search certain word, it just return 300 count, actually it has more than 300 results. The same reason, when i search a word in back part of the doc, it also couldn't find. //////////////set the length idexwriter.SetMaxFieldLength(2147483647); ////////////////////search IndexSearcher searcher = new ndexSearcher(Program.Parameters["INDEX_LOCATION"].ToString()); Hits hits = searcher.Search(query); This is my code, as others same. I found that problem when i need to count every word hits in a doc. So i also found it couldn't search word in back part of doc. pls help me to find, is there any set searcher length somewhere? how u meet this problem.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Send SMS text messages for FREE using Java ME

    - by hinkmond
    Here's a way to get around those nasty SMS text messages charges (and maybe a way to get around the Pakistan SMS text censors too!). Use this Java ME SMS text app for your Java ME mobile phone, called JaxtrSMS: See: JaxtrSMS free Java ME SMS Here's a quote: JaxtrSMS lets you send FREE SMS and txt messages to any mobile phone in the world. Best of all, the receiver does not have to have the JaxtrSMS app. International and local SMS/texting can be expensive but with JaxtrSMS you can text anyone in the world for FREE! Great! Now, you can send 2,000 text messages from your phone every month and not worry about a huge bill. You don't send 2,000 text message in a month? Well, get it for your teenage kids then. They certainly send 2,000 text messages in a month... Hinkmond

    Read the article

  • Where can I find a list of reserved words for Oracle fulltext search?

    - by Tyronomo
    I've a client testing the full text (example below) search on a new Oracle UCM site. The random text string they chose to test was 'test only'. Which failed; from my testing it seems 'only' is a reserved word, as it is never returned from a full text search (it is returned from metadata searches). I've spent the morning searching oracle.com and found this which seems pretty comprehensive, yet does not have 'only'. So my question is thus, is 'only' a reserved word. Where can I find a complete list of reserved words for Oracle full text search (10g)? Full text search string example; (<ftx>test only</ftx>)

    Read the article

  • Sorting data by relevance, from multiple tables

    - by Oden
    Hey, How is it possible to sort data from multiple tables by relevance? My table structure is following: I have 3 tables in my database, one table contains the name of solar systems, the second for e.g. of planets. There is one more table, witch is a connection between solar systems and planets. If I want to get data of a planet, witch is in the Milky Way, i post this data to the server, and it gives me a multi-dimensional array witch contains: The Milky Way, with every planet in it Every planet, witch name contains the string Milky Way (maybe thats a bat example because i don't think that theres but one planet with this name, but the main concept is on file) But, i want to set the most relevant restaurants to the top of the array. (for the relevance i would check the description of the restaurants or something like that) So, how would you do that kind of data sorting?

    Read the article

  • Hide a single content block from search engines?

    - by jonas
    A header is automatically added on top of each content URL, but its not relevant for search and messing up the all the results beeing the first line of every page (in the code its the last line but visually its the first, which google is able to notice) Solution1: You could put the header (content to exculde from google searches) in an iframe with a static url domain.com/header.html and a <meta name="robots" content="noindex" /> ? - are there takeoffs of this solution? Solution2: You could deliver it conditionally by apache mod rewrite, php or javascript -takeoff(?): google does not like it? will google ever try pages with a standard users's useragent and compare? -takeoff: The hidden content will be missing in the google cache version as well... example: add-header.php: <?php $path = $_GET['path']; echo file_get_contents($_SERVER["DOCUMENT_ROOT"].$path); ?> apache virtual host config: RewriteCond %{HTTP_USER_AGENT} !.*spider.* [NC] RewriteCond %{HTTP_USER_AGENT} !Yahoo.* [NC] RewriteCond %{HTTP_USER_AGENT} !Bing.* [NC] RewriteCond %{HTTP_USER_AGENT} !Yandex.* [NC] RewriteCond %{HTTP_USER_AGENT} !Baidu.* [NC] RewriteCond %{HTTP_USER_AGENT} !.*bot.* [NC] RewriteCond %{SCRIPT_FILENAME} \.htm$ [NC,OR] RewriteCond %{SCRIPT_FILENAME} \.html$ [NC,OR] RewriteCond %{SCRIPT_FILENAME} \.php$ [NC] RewriteRule ^(.*)$ /var/www/add-header.php?path=%1 [L]

    Read the article

  • Changing Text colour in text field by dropdown menu - Visual Studio 2008

    - by Wayne
    Hey, i'm just doing some testing on Visual Studio 2008, what i'm trying to do is to change the text colour inside the multi-textfield which isn't working and I don't know why... Public Class Form1 Dim ColourValue As Color Private Sub Form1_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load rbBlue.Checked = False rbRed.Checked = False rbGreen.Checked = False End Sub Private Sub rbRed_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbRed.CheckedChanged txtSpace.BackColor = Color.Red End Sub Private Sub rbBlue_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbBlue.CheckedChanged txtSpace.BackColor = Color.Blue End Sub Private Sub rbGreen_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbGreen.CheckedChanged txtSpace.BackColor = Color.Green End Sub Private Sub cbColours_SelectedValueChanged(ByVal sender As Object, ByVal e As System.EventArgs) Handles cbColours.SelectedValueChanged ColourValue = cbColours.SelectedValue txtSpace.BackColor = ColourValue End Sub End Class Basically i have the radio buttons that would change the background colour of the textfield, but i just need the dropdown menu to change the text colour. Many thanks :)

    Read the article

  • When page loads display 1st image text - hide all other text

    - by Jonah1289
    Hi I have created http://techavid.com/design/test3.html and when you load the page you see there are 3 images. The sun image is focused(in color), while the others are greyed out until clicked. That is how it should be for the images. Also when you load the page you see under each image it's own text(i.e. 1st: Sun, 2nd: Airplane, 3rd: Nano), but on page load I only want 1st:Sun to display and hide all other text until their respective image is clicked. Any idea how to do this? thanks :) J

    Read the article

  • Refining Search Results [PHP/MySQL]

    - by Dae
    I'm creating a set of search panes that allow users to tweak their results set after submitting a query. We pull commonly occurring values in certain fields from the results and display them in order of their popularity - you've all seen this sort of thing on eBay. So, if a lot of rows in our results were created in 2009, we'll be able to click "2009" and see only rows created in that year. What in your opinion is the most efficient way of applying these filters? My working solution was to discard entries from the results that didn't match the extra arguments, like: while($row = mysql_fetch_assoc($query)) { foreach($_GET as $key => $val) { if($val !== $row[$key]) { continue 2; } } // Output... } This method should hopefully only query the database once in effect, as adding filters doesn't change the query - MySQL can cache and reuse one data set. On the downside it makes pagination a bit of a headache. The obvious alternative would be to build any additional criteria into the initial query, something like: $sql = "SELECT * FROM tbl MATCH (title, description) AGAINST ('$search_term')"; foreach($_GET as $key => $var) { $sql .= " AND ".$key." = ".$var; } Are there good reasons to do this instead? Or are there better options altogether? Maybe a temporary table? Any thoughts much appreciated!

    Read the article

  • Cakephp, Route old google search results to new home page

    - by ion
    Hi there, I have created a new website for a company and I would like all the previous search engine results to be redirected. Since there were quite a few pages and most of them where using an id I would like to use something generic instead of re-routing all the old pages. My first thought was to do that: Router::connect('/*', array('controller' => 'pages', 'action' => 'display', 'home')); And put that at the very end of the routes.php file [since it is prioritized] so that all requests not validating with previous route actions would return true with this one and redirect to homepage. However this does not work. I'm pasting my routes.php file [since it is small] hoping that someone could give me a hint: Router::connect('/', array('controller' => 'pages', 'action' => 'display', 'home')); Router::connect('/company/*', array('controller' => 'articles', 'action' => 'view')); Router::connect('/contact/*', array('controller' => 'contacts', 'action' => 'view')); Router::connect('/lang/*', array('controller' => 'p28n', 'action' => 'change')); Router::connect('/eng/*', array('controller' => 'p28n', 'action' => 'shuntRequest', 'lang' => 'eng')); Router::connect('/gre/*', array('controller' => 'p28n', 'action' => 'shuntRequest', 'lang' => 'gre')); Router::parseExtensions('xml');

    Read the article

< Previous Page | 57 58 59 60 61 62 63 64 65 66 67 68  | Next Page >