Search Results

Search found 15712 results on 629 pages for 'location href'.

Page 619/629 | < Previous Page | 615 616 617 618 619 620 621 622 623 624 625 626  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • changing output in objective-c app

    - by Zack
    // // RC4.m // Play5 // // Created by svp on 24.05.10. // Copyright 2010 __MyCompanyName__. All rights reserved. // #import "RC4.h" @implementation RC4 @synthesize txtLyrics; @synthesize sbox; @synthesize mykey; - (IBAction) clicked: (id) sender { NSData *asciidata1 = [@"4875" dataUsingEncoding:NSASCIIStringEncoding allowLossyConversion:YES]; NSString *asciistr1 = [[NSString alloc] initWithData:asciidata1 encoding:NSASCIIStringEncoding]; //[txtLyrics setText:@"go"]; NSData *asciidata = [@"sdf883jsdf22" dataUsingEncoding:NSASCIIStringEncoding allowLossyConversion:YES]; NSString *asciistr = [[NSString alloc] initWithData:asciidata encoding:NSASCIIStringEncoding]; //RC4 * x = [RC4 alloc]; [txtLyrics setText:[self decrypt:asciistr1 andKey:asciistr]]; } - (NSMutableArray*) hexToChars: (NSString*) hex { NSMutableArray * arr = [[NSMutableArray alloc] init]; NSRange range; range.length = 2; for (int i = 0; i < [hex length]; i = i + 2) { range.location = 0; NSString * str = [[hex substringWithRange:range] uppercaseString]; unsigned int value; [[NSScanner scannerWithString:str] scanHexInt:&value]; [arr addObject:[[NSNumber alloc] initWithInt:(int)value]]; } return arr; } - (NSString*) charsToStr: (NSMutableArray*) chars { NSString * str = @""; for (int i = 0; i < [chars count]; i++) { str = [NSString stringWithFormat:@"%@%@",[NSString stringWithFormat:@"%c", [chars objectAtIndex:i]],str]; } return str; } //perfect except memory leaks - (NSMutableArray*) strToChars: (NSString*) str { NSData *asciidata = [str dataUsingEncoding:NSASCIIStringEncoding allowLossyConversion:YES]; NSString *asciistr = [[NSString alloc] initWithData:asciidata encoding:NSASCIIStringEncoding]; NSMutableArray * arr = [[NSMutableArray alloc] init]; for (int i = 0; i < [str length]; i++) { [arr addObject:[[NSNumber alloc] initWithInt:(int)[asciistr characterAtIndex:i]]]; } return arr; } - (void) initialize: (NSMutableArray*) pwd { sbox = [[NSMutableArray alloc] init]; mykey = [[NSMutableArray alloc] init]; int a = 0; int b; int c = [pwd count]; int d = 0; while (d < 256) { [mykey addObject:[pwd objectAtIndex:(d % c)]]; [sbox addObject:[[NSNumber alloc] initWithInt:d]]; d++; } d = 0; while (d < 256) { a = (a + [[sbox objectAtIndex:d] intValue] + [[mykey objectAtIndex:d] intValue]) % 256; b = [[sbox objectAtIndex:d] intValue]; [sbox replaceObjectAtIndex:d withObject:[sbox objectAtIndex:a]]; [sbox replaceObjectAtIndex:a withObject:[[NSNumber alloc] initWithInt:b]]; d++; } } - (NSMutableArray*) calculate: (NSMutableArray*) plaintxt andPsw: (NSMutableArray*) psw { [self initialize:psw]; int a = 0; int b = 0; NSMutableArray * c = [[NSMutableArray alloc] init]; int d; int e; int f; int g = 0; while (g < [plaintxt count]) { a = (a + 1) % 256; b = (b + [[sbox objectAtIndex:a] intValue]) % 256; e = [[sbox objectAtIndex:a] intValue]; [sbox replaceObjectAtIndex:a withObject:[sbox objectAtIndex:b]]; [sbox replaceObjectAtIndex:b withObject:[[NSNumber alloc] initWithInt:e]]; int h = ([[sbox objectAtIndex:a]intValue] + [[sbox objectAtIndex:b]intValue]) % 256; d = [[sbox objectAtIndex:h] intValue]; f = [[plaintxt objectAtIndex:g] intValue] ^ d; [c addObject:[[NSNumber alloc] initWithInt:f]]; g++; } return c; } - (NSString*) decrypt: (NSString*) src andKey: (NSString*) key { NSMutableArray * plaintxt = [self hexToChars:src]; NSMutableArray * psw = [self strToChars:key]; NSMutableArray * chars = [self calculate:plaintxt andPsw:psw]; NSData *asciidata = [[self charsToStr:chars] dataUsingEncoding:NSASCIIStringEncoding allowLossyConversion:YES]; NSString *asciistr = [[NSString alloc] initWithData:asciidata encoding:NSUTF8StringEncoding]; return asciistr; } @end This is supposed to decrypt a hex string with an ascii string, using rc4 decryption. I'm converting my java application to objective-c. The output keeps changing, every time i run it.

    Read the article

  • Android: who can help me with setting up this google maps class please??

    - by Capsud
    Hi, Firstly this has turned out to be quite a long post so please bear with me as its not too difficult but you may need to clarify something with me if i haven't explained it correctly. So with some help the other day from guys on this forum, i managed to partially set up my 'mapClass' class, but i'm having trouble with it and its not running correctly so i would like some help if possible. I will post the code below so you can see. What Ive got is a 'Dundrum' class which sets up the listView for an array of items. Then ive got a 'dundrumSelector' class which I use to set up the setOnClickListener() methods on the listItems and link them to their correct views. DundrumSelector class.. public static final int BUTTON1 = R.id.anandaAddressButton; public static final int BUTTON2 = R.id.bramblesCafeAddressButton; public static final int BUTTON3 = R.id.brannigansAddressButton; public void onCreate(Bundle savedInstanceState){ super.onCreate(savedInstanceState); int position = getIntent().getExtras().getInt("position"); if(position == 0){ setContentView(R.layout.ananda); }; if(position == 1){ setContentView(R.layout.bramblescafe); }; if(position == 2){ setContentView(R.layout.brannigans); Button anandabutton = (Button) findViewById(R.id.anandaAddressButton); anandabutton.setOnClickListener(new View.OnClickListener() { public void onClick(View view) { Intent myIntent = new Intent(view.getContext(),MapClass.class); myIntent.putExtra("button", BUTTON1); startActivityForResult(myIntent,0); } }); Button bramblesbutton = (Button) findViewById(R.id.bramblesCafeAddressButton); bramblesbutton.setOnClickListener(new View.OnClickListener() { public void onClick(View view) { Intent myIntent = new Intent(view.getContext(),MapClass.class); myIntent.putExtra("button", BUTTON2); startActivityForResult(myIntent, 0); } }); etc etc.... Then what i did was set up static ints to represent the buttons which you can see at the top of this class, the reason for this is because in my mapClass activity I just want to have one method, because the only thing that is varying is the coordinates to each location. ie. i dont want to have 100+ map classes essentially doing the same thing other than different coordinates into the method. So my map class is as follows... case DundrumSelector.BUTTON1: handleCoordinates("53.288719","-6.241179"); break; case DundrumSelector.BUTTON2: handleCoordinates("53.288719","-6.241179"); break; case DundrumSelector.BUTTON3: handleCoordinates("53.288719","-6.241179"); break; } } private void handleCoordinates(String l, String b){ mapView = (MapView) findViewById(R.id.mapView); LinearLayout zoomLayout = (LinearLayout)findViewById(R.id.zoom); View zoomView = mapView.getZoomControls(); zoomLayout.addView(zoomView, new LinearLayout.LayoutParams( LayoutParams.WRAP_CONTENT, LayoutParams.WRAP_CONTENT)); mapView.displayZoomControls(true); mc = mapView.getController(); String coordinates[] = {l, b}; double lat = Double.parseDouble(coordinates[0]); double lng = Double.parseDouble(coordinates[1]); p = new GeoPoint( (int) (lat*1E6), (int) (lng*1E6)); mc.animateTo(p); mc.setZoom(17); mapView.invalidate(); } Now this is where my problem is. The onClick() events don't even work from the listView to get into the correct views. I have to comment out the methods in 'DundrumSelector' before I can get into their views. And this is what I dont understand, firstly why wont the onClick() events work, because its not even on that next view where the map is. I know this is a very long post and it might be quite confusing so let me know if you want any clarification.. Just to recap, what i'm trying to do is just have one class that sets up the map coordinates, like what i'm trying to do in my 'mapClass'. Please can someone help or suggest another way of doing this! Thanks alot everyone for reading this.

    Read the article

  • Pixel plot method errors out without error message.

    - by sonny5
    // The following method blows up (big red x on screen) without generating error info. Any // ideas why? // MyPlot.PlotPixel(x, y, Color.BlueViolet, Grf); // runs if commented out // My goal is to draw a pixel on a form. Is there a way to increase the pixel size also? using System; using System.Drawing; using System.Drawing.Drawing2D; using System.Collections; using System.ComponentModel; using System.Windows.Forms; using System.Data; public class Plot : System.Windows.Forms.Form { private Size _ClientArea; //keeps the pixels info private double _Xspan; private double _Yspan; public Plot() { InitializeComponent(); } public Size ClientArea { set { _ClientArea = value; } } private void InitializeComponent() { this.AutoScaleBaseSize = new System.Drawing.Size(5, 13); this.ClientSize = new System.Drawing.Size(400, 300); this.Text="World Plot (world_plot.cs)"; this.Resize += new System.EventHandler(this.Form1_Resize); this.Paint += new System.Windows.Forms.PaintEventHandler(this.doLine); this.Paint += new System.Windows.Forms.PaintEventHandler(this.TransformPoints); // new this.Paint += new System.Windows.Forms.PaintEventHandler(this.DrawRectangleFloat); this.Paint += new System.Windows.Forms.PaintEventHandler(this.DrawWindow_Paint); } private void DrawWindow_Paint(object sender, PaintEventArgs e) { Graphics Grf = e.Graphics; pixPlot(Grf); } static void Main() { Application.Run(new Plot()); } private void doLine(object sender, System.Windows.Forms.PaintEventArgs e) { // no transforms done yet!!! Graphics g = e.Graphics; g.FillRectangle(Brushes.White, this.ClientRectangle); Pen p = new Pen(Color.Black); g.DrawLine(p, 0, 0, 100, 100); // draw DOWN in y, which is positive since no matrix called p.Dispose(); } public void PlotPixel(double X, double Y, Color C, Graphics G) { Bitmap bm = new Bitmap(1, 1); bm.SetPixel(0, 0, C); G.DrawImageUnscaled(bm, TX(X), TY(Y)); } private int TX(double X) //transform real coordinates to pixels for the X-axis { double w; w = _ClientArea.Width / _Xspan * X + _ClientArea.Width / 2; return Convert.ToInt32(w); } private int TY(double Y) //transform real coordinates to pixels for the Y-axis { double w; w = _ClientArea.Height / _Yspan * Y + _ClientArea.Height / 2; return Convert.ToInt32(w); } private void pixPlot(Graphics Grf) { Plot MyPlot = new Plot(); double x = 12.0; double y = 10.0; MyPlot.ClientArea = this.ClientSize; Console.WriteLine("x = {0}", x); Console.WriteLine("y = {0}", y); //MyPlot.PlotPixel(x, y, Color.BlueViolet, Grf); // blows up } private void DrawRectangleFloat(object sender, PaintEventArgs e) { // Create pen. Pen penBlu = new Pen(Color.Blue, 2); // Create location and size of rectangle. float x = 0.0F; float y = 0.0F; float width = 200.0F; float height = 200.0F; // translate DOWN by 200 pixels // Draw rectangle to screen. e.Graphics.DrawRectangle(penBlu, x, y, width, height); } private void TransformPoints(object sender, System.Windows.Forms.PaintEventArgs e) { // after transforms Graphics g = this.CreateGraphics(); Pen penGrn = new Pen(Color.Green, 3); Matrix myMatrix2 = new Matrix(1, 0, 0, -1, 0, 0); // flip Y axis with -1 g.Transform = myMatrix2; g.TranslateTransform(0, 200, MatrixOrder.Append); // translate DOWN the same distance as the rectangle... // ...so this will put it at lower left corner g.DrawLine(penGrn, 0, 0, 100, 90); // notice that y 90 is going UP } private void Form1_Resize(object sender, System.EventArgs e) { Invalidate(); } }

    Read the article

  • Rails validation count limit on has_many :through

    - by Jeremy
    I've got the following models: Team, Member, Assignment, Role The Team model has_many Members. Each Member has_many roles through assignments. Role assignments are Captain and Runner. I have also installed devise and CanCan using the Member model. What I need to do is limit each Team to have a max of 1 captain and 5 runners. I found this example, and it seemed to work after some customization, but on update ('teams/1/members/4/edit'). It doesn't work on create ('teams/1/members/new'). But my other validation (validates :role_ids, :presence = true ) does work on both update and create. Any help would be appreciated. Update: I've found this example that would seem to be similar to my problem but I can't seem to make it work for my app. It seems that the root of the problem lies with how the count (or size) is performed before and during validation. For Example: When updating a record... It checks to see how many runners there are on a team and returns a count. (i.e. 5) Then when I select a role(s) to add to the member it takes the known count from the database (i.e. 5) and adds the proposed changes (i.e. 1), and then runs the validation check. (Team.find(self.team_id).members.runner.count 5) This works fine because it returns a value of 6 and 6 5 so the proposed update fails without saving and an error is given. But when I try to create a new member on the team... It checks to see how many runners there are on a team and returns a count. (i.e. 5) Then when I select a role(s) to add to the member it takes the known count from the database (i.e. 5) and then runs the validation check WITHOUT factoring in the proposed changes. This doesn't work because it returns a value of 5 known runner and 5 = 5 so the proposed update passes and the new member and role is saved to the database with no error. Member Model: class Member < ActiveRecord::Base devise :database_authenticatable, :registerable, :recoverable, :rememberable, :trackable, :validatable attr_accessible :password, :password_confirmation, :remember_me attr_accessible :age, :email, :first_name, :last_name, :sex, :shirt_size, :team_id, :assignments_attributes, :role_ids belongs_to :team has_many :assignments, :dependent => :destroy has_many :roles, through: :assignments accepts_nested_attributes_for :assignments scope :runner, joins(:roles).where('roles.title = ?', "Runner") scope :captain, joins(:roles).where('roles.title = ?', "Captain") validate :validate_runner_count validate :validate_captain_count validates :role_ids, :presence => true def validate_runner_count if Team.find(self.team_id).members.runner.count > 5 errors.add(:role_id, 'Error - Max runner limit reached') end end def validate_captain_count if Team.find(self.team_id).members.captain.count > 1 errors.add(:role_id, 'Error - Max captain limit reached') end end def has_role?(role_sym) roles.any? { |r| r.title.underscore.to_sym == role_sym } end end Member Controller: class MembersController < ApplicationController load_and_authorize_resource :team load_and_authorize_resource :member, :through => :team before_filter :get_team before_filter :initialize_check_boxes, :only => [:create, :update] def get_team @team = Team.find(params[:team_id]) end def index respond_to do |format| format.html # index.html.erb format.json { render json: @members } end end def show respond_to do |format| format.html # show.html.erb format.json { render json: @member } end end def new respond_to do |format| format.html # new.html.erb format.json { render json: @member } end end def edit end def create respond_to do |format| if @member.save format.html { redirect_to [@team, @member], notice: 'Member was successfully created.' } format.json { render json: [@team, @member], status: :created, location: [@team, @member] } else format.html { render action: "new" } format.json { render json: @member.errors, status: :unprocessable_entity } end end end def update respond_to do |format| if @member.update_attributes(params[:member]) format.html { redirect_to [@team, @member], notice: 'Member was successfully updated.' } format.json { head :no_content } else format.html { render action: "edit" } format.json { render json: @member.errors, status: :unprocessable_entity } end end end def destroy @member.destroy respond_to do |format| format.html { redirect_to team_members_url } format.json { head :no_content } end end # Allow empty checkboxes # http://railscasts.com/episodes/17-habtm-checkboxes def initialize_check_boxes params[:member][:role_ids] ||= [] end end _Form Partial <%= form_for [@team, @member], :html => { :class => 'form-horizontal' } do |f| %> #... # testing the count... <ul> <li>Captain - <%= Team.find(@member.team_id).members.captain.size %></li> <li>Runner - <%= Team.find(@member.team_id).members.runner.size %></li> <li>Driver - <%= Team.find(@member.team_id).members.driver.size %></li> </ul> <div class="control-group"> <div class="controls"> <%= f.fields_for :roles do %> <%= hidden_field_tag "member[role_ids][]", nil %> <% Role.all.each do |role| %> <%= check_box_tag "member[role_ids][]", role.id, @member.role_ids.include?(role.id), id: dom_id(role) %> <%= label_tag dom_id(role), role.title %> <% end %> <% end %> </div> </div> #... <% end %>

    Read the article

  • php form validation with javascript

    - by Jon Hanson
    hi guys i need help trying to figure out why the alert box doesnt show up when i run this. im also new at programming. html i due just fine. im currently taking a php class, and the teacher thought it would be fun to have us create a form and validate it. my problem is i am trying to call the function which then would validate it. My problem is its not calling it, and i cant quite figure out why. please help? jons viladating <html xmlns="http://www.w3.org/1999/xhtml" lang="en" xml:lang="en"> <head> <link rel="stylesheet" href="decor.css" type="text/css"> <meta http-equiv="Content-Type" content="text/html; charset=utf-8"> <title>jons viladating</title> <script type="text/javascript"> <!-- <![CDATA[ function showjonsForm() { var errors = ""; // check for any empty strings if (document.forms[0].fname.value == "") errors += "fname\n"; if (document.forms[0].lname.value == "") errors += "lName\n"; if (document.forms[0].addrs1.value == "") errors += "Address\n"; if (document.forms[0].city.value == "") errors += "City\n"; if (document.forms[0].state.value == "") errors += "State\n"; if (document.forms[0].zip.value == "") errors += "Zip\n"; if (document.forms[0].phone.value == "") errors += "Phone\n"; if (document.forms[0].email.value == "") errors += "Email\n"; if (document.forms[0].pw2.value == "") errors += "Confirm password\n"; if (document.forms[0].dob.value == "") errors += "Date of birth\n"; if (document.forms[0].sex.value == "") errors += "sex\n"; // don't need to check checkboxes if (errors != "") { //something was wrong})) alert ("Please fix these errors\n" + errors) ; return false; } var stringx; stringx = "fName:" + document.forms(0).fname.value; stringx = "lName:" + document.forms(0).lname.value; stringx += "\nAddress: " + document.forms(0).addrs1.value; stringx += "\nCity: " + document.forms(0).city.value; stringx += " \nState: " + document.forms(0).state.value; stringx += " Zip: "+ document.forms(0).zip.value; stringx += "\nPhone: " + document.forms(0).phone.value; stringx += "\nE-mail:" + document.forms(0).email.value; stringx += "\nConfirm password " + document.forms(0).pw2.value; stringx += "\nDate of birth: " + document.forms(0).dob.value; stringx += "\nSex: " + document.forms(0).sex.value; alert(stringx); return false //set to false to not submit } // ]]> --> </script> <h1>jons validations test</h1> </head> <body> <div id="rightcolumn"> <img src="hula.gif" align="right"/> </div> <text align="left"> <form name="jon" action="formoutput.php" onsubmit="return showjonsForm()" Method="post"> <fieldset style="width:250px"> <label> first name</label> <input type="text" name="fname" size="15" maxlength="22" onBlur="checkRequired( this,'fname')"/><br /> <label>last name</label> <input type="text" name="lname" size="10" maxlength="22"> <br /> </fieldset> <fieldset style="width:250px"> <label>address</label> <input type="text" name="adrs1" size="10" maxlength="30"><br /> <span class="msg_container" id="adrs2"></span><br /> <label>city</label> <input type="text" name="city" size="10" maxlength="15"><br /> <span class="msg_container" id="city"></span><br /> <label>state</label> <input type="text" name="state" size="10" maxlength="2"><br /> <span class="msg_container" id="state"></span><br /> <label>zip</label> <input type="text" name="zip" size="10" maxlength="5"><br /> </fieldset> <fieldset style="width:250px"> <label>phone</label> <input type="text" name="phone" size="10" maxlength="10"><br /> <div>please input phone number in this format 1234567892 thank you </div> <label>email</label> <input type="text" name="email" size="10" maxlength="22"><br /> <div> password must have 1 number upper case and minimum of 6 charcters</div> <label>password</label> <input type="text" name="pw2" size="10" maxlength="12"><br /> <label>select gender type</label> <select name="sex" size="1" <br /> <option>male</option> <option>female</option> <option>timelord</option> </select> <label>date of birth</label> <input type="text name="dob" size="8" maxlength="8"/> <div> would you like to know know more</div> <label> yes</label> <input type="checkbox" checked="checked" name="check" /> </fieldset> <input type="submit"/></form> </form> <div id="footer"> <img src="laps2.jpg"> <img src="orange.jpg"><img src="ok.jpg"> </div> </body> </html>

    Read the article

  • How to make my robot move in a rectangular path along the black tape?

    - by Sahat
    I am working on a robot, it's part of the summer robotics workshop in our college. We are using C-STAMP micro controllers by A-WIT. I was able to make it move, turn left, turn right, move backward. I have even managed to make it go along the black tape using a contrast sensor. I send the robot at 30-45 degrees toward the black tape on the table and it aligns itself and starts to move along the black tape. It jerks a little, probably due to my programming logic below, it's running a while loop and constantly checking if statements, so it ends up trying to turn left and right every few milliseconds, which explains the jerking part. But it's okay, it works, not as smooth as I want it to work but it works! Problem is that I can't make my robot go into a rectangular path of the black tape. As soon as it reaches the corner it just keeps going straight instead of making a left/right turn. Here's my attempt. The following code is just part of the code. My 2 sensors are located right underneath the robot, next to the front wheel, almost at the floor level. It has "index" value ranging from 0 to 8. I believe it's 8 when you have a lot of light coming into the sensor , and 0 when it's nearly pitch black. So when the robot moves into the black-tape-zone, the index value drops, and based on that I have an if-statement telling my robot to either turn left or right. To avoid confusion I didn't post the entire source code, but only the logical part responsible for the movement of my robot along the black tape. while(1) { // don't worry about these. // 10 and 9 represent Sensor's PIN location on the motherboard V = ANALOGIN(10, 1, 0, 0, 0); V2 = ANALOGIN(9, 1, 0, 0, 0); // i got this "formula" from the example in my Manual. // V stands for voltage of the sensor. // it gives me the index value of the sensor. 0 = darkest, 8 = lightest. index = ((-(V - 5) / 5) * 8 + 0.5); index2 = ((-(V2 - 5) / 5) * 8 + 0.5); // i've tweaked the position of the sensors so index > 7 is just right number. // the robot will move anywhere on the table just fine with index > 7. // as soon as it drops to or below 7 (i.e. finds black tape), the robot will // either turn left or right and then go forward. // lp & rp represent left-wheel pin and right-wheel pin, 1 means run forever. // if i change it from 1 to 100, it will go forward for 100ms. if (index > 7 && index2 > 7) goForward(lp, rp, 1); if (index <= 7) { turnLeft(lp, rp, 1); goForward(lp, rp, 1); // this is the tricky part. i've added this code last minute // trying to make my robot turn, but i didn't work. if (index > 4) { turnLeft(lp, rp, 1); goForward(lp, rp, 1); } } else if (index2 <= 7) { turnRight(lp, rp, 1); goForward(lp, rp, 1); // this is also the last minute addition. it's same code as above // but it's for the 2nd sensor. if (index2 > 4) { turnRight(lp, rp, 1); goForward(lp, rp, 1); } } I've spent the entire day trying to figure it out. I've pretty much exhausted all avenues. Asking for the solution on stackoverflow is my very last option now. Thanks in advance! If you have any questions about the code, let me know, but comments should be self-explanatory.

    Read the article

  • Server Error in '/' Application (ASP.NET)

    - by baeltazor
    Hi All I just setup up member ship roles and registration on my website with visual web developer using the tutorial on msdn. It works perfectly locally, but when i uploaded it to my server, I get the following page: "Server Error in '/' Application. -------------------------------------------------------------------------------- Configuration Error Description: An error occurred during the processing of a configuration file required to service this request. Please review the specific error details below and modify your configuration file appropriately. Parser Error Message: The connection name 'LocalSqlServer' was not found in the applications configuration or the connection string is empty. Source Error: [No relevant source lines] Source File: machine.config Line: 160 -------------------------------------------------------------------------------- Version Information: Microsoft .NET Framework Version:2.0.50727.4200; ASP.NET Version:2.0.50727.4016 " Does anybody know why I'm seeing this and how I may go about fixinf this? Any help is greatly appreciated. Thank you Bael. EDIT: I have just looked at my web.config file after reading the following line in the error message: "The connection name 'LocalSqlServer' was not found in the applications configuration or the connection string is empty." ... And have noticed that the following element is completely empty: <connectionStrings/> // Is this one supposed to be empty? if not what should go here? In the error it implies it shouldn't be empty. Also, I don't know where I should place LocalSqlServer LATEST EDIT After changing DataSource to LocalHost i get the following error: Server Error in '/JTS' Application. -------------------------------------------------------------------------------- A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: Named Pipes Provider, error: 40 - Could not open a connection to SQL Server) Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Data.SqlClient.SqlException: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: Named Pipes Provider, error: 40 - Could not open a connection to SQL Server) Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [SqlException (0x80131904): A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: Named Pipes Provider, error: 40 - Could not open a connection to SQL Server)] System.Data.SqlClient.SqlInternalConnection.OnError(SqlException exception, Boolean breakConnection) +4849015 System.Data.SqlClient.TdsParser.ThrowExceptionAndWarning(TdsParserStateObject stateObj) +194 System.Data.SqlClient.TdsParser.Connect(ServerInfo serverInfo, SqlInternalConnectionTds connHandler, Boolean ignoreSniOpenTimeout, Int64 timerExpire, Boolean encrypt, Boolean trustServerCert, Boolean integratedSecurity, SqlConnection owningObject) +4862333 System.Data.SqlClient.SqlInternalConnectionTds.AttemptOneLogin(ServerInfo serverInfo, String newPassword, Boolean ignoreSniOpenTimeout, Int64 timerExpire, SqlConnection owningObject) +90 System.Data.SqlClient.SqlInternalConnectionTds.LoginNoFailover(String host, String newPassword, Boolean redirectedUserInstance, SqlConnection owningObject, SqlConnectionString connectionOptions, Int64 timerStart) +342 System.Data.SqlClient.SqlInternalConnectionTds.OpenLoginEnlist(SqlConnection owningObject, SqlConnectionString connectionOptions, String newPassword, Boolean redirectedUserInstance) +221 System.Data.SqlClient.SqlInternalConnectionTds..ctor(DbConnectionPoolIdentity identity, SqlConnectionString connectionOptions, Object providerInfo, String newPassword, SqlConnection owningObject, Boolean redirectedUserInstance) +189 System.Data.SqlClient.SqlConnectionFactory.CreateConnection(DbConnectionOptions options, Object poolGroupProviderInfo, DbConnectionPool pool, DbConnection owningConnection) +185 System.Data.ProviderBase.DbConnectionFactory.CreatePooledConnection(DbConnection owningConnection, DbConnectionPool pool, DbConnectionOptions options) +31 System.Data.ProviderBase.DbConnectionPool.CreateObject(DbConnection owningObject) +433 System.Data.ProviderBase.DbConnectionPool.UserCreateRequest(DbConnection owningObject) +66 System.Data.ProviderBase.DbConnectionPool.GetConnection(DbConnection owningObject) +499 System.Data.ProviderBase.DbConnectionFactory.GetConnection(DbConnection owningConnection) +65 System.Data.ProviderBase.DbConnectionClosed.OpenConnection(DbConnection outerConnection, DbConnectionFactory connectionFactory) +117 System.Data.SqlClient.SqlConnection.Open() +122 System.Web.DataAccess.SqlConnectionHolder.Open(HttpContext context, Boolean revertImpersonate) +87 System.Web.DataAccess.SqlConnectionHelper.GetConnection(String connectionString, Boolean revertImpersonation) +221 System.Web.Security.SqlMembershipProvider.GetPasswordWithFormat(String username, Boolean updateLastLoginActivityDate, Int32& status, String& password, Int32& passwordFormat, String& passwordSalt, Int32& failedPasswordAttemptCount, Int32& failedPasswordAnswerAttemptCount, Boolean& isApproved, DateTime& lastLoginDate, DateTime& lastActivityDate) +815 System.Web.Security.SqlMembershipProvider.CheckPassword(String username, String password, Boolean updateLastLoginActivityDate, Boolean failIfNotApproved, String& salt, Int32& passwordFormat) +105 System.Web.Security.SqlMembershipProvider.CheckPassword(String username, String password, Boolean updateLastLoginActivityDate, Boolean failIfNotApproved) +42 System.Web.Security.SqlMembershipProvider.ValidateUser(String username, String password) +78 System.Web.UI.WebControls.Login.AuthenticateUsingMembershipProvider(AuthenticateEventArgs e) +60 System.Web.UI.WebControls.Login.OnAuthenticate(AuthenticateEventArgs e) +119 System.Web.UI.WebControls.Login.AttemptLogin() +115 System.Web.UI.WebControls.Login.OnBubbleEvent(Object source, EventArgs e) +101 System.Web.UI.Control.RaiseBubbleEvent(Object source, EventArgs args) +37 System.Web.UI.WebControls.Button.OnCommand(CommandEventArgs e) +118 System.Web.UI.WebControls.Button.RaisePostBackEvent(String eventArgument) +166 System.Web.UI.WebControls.Button.System.Web.UI.IPostBackEventHandler.RaisePostBackEvent(String eventArgument) +10 System.Web.UI.Page.RaisePostBackEvent(IPostBackEventHandler sourceControl, String eventArgument) +13 System.Web.UI.Page.RaisePostBackEvent(NameValueCollection postData) +36 System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) +1565 -------------------------------------------------------------------------------- Version Information: Microsoft .NET Framework Version:2.0.50727.4927; ASP.NET Version:2.0.50727.4927

    Read the article

  • Unnecessary Error Message Being Displayed

    - by ThatMacLad
    I've set up a form to update my blog and it was working fine up until about this morning. It keeps on turning up with an Invalid Entry ID error on the edit post page when I click the update button despite the fact that it updates the homepage. All help is seriously appreciated. <html> <head> <title>Ultan's Blog | New Post</title> <link rel="stylesheet" href="css/editpost.css" type="text/css" /> </head> <body> <div class="new-form"> <div class="header"> </div> <div class="form-bg"> <?php mysql_connect ('localhost', 'root', 'root') ; mysql_select_db ('tmlblog'); if (isset($_POST['update'])) { $id = htmlspecialchars(strip_tags($_POST['id'])); $month = htmlspecialchars(strip_tags($_POST['month'])); $date = htmlspecialchars(strip_tags($_POST['date'])); $year = htmlspecialchars(strip_tags($_POST['year'])); $time = htmlspecialchars(strip_tags($_POST['time'])); $entry = $_POST['entry']; $title = htmlspecialchars(strip_tags($_POST['title'])); if (isset($_POST['password'])) $password = htmlspecialchars(strip_tags($_POST['password'])); else $password = ""; $entry = nl2br($entry); if (!get_magic_quotes_gpc()) { $title = addslashes($title); $entry = addslashes($entry); } $timestamp = strtotime ($month . " " . $date . " " . $year . " " . $time); $result = mysql_query("UPDATE php_blog SET timestamp='$timestamp', title='$title', entry='$entry', password='$password' WHERE id='$id' LIMIT 1") or print ("Can't update entry.<br />" . mysql_error()); header("Location: post.php?id=" . $id); } if (isset($_POST['delete'])) { $id = (int)$_POST['id']; $result = mysql_query("DELETE FROM php_blog WHERE id='$id'") or print ("Can't delete entry.<br />" . mysql_error()); if ($result != false) { print "The entry has been successfully deleted from the database."; exit; } } if (!isset($_GET['id']) || empty($_GET['id']) || !is_numeric($_GET['id'])) { die("Invalid entry ID."); } else { $id = (int)$_GET['id']; } $result = mysql_query ("SELECT * FROM php_blog WHERE id='$id'") or print ("Can't select entry.<br />" . $sql . "<br />" . mysql_error()); while ($row = mysql_fetch_array($result)) { $old_timestamp = $row['timestamp']; $old_title = stripslashes($row['title']); $old_entry = stripslashes($row['entry']); $old_password = $row['password']; $old_title = str_replace('"','\'',$old_title); $old_entry = str_replace('<br />', '', $old_entry); $old_month = date("F",$old_timestamp); $old_date = date("d",$old_timestamp); $old_year = date("Y",$old_timestamp); $old_time = date("H:i",$old_timestamp); } ?> <form method="post" action="<?php echo $_SERVER['PHP_SELF']; ?>"> <p><input type="hidden" name="id" value="<?php echo $id; ?>" /> <strong><label for="month">Date (month, day, year):</label></strong> <select name="month" id="month"> <option value="<?php echo $old_month; ?>"><?php echo $old_month; ?></option> <option value="January">January</option> <option value="February">February</option> <option value="March">March</option> <option value="April">April</option> <option value="May">May</option> <option value="June">June</option> <option value="July">July</option> <option value="August">August</option> <option value="September">September</option> <option value="October">October</option> <option value="November">November</option> <option value="December">December</option> </select> <input type="text" name="date" id="date" size="2" value="<?php echo $old_date; ?>" /> <select name="year" id="year"> <option value="<?php echo $old_year; ?>"><?php echo $old_year; ?></option> <option value="2004">2004</option> <option value="2005">2005</option> <option value="2006">2006</option> <option value="2007">2007</option> <option value="2008">2008</option> <option value="2009">2009</option> <option value="2010">2010</option> </select> <strong><label for="time">Time:</label></strong> <input type="text" name="time" id="time" size="5" value="<?php echo $old_time; ?>" /></p> <p><strong><label for="title">Title:</label></strong> <input type="text" name="title" id="title" value="<?php echo $old_title; ?>" size="40" /> </p> <p><strong><label for="password">Password protect?</label></strong> <input type="checkbox" name="password" id="password" value="1"<?php if($old_password == 1) echo " checked=\"checked\""; ?> /></p> <p><textarea cols="80" rows="20" name="entry" id="entry"><?php echo $old_entry; ?></textarea></p> <p><input type="submit" name="update" id="update" value="Update"></p> </form> <p><strong>Be absolutely sure that this is the post that you wish to remove from the blog!</strong><br /> </p> <form action="<?php echo $_SERVER['PHP_SELF']; ?>" method="post"> <input type="hidden" name="id" id="id" value="<?php echo $id; ?>" /> <input type="submit" name="delete" id="delete" value="Delete" /> </form> </div> </div> </div> <div class="bottom"></div> </body> </html>

    Read the article

  • Help needed on an SQL configuration problem.

    - by user321048
    I have been banging my head with this one more the two weeks, and still don't know what the problem is ( I can't narrow it down). The problem is the following. I have a solution with 3 project in it all written in c# and I with LINQ. One project is the main web site, the other is the data layer (communication with the database) and the third one is a custom little CMS. The problem is the following: On a hosting provider when I publish the site it all works perfectly, but this site was needed to be hosted on the client server so I needed to do that. But the problem is that I also needed to configure the client server, because they don't have an Administrator employed (I know, I know ;) ). For the first time I some how managed, to set it up but a problem appear. My main web site is working just as it suppose to be - it reads (communicates with) the database, but My CMS is not. It shows the first log in page, but after that when I try to log in it throws the following error: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.) Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Data.SqlClient.SqlException: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.) Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [SqlException (0x80131904): A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.)] System.Data.SqlClient.SqlInternalConnection.OnError(SqlException exception, Boolean breakConnection) +4846887 System.Data.SqlClient.TdsParser.ThrowExceptionAndWarning(TdsParserStateObject stateObj) +194 System.Data.SqlClient.TdsParser.Connect(ServerInfo serverInfo, SqlInternalConnectionTds connHandler, Boolean ignoreSniOpenTimeout, Int64 timerExpire, Boolean encrypt, Boolean trustServerCert, Boolean integratedSecurity, SqlConnection owningObject) +4860189 System.Data.SqlClient.SqlInternalConnectionTds.AttemptOneLogin(ServerInfo serverInfo, String newPassword, Boolean ignoreSniOpenTimeout, Int64 timerExpire, SqlConnection owningObject) +90 System.Data.SqlClient.SqlInternalConnectionTds.LoginNoFailover(String host, String newPassword, Boolean redirectedUserInstance, SqlConnection owningObject, SqlConnectionString connectionOptions, Int64 timerStart) +342 System.Data.SqlClient.SqlInternalConnectionTds.OpenLoginEnlist(SqlConnection owningObject, SqlConnectionString connectionOptions, String newPassword, Boolean redirectedUserInstance) +221 System.Data.SqlClient.SqlInternalConnectionTds..ctor(DbConnectionPoolIdentity identity, SqlConnectionString connectionOptions, Object providerInfo, String newPassword, SqlConnection owningObject, Boolean redirectedUserInstance) +189 System.Data.SqlClient.SqlConnectionFactory.CreateConnection(DbConnectionOptions options, Object poolGroupProviderInfo, DbConnectionPool pool, DbConnection owningConnection) +185 System.Data.ProviderBase.DbConnectionFactory.CreatePooledConnection(DbConnection owningConnection, DbConnectionPool pool, DbConnectionOptions options) +31 System.Data.ProviderBase.DbConnectionPool.CreateObject(DbConnection owningObject) +433 System.Data.ProviderBase.DbConnectionPool.UserCreateRequest(DbConnection owningObject) +66 System.Data.ProviderBase.DbConnectionPool.GetConnection(DbConnection owningObject) +499 System.Data.ProviderBase.DbConnectionFactory.GetConnection(DbConnection owningConnection) +65 System.Data.ProviderBase.DbConnectionClosed.OpenConnection(DbConnection outerConnection, DbConnectionFactory connectionFactory) +117 System.Data.SqlClient.SqlConnection.Open() +122 System.Data.Linq.SqlClient.SqlConnectionManager.UseConnection(IConnectionUser user) +44 System.Data.Linq.SqlClient.SqlProvider.get_IsSqlCe() +45 System.Data.Linq.SqlClient.SqlProvider.InitializeProviderMode() +20 System.Data.Linq.SqlClient.SqlProvider.System.Data.Linq.Provider.IProvider.Execute(Expression query) +57 System.Data.Linq.DataQuery`1.System.Linq.IQueryProvider.Execute(Expression expression) +23 System.Linq.Queryable.Count(IQueryable`1 source) +240 CMS.Security.UserProfile.LoginUser() in C:\Documents and Settings\Dimitar\Desktop\New Mepso Final 08_04\CMS\Classes\UserProfile.cs:132 CMS.Default.Login1_Authenticate(Object sender, AuthenticateEventArgs e) in C:\Documents and Settings\Dimitar\Desktop\New Mepso Final 08_04\CMS\Default.aspx.cs:37 System.Web.UI.WebControls.Login.OnAuthenticate(AuthenticateEventArgs e) +108 System.Web.UI.WebControls.Login.AttemptLogin() +115 System.Web.UI.WebControls.Login.OnBubbleEvent(Object source, EventArgs e) +101 System.Web.UI.Control.RaiseBubbleEvent(Object source, EventArgs args) +37 System.Web.UI.WebControls.Button.OnCommand(CommandEventArgs e) +118 System.Web.UI.WebControls.Button.RaisePostBackEvent(String eventArgument) +166 System.Web.UI.WebControls.Button.System.Web.UI.IPostBackEventHandler.RaisePostBackEvent(String eventArgument) +10 System.Web.UI.Page.RaisePostBackEvent(IPostBackEventHandler sourceControl, String eventArgument) +13 System.Web.UI.Page.RaisePostBackEvent(NameValueCollection postData) +36 System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) +1565 Maybe this is a dumb question, but I cannot find the root of the problem, let alone the solution. So far I have tried the following: -setting time out on connection string to a higher value -configuration and after that turning off server firewall -checking the connection string over and over again (they are the same for all three projects and are saved in web.config) Important notes: I have tried executing the project from VS2008 with a connection string to the same database and the results are the same. That's why I think the problem is the SQL Server 2005 and not the IIS7. Any bit of information is more then welcomed.

    Read the article

  • OpenGL + cgFX Alpha Blending failure

    - by dopplex
    I have a shader that needs to additively blend to its output render target. While it had been fully implemented and working, I recently refactored and have done something that is causing the alpha blending to not work anymore. I'm pretty sure that the problem is somewhere in my calls to either OpenGL or cgfx - but I'm currently at a loss for where exactly the problem is, as everything looks like it is set up properly for alpha blending to occur. No OpenGL or cg framework errors are showing up, either. For some context, what I'm doing here is taking a buffer which contains screen position and luminance values for each pixel, copying it to a PBO, and using it as the vertex buffer for drawing GL_POINTS. Everything except for the alpha blending appears to be working as expected. I've confirmed both that the input vertex buffer has the correct values, and that my vertex and fragment shaders are outputting the points to the correct locations and with the correct luminance values. The way that I've arrived at the conclusion that the Alpha blending was broken is by making my vertex shader output every point to the same screen location and then setting the pixel shader to always output a value of float4(0.5) for that pixel. Invariably, the end color (dumped afterwards) ends up being float4(0.5). The confusing part is that as far as I can tell, everything is properly set for alpha blending to occur. The cgfx pass has the two following state assignments (among others - I'll put a full listing at the end): BlendEnable = true; BlendFunc = int2(One, One); This ought to be enough, since I am calling cgSetPassState() - and indeed, when I use glGets to check the values of GL_BLEND_SRC, GL_BLEND_DEST, GL_BLEND, and GL_BLEND_EQUATION they all look appropriate (GL_ONE, GL_ONE, GL_TRUE, and GL_FUNC_ADD). This check was done immediately after the draw call. I've been looking around to see if there's anything other than blending being enabled and the blending function being correctly set that would cause alpha blending not to occur, but without any luck. I considered that I could be doing something wrong with GL, but GL is telling me that blending is enabled. I doubt it's cgFX related (as otherwise the GL state wouldn't even be thinking it was enabled) but it still fails if I explicitly use GL calls to set the blend mode and enable it. Here's the trimmed down code for starting the cgfx pass and the draw call: CGtechnique renderTechnique = Filter->curTechnique; TEXUNITCHECK; CGpass pass = cgGetFirstPass(renderTechnique); TEXUNITCHECK; while (pass) { cgSetPassState(pass); cgUpdatePassParameters(pass); //drawFSPointQuadBuff((void*)PointQuad); drawFSPointQuadBuff((void*)LumPointBuffer); TEXUNITCHECK; cgResetPassState(pass); pass = cgGetNextPass(pass); }; and the function with the draw call: void drawFSPointQuadBuff(void* args) { PointBuffer* pointBuffer = (PointBuffer*)args; FBOERRCHECK; glClear(GL_COLOR_BUFFER_BIT); GLERRCHECK; glPointSize(1.0); GLERRCHECK; glEnableClientState(GL_VERTEX_ARRAY); GLERRCHECK; glEnable(GL_POINT_SMOOTH); if (pointBuffer-BufferObject) { glBindBufferARB(GL_ARRAY_BUFFER_ARB, (unsigned int)pointBuffer-BufData); glVertexPointer(pointBuffer-numComp, GL_FLOAT, 0, 0); } else { glVertexPointer(pointBuffer-numComp, GL_FLOAT, 0, pointBuffer-BufData); }; GLERRCHECK; glDrawArrays(GL_POINTS, 0, pointBuffer-numElem); GLboolean testBool; glGetBooleanv(GL_BLEND, &testBool); int iblendColor, iblendDest, iblendEquation, iblendSrc; glGetIntegerv(GL_BLEND_SRC, &iblendSrc); glGetIntegerv(GL_BLEND_DST, &iblendDest); glGetIntegerv(GL_BLEND_EQUATION, &iblendEquation); if (iblendEquation == GL_FUNC_ADD) { cerr << "Correct func" << endl; }; GLERRCHECK; if (pointBuffer-BufferObject) { glBindBufferARB(GL_ARRAY_BUFFER_ARB,0); } GLERRCHECK; glDisableClientState(GL_VERTEX_ARRAY); GLERRCHECK; }; Finally, here is the full state setting of the shader: AlphaTestEnable = false; DepthTestEnable = false; DepthMask = false; ColorMask = true; CullFaceEnable = false; BlendEnable = true; BlendFunc = int2(One, One); FragmentProgram = compile glslf std_PS(); VertexProgram = compile glslv bilatGridVS2();

    Read the article

  • How to enforce a namespace in wsdl for inner elements

    - by wsxedc
    I am looking at an example WSDL <definitions xmlns:wsu="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd" xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:tns="http://mypackage/" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns="http://schemas.xmlsoap.org/wsdl/" targetNamespace="http://mypackage/" name="HelloService"> <types> <xsd:schema> <xsd:import namespace="http://mypackage/" schemaLocation="http://localhost:8081/HelloWebService/HelloService?xsd=1"> </xsd:import> </xsd:schema> </types> <message name="sayHello"> <part name="parameters" element="tns:sayHello"></part> </message> <message name="sayHelloResponse"> <part name="parameters" element="tns:sayHelloResponse"></part> </message> <portType name="Hello"> <operation name="sayHello"> <input message="tns:sayHello"></input> <output message="tns:sayHelloResponse"></output> </operation> </portType> <binding name="HelloPortBinding" type="tns:Hello"> <soap:binding transport="http://schemas.xmlsoap.org/soap/http" style="document"></soap:binding> <operation name="sayHello"> <soap:operation soapAction=""></soap:operation> <input> <soap:body use="literal"></soap:body> </input> <output> <soap:body use="literal"></soap:body> </output> </operation> </binding> <service name="HelloService"> <port name="HelloPort" binding="tns:HelloPortBinding"> <soap:address location="http://localhost:8081/HelloWebService/HelloService"> </soap:address> </port> </service> and the referenced xsd is <?xml version="1.0" encoding="utf-8"?> <xs:schema xmlns:tns="http://mypackage/" xmlns:xs="http://www.w3.org/2001/XMLSchema" version="1.0" targetNamespace="http://mypackage/"> <xs:element name="sayHello" type="tns:sayHello"></xs:element> <xs:element name="sayHelloResponse" type="tns:sayHelloResponse"> </xs:element> <xs:complexType name="sayHello"> <xs:sequence> <xs:element name="arg0" type="xs:string" minOccurs="0"> </xs:element> </xs:sequence> </xs:complexType> <xs:complexType name="sayHelloResponse"> <xs:sequence> <xs:element name="return" type="xs:string" minOccurs="0"> </xs:element> </xs:sequence> </xs:complexType> </xs:schema> When I use SoapUI to generate a request message, it looks like this <soapenv:Envelope xmlns:soapenv="http://schemas.xmlsoap.org/soap/envelope/" xmlns:myp="http://mypackage/"> <soapenv:Header/> <soapenv:Body> <myp:sayHello> <arg0>?</arg0> </myp:sayHello> </soapenv:Body> </soapenv:Envelope> My question is, why doesn't arg0 need a namespace like ?? I am just using this as an example as the element that are children of soapenv always have a namespace prefix, however, the children of these children do not have any prefix. This is the case with soapUI and message sent by Axis2 generated stubs. My questions are: 1. Why aren't there any namespace for arg0? 2. Is there a way to enforce myp prefix on arg0 from WSDL? If so, how? If not, why can't it be done?

    Read the article

  • Why is str_replace not replacing this string?

    - by Niall
    I have the following PHP code which should load the data from a CSS file into a variable, search for the old body background colour, replace it with the colour from a submitted form, resave the CSS file and finally update the colour in the database. The problem is, str_replace does not appear to be replacing anything. Here is my PHP code (stored in "processors/save_program_settings.php"): <?php require("../security.php"); $institution_name = mysql_real_escape_string($_POST['institution_name']); $staff_role_title = mysql_real_escape_string($_POST['staff_role_title']); $program_location = mysql_real_escape_string($_POST['program_location']); $background_colour = mysql_real_escape_string($_POST['background_colour']); $bar_border_colour = mysql_real_escape_string($_POST['bar_border_colour']); $title_colour = mysql_real_escape_string($_POST['title_colour']); $url = $global_variables['program_location']; $data_background = mysql_query("SELECT * FROM sents_global_variables WHERE name='background_colour'") or die(mysql_error()); $background_output = mysql_fetch_array($data_background); $css = file_get_contents($url.'/default.css'); $str = "body { background-color: #".$background_output['data']."; }"; $str2 = "body { background-color: #".$background_colour."; }"; $css2 = str_replace($str, $str2, $css); unlink('../default.css'); file_put_contents('../default.css', $css2); mysql_query("UPDATE sents_global_variables SET data='{$institution_name}' WHERE name='institution_name'") or die(mysql_error()); mysql_query("UPDATE sents_global_variables SET data='{$staff_role_title}' WHERE name='role_title'") or die(mysql_error()); mysql_query("UPDATE sents_global_variables SET data='{$program_location}' WHERE name='program_location'") or die(mysql_error()); mysql_query("UPDATE sents_global_variables SET data='{$background_colour}' WHERE name='background_colour'") or die(mysql_error()); mysql_query("UPDATE sents_global_variables SET data='{$bar_border_colour}' WHERE name='bar_border_colour'") or die(mysql_error()); mysql_query("UPDATE sents_global_variables SET data='{$title_colour}' WHERE name='title_colour'") or die(mysql_error()); header('Location: '.$url.'/pages/start.php?message=program_settings_saved'); ?> Here is my CSS (stored in "default.css"): @charset "utf-8"; /* CSS Document */ body,td,th { font-family: Arial, Helvetica, sans-serif; font-size: 14px; color: #000; } body { background-color: #CCCCFF; } .main_table th { background:#003399; font-size:24px; color:#FFFFFF; } .main_table { background:#FFF; border:#003399 solid 1px; } .subtitle { font-size:20px; } input#login_username, input#login_password { height:30px; width:300px; font-size:24px; } input#login_submit { height:30px; width:150px; font-size:16px; } .timetable_cell_lesson { width:100px; font-size:10px; } .timetable_cell_tutorial_a, .timetable_cell_tutorial_b, .timetable_cell_break, .timetable_cell_lunch { width:100px; background:#999; font-size:10px; } I've run some checks using the following code in the PHP file: echo $css . "<br><br>" . $str . "<br><br>" . $str2 . "<br><br>" . $css2; exit; And it outputs (as you can see it's not changing anything in the CSS): @charset "utf-8"; /* CSS Document */ body,td,th { font-family: Arial, Helvetica, sans-serif; font-size: 14px; color: #000; } body { background-color: #CCCCFF; } .main_table th { background:#003399; font-size:24px; color:#FFFFFF; } .main_table { background:#FFF; border:#003399 solid 1px; } .subtitle { font-size:20px; } input#login_username, input#login_password { height:30px; width:300px; font-size:24px; } input#login_submit { height:30px; width:150px; font-size:16px; } .timetable_cell_lesson { width:100px; font-size:10px; } .timetable_cell_tutorial_a, .timetable_cell_tutorial_b, .timetable_cell_break, .timetable_cell_lunch { width:100px; background:#999; font-size:10px; } body { background-color: #CCCCFF; } body { background-color: #FF5719; } @charset "utf-8"; /* CSS Document */ body,td,th { font-family: Arial, Helvetica, sans-serif; font-size: 14px; color: #000; } body { background-color: #CCCCFF; } .main_table th { background:#003399; font-size:24px; color:#FFFFFF; } .main_table { background:#FFF; border:#003399 solid 1px; } .subtitle { font-size:20px; } input#login_username, input#login_password { height:30px; width:300px; font-size:24px; } input#login_submit { height:30px; width:150px; font-size:16px; } .timetable_cell_lesson { width:100px; font-size:10px; } .timetable_cell_tutorial_a, .timetable_cell_tutorial_b, .timetable_cell_break, .timetable_cell_lunch { width:100px; background:#999; font-size:10px; }

    Read the article

  • spring-nullpointerexception- cant access autowired annotated service (or dao) in a no-annotations class

    - by user286806
    I have this problem that I cannot fix. From my @Controller, i can easily access my autowired @Service class and play with it no problem. But when I do that from a separate class without annotations, it gives me a NullPointerException. My Controller (works)- @Controller public class UserController { @Autowired UserService userService;... My separate Java class (not working)- public final class UsersManagementUtil { @Autowired UserService userService; or @Autowired UserDao userDao; userService or userDao are always null! Was just trying if any one of them works. My component scan setting has the root level package set for scanning so that should be OK. my servlet context - <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:context="http://www.springframework.org/schema/context" xmlns:tx="http://www.springframework.org/schema/tx" xsi:schemaLocation=" http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans-3.0.xsd http://www.springframework.org/schema/context http://www.springframework.org/schema/context/spring-context-3.0.xsd http://www.springframework.org/schema/tx http://www.springframework.org/schema/tx/spring-tx-3.0.xsd"> <!-- the application context definition for the springapp DispatcherServlet --> <!-- Enable annotation driven controllers, validation etc... --> <context:property-placeholder location="classpath:jdbc.properties" /> <context:component-scan base-package="x" /> <tx:annotation-driven transaction-manager="hibernateTransactionManager" /> <!-- package shortended --> <bean id="messageSource" class="o.s.c.s.ReloadableResourceBundleMessageSource"> <property name="basename" value="/WEB-INF/messages" /> </bean> <bean id="dataSource" class="org.springframework.jdbc.datasource.DriverManagerDataSource"> <property name="driverClassName" value="${database.driver}" /> <property name="url" value="${database.url}" /> <property name="username" value="${database.user}" /> <property name="password" value="${database.password}" /> </bean> <!-- package shortened --> <bean id="viewResolver" class="o.s.w.s.v.InternalResourceViewResolver"> <property name="prefix"> <value>/</value> </property> <property name="suffix"> <value>.jsp</value> </property> <property name="order"> <value>0</value> </property> </bean> <!-- package shortened --> <bean id="sessionFactory" class="o.s.o.h3.a.AnnotationSessionFactoryBean"> <property name="dataSource" ref="dataSource" /> <property name="annotatedClasses"> <list> <value>orion.core.models.Question</value> <value>orion.core.models.User</value> <value>orion.core.models.Space</value> <value>orion.core.models.UserSkill</value> <value>orion.core.models.Question</value> <value>orion.core.models.Rating</value> </list> </property> <property name="hibernateProperties"> <props> <prop key="hibernate.dialect">${hibernate.dialect}</prop> <prop key="hibernate.show_sql">${hibernate.show_sql}</prop> <prop key="hibernate.hbm2ddl.auto">${hibernate.hbm2ddl.auto}</prop> </props> </property> </bean> <bean id="hibernateTransactionManager" class="org.springframework.orm.hibernate3.HibernateTransactionManager"> <property name="sessionFactory" ref="sessionFactory" /> </bean> Any clue?

    Read the article

  • SUDS rendering a duplicate node and wrapping everything in it

    - by PylonsN00b
    Here is my code: #Make the SOAP connection url = "https://api.channeladvisor.com/ChannelAdvisorAPI/v1/InventoryService.asmx?WSDL" headers = {'Content-Type': 'text/xml; charset=utf-8'} ca_client_inventory = Client(url, location="https://api.channeladvisor.com/ChannelAdvisorAPI/v1/InventoryService.asmx", headers=headers) #Make the SOAP headers login = ca_client_inventory.factory.create('APICredentials') login.DeveloperKey = 'REMOVED' login.Password = 'REMOVED' #Attach the headers ca_client_inventory.set_options(soapheaders=login) synch_inventory_item_list = ca_client_inventory.factory.create('SynchInventoryItemList') synch_inventory_item_list.accountID = "REMOVED" array_of_inventory_item_submit = ca_client_inventory.factory.create('ArrayOfInventoryItemSubmit') for product in products: inventory_item_submit = ca_client_inventory.factory.create('InventoryItemSubmit') inventory_item_list = get_item_list(product) inventory_item_submit = [inventory_item_list] array_of_inventory_item_submit.InventoryItemSubmit.append(inventory_item_submit) synch_inventory_item_list.itemList = array_of_inventory_item_submit #Call that service baby! ca_client_inventory.service.SynchInventoryItemList(synch_inventory_item_list) Here is what it outputs: <?xml version="1.0" encoding="UTF-8"?> <SOAP-ENV:Envelope xmlns:ns0="http://api.channeladvisor.com/webservices/" xmlns:ns1="http://schemas.xmlsoap.org/soap/envelope/" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:tns="http://api.channeladvisor.com/webservices/" xmlns:SOAP-ENV="http://schemas.xmlsoap.org/soap/envelope/"> <SOAP-ENV:Header> <tns:APICredentials> <tns:DeveloperKey>REMOVED</tns:DeveloperKey> <tns:Password>REMOVED</tns:Password> </tns:APICredentials> </SOAP-ENV:Header> <ns1:Body> <ns0:SynchInventoryItemList> <ns0:accountID> <ns0:accountID>REMOVED</ns0:accountID> <ns0:itemList> <ns0:InventoryItemSubmit> <ns0:Sku>1872</ns0:Sku> <ns0:Title>The Big Book Of Crazy Quilt Stitches</ns0:Title> <ns0:Subtitle></ns0:Subtitle> <ns0:Description>Embellish the seams and patches of crazy quilt projects with over 75 embroidery stitches and floral motifs. You&apos;ll use this handy reference book again and again to dress up wall hangings, pillows, sachets, clothing, and other nostalgic creations.</ns0:Description> <ns0:Weight>4</ns0:Weight> <ns0:FlagStyle/> <ns0:IsBlocked xsi:nil="true"/> <ns0:ISBN></ns0:ISBN> <ns0:UPC>028906018721</ns0:UPC> <ns0:EAN></ns0:EAN> <ns0:QuantityInfo> <ns0:UpdateType>UnShipped</ns0:UpdateType> <ns0:Total>0</ns0:Total> </ns0:QuantityInfo> <ns0:PriceInfo> <ns0:Cost>0.575</ns0:Cost> <ns0:RetailPrice xsi:nil="true"/> <ns0:StartingPrice xsi:nil="true"/> <ns0:ReservePrice xsi:nil="true"/> <ns0:TakeItPrice>6.95</ns0:TakeItPrice> <ns0:SecondChanceOfferPrice xsi:nil="true"/> <ns0:StorePrice>6.95</ns0:StorePrice> </ns0:PriceInfo> <ns0:ClassificationInfo> <ns0:Name>Books</ns0:Name> <ns0:AttributeList> <ns0:ClassificationAttributeInfo> <ns0:Name>Designer/Author</ns0:Name> <ns0:Value>Patricia Eaton</ns0:Value> </ns0:ClassificationAttributeInfo> <ns0:ClassificationAttributeInfo> <ns0:Name>Trim Size</ns0:Name> <ns0:Value></ns0:Value> </ns0:ClassificationAttributeInfo> <ns0:ClassificationAttributeInfo> <ns0:Name>Binding</ns0:Name> <ns0:Value>Leaflet</ns0:Value> </ns0:ClassificationAttributeInfo> <ns0:ClassificationAttributeInfo> <ns0:Name>Release Date</ns0:Name> <ns0:Value>11/1/1999 0:00:00</ns0:Value> </ns0:ClassificationAttributeInfo> <ns0:ClassificationAttributeInfo> <ns0:Name>Skill Level</ns0:Name> <ns0:Value></ns0:Value> </ns0:ClassificationAttributeInfo> <ns0:ClassificationAttributeInfo> <ns0:Name>Pages</ns0:Name> <ns0:Value>20</ns0:Value> </ns0:ClassificationAttributeInfo> <ns0:ClassificationAttributeInfo> <ns0:Name>Projects</ns0:Name> <ns0:Value></ns0:Value> </ns0:ClassificationAttributeInfo> </ns0:AttributeList> </ns0:ClassificationInfo> <ns0:ImageList> <ns0:ImageInfoSubmit> <ns0:PlacementName>ITEMIMAGEURL1</ns0:PlacementName> <ns0:FilenameOrUrl>1872.jpg</ns0:FilenameOrUrl> </ns0:ImageInfoSubmit> </ns0:ImageList> </ns0:InventoryItemSubmit> </ns0:itemList> </ns0:accountID> </ns0:SynchInventoryItemList> </ns1:Body> </SOAP-ENV:Envelope> See how it creates the accountID node twice and wraps the whole thing in it? WHY? How do I make it stop that?!

    Read the article

  • another onmouseover problem this one concerns pictures

    - by user334118
    Hi all! have problems with mouseover in Mozilla and Chrome after making it work in IE, for sure I can tell you that my code woked perfectly in Chrome at least, cause thats my default browser and I used it for debuging when creating the javascipt and it worked nicely... until I tried to make it work in IE too. Here I post the full code of the webpage I'm having trouble with. <%@ Page Language="C#" AutoEventWireup="true" CodeBehind="WebbShop.aspx.cs" Inherits="FSwebportal.WebbShop" %> .prodShow{width: 100%; text-align:center;border:0; float:right; position:inherit; padding-left:310px;} prodFollow{display:block; width:100%; height:100%; position:fixed; overflow:hidden;} orderSett{display:block; position:relative; float:left; padding-top:inherit;} .ShowBig{width:290px;height:290px; padding-top:10px;} .pTb{width:50px;} .order{background-color:Transparent;margin:3px;} .txtArea{border:0;overflow:auto;width:200px;height:100px;} .prodRow{background-image:url("produktbakgrund.png"); background-repeat:repeat;} .row{background-color:Transparent;width:100%;margin: 0px auto;display:inline-table;} .col{background-color:Transparent;width:100%;margin:3px;} <div id="prodFollow"> <table id="dumbTable"> <tr> <td> <img id="sideImg" class="ShowBig" src="" alt=""/> </td> </tr> <tr> <td> <h3><b>Specifikationer:</b></h3> <select name=""> </select> </td> </tr> </table> </div> <table id="itemList" class="prodShow" cellspacing="0"> <thead> <tr class="prodRow"> <th>Bild</th> <th>Förklaring</th> <th>Artikelnummer</th> <th>Pris</th> </tr> </thead> </table> <script type="text/javascript"> function appendRow() { var tbl = document.getElementById('itemList'); var len = <%= aspInfo.Count %>; var arr = new Array(len); var currIndex = 0; var imgID=0; <% for (int x = 0; x < aspInfo.Count; x++) { Response.Write("arr["+x+"]= '"+ aspInfo[x]+"';"); } %> for(row =0; row < arr.length/4;row++) { var rad = tbl.insertRow(tbl.rows.length); rad.setAttribute('class','prodRow'); for (c = 0; c < tbl.rows[row].cells.length; c++) { if(c < 1) { createCell(rad.insertCell(c), arr[currIndex], 'col',imgID); imgID++; } else { if(c < 3) { createCell(rad.insertCell(c),"<Label class=txtArea>" + arr[currIndex] + "</Label>", 'row',imgID); } else { createCell(rad.insertCell(c),"<Label class=txtArea>" + arr[currIndex] + " SKR</Label><br>Antal:<input type=text class=pTb /><input type=button width=100px value='Lägg i varukorg'></input>", 'order',imgID); } } currIndex++; } } } function createCell(cell, text, style,imgID) { if (style == 'col') { var arrLen = <% = largeImg.Count %>; var imgArr = new Array(arrLen); <% for (int x = 0; x < largeImg.Count; x++) { Response.Write("imgArr["+x+"]= '"+ largeImg[x]+"';"); } %> var div = document.createElement('div'); div.setAttribute('class', style); div.setAttribute('className', style); div.innerHTML = "<a href='#'><img id='" + imgID + "' src='" + text + "' onmouseover=javascript:onImg('" + imgArr[imgID] + "') border='0' alt='Animg' /></a>"; cell.appendChild(div); } else { var div = document.createElement('div'); div.setAttribute('class', style); div.setAttribute('className', style); div.innerHTML = text; cell.appendChild(div); } } </script> <script type="text/javascript" language="javascript"> function onImg(bigImg) { var img = document.getElementById('sideImg#'); img.src = bigImg; alert(img.src.toString()); } </script> </form> hope you guys can solve it for me, going mad! best regards David

    Read the article

  • Access violation using LocalAlloc()

    - by PaulH
    I have a Visual Studio 2008 Windows Mobile 6 C++ application that is using an API that requires the use of LocalAlloc(). To make my life easier, I created an implementation of a standard allocator that uses LocalAlloc() internally: /// Standard library allocator implementation using LocalAlloc and LocalReAlloc /// to create a dynamically-sized array. /// Memory allocated by this allocator is never deallocated. That is up to the /// user. template< class T, int max_allocations > class LocalAllocator { public: typedef T value_type; typedef size_t size_type; typedef ptrdiff_t difference_type; typedef T* pointer; typedef const T* const_pointer; typedef T& reference; typedef const T& const_reference; pointer address( reference r ) const { return &r; }; const_pointer address( const_reference r ) const { return &r; }; LocalAllocator() throw() : c_( NULL ) { }; /// Attempt to allocate a block of storage with enough space for n elements /// of type T. n>=1 && n<=max_allocations. /// If memory cannot be allocated, a std::bad_alloc() exception is thrown. pointer allocate( size_type n, const void* /*hint*/ = 0 ) { if( NULL == c_ ) { c_ = LocalAlloc( LPTR, sizeof( T ) * n ); } else { HLOCAL c = LocalReAlloc( c_, sizeof( T ) * n, LHND ); if( NULL == c ) LocalFree( c_ ); c_ = c; } if( NULL == c_ ) throw std::bad_alloc(); return reinterpret_cast< T* >( c_ ); }; /// Normally, this would release a block of previously allocated storage. /// Since that's not what we want, this function does nothing. void deallocate( pointer /*p*/, size_type /*n*/ ) { // no deallocation is performed. that is up to the user. }; /// maximum number of elements that can be allocated size_type max_size() const throw() { return max_allocations; }; private: /// current allocation point HLOCAL c_; }; // class LocalAllocator My application is using that allocator implementation in a std::vector< #define MAX_DIRECTORY_LISTING 512 std::vector< WIN32_FIND_DATA, LocalAllocator< WIN32_FIND_DATA, MAX_DIRECTORY_LISTING > > file_list; WIN32_FIND_DATA find_data = { 0 }; HANDLE find_file = ::FindFirstFile( folder.c_str(), &find_data ); if( NULL != find_file ) { do { // access violation here on the 257th item. file_list.push_back( find_data ); } while ( ::FindNextFile( find_file, &find_data ) ); ::FindClose( find_file ); } // data submitted to the API that requires LocalAlloc()'d array of WIN32_FIND_DATA structures SubmitData( &file_list.front() ); On the 257th item added to the vector<, the application crashes with an access violation: Data Abort: Thread=8e1b0400 Proc=8031c1b0 'rapiclnt' AKY=00008001 PC=03f9e3c8(coredll.dll+0x000543c8) RA=03f9ff04(coredll.dll+0x00055f04) BVA=21ae0020 FSR=00000007 First-chance exception at 0x03f9e3c8 in rapiclnt.exe: 0xC0000005: Access violation reading location 0x01ae0020. LocalAllocator::allocate is called with an n=512 and LocalReAlloc() succeeds. The actual Access Violation exception occurs within the std::vector< code after the LocalAllocator::allocate call: 0x03f9e3c8 0x03f9ff04 > MyLib.dll!stlp_std::priv::__copy_trivial(const void* __first = 0x01ae0020, const void* __last = 0x01b03020, void* __result = 0x01b10020) Line: 224, Byte Offsets: 0x3c C++ MyLib.dll!stlp_std::vector<_WIN32_FIND_DATAW,LocalAllocator<_WIN32_FIND_DATAW,512> >::_M_insert_overflow(_WIN32_FIND_DATAW* __pos = 0x01b03020, _WIN32_FIND_DATAW& __x = {...}, stlp_std::__true_type& __formal = {...}, unsigned int __fill_len = 1, bool __atend = true) Line: 112, Byte Offsets: 0x5c C++ MyLib.dll!stlp_std::vector<_WIN32_FIND_DATAW,LocalAllocator<_WIN32_FIND_DATAW,512> >::push_back(_WIN32_FIND_DATAW& __x = {...}) Line: 388, Byte Offsets: 0xa0 C++ MyLib.dll!Foo(unsigned long int cbInput = 16, unsigned char* pInput = 0x01a45620, unsigned long int* pcbOutput = 0x1dabfbbc, unsigned char** ppOutput = 0x1dabfbc0, IRAPIStream* __formal = 0x00000000) Line: 66, Byte Offsets: 0x1e4 C++ If anybody can point out what I may be doing wrong, I would appreciate it. Thanks, PaulH

    Read the article

  • Detect bugs in this asp.net VB master page , default.aspx and detail.aspx page codes. [closed]

    - by ITGURU2011
    please help me in detecting some bugs, cosmetic issues, information design issues, programming issues in the Below code of master page and default.aspx page and detail.aspx page. also suggest me some way to make it work better. i seprated all the three pages with the names. Master Page <%@ Master Language="VB" CodeFile="Limo.master.vb" Inherits="Limo" %> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head runat="server"> <title>Untitled Page</title> <asp:ContentPlaceHolder id="ContentPlaceHolder2" runat="server"> </asp:ContentPlaceHolder> <link href="StyleSheet.css" rel="stylesheet" type="text/css" /> <style type="text/css"> .style3 { color: #0000CC; font-family: Constantia; font-size: xx-large; font-weight: normal; } </style> </head> <body> <form id="form1" runat="server"> <div class="ExternalDiv"> <div class="HeaderDiv"> <h1 class="style3"> Limousines</h1> <p class="style3"> &nbsp;</p> <div class="MenuDiv"> </div> <div class="ContentDiv"> <asp:ContentPlaceHolder id="ContentPlaceHolder1" runat="server"> </asp:ContentPlaceHolder> </div> </div> </div> </form> </body> </html> default.aspx page <%@ Page Language="VB" MasterPageFile="~/Limo.master" AutoEventWireup="false" CodeFile="default.aspx.vb" Inherits="list" title="List" %> <asp:Content ID="Content1" ContentPlaceHolderID="ContentPlaceHolder2" Runat="Server"> </asp:Content> <asp:Content ID="Content2" ContentPlaceHolderID="ContentPlaceHolder1" Runat="Server"> <div style="height: 1343px; width: 727px"> <asp:GridView ID="GridView1" runat="server" AllowSorting="True" AutoGenerateColumns="False" DataSourceID="SqlDataSource2" style="top: 134px; left: 12px; position: absolute; height: 1337px; width: 531px"> <Columns> <asp:BoundField DataField="Limo_Types" HeaderText="Limo_Types" SortExpression="Limo_Types" /> <asp:HyperLinkField DataNavigateUrlFields="Limo_Types" DataNavigateUrlFormatString="Details.aspx?tag={0}" DataTextField="Limo_Types" HeaderText="Click for Detail" /> <asp:ImageField DataImageUrlField="Images" DataImageUrlFormatString="images/{0}" HeaderImageUrl="~/images/6.jpg" HeaderText="Thumbnail"> <ControlStyle Height="200px" Width="200px" /> <HeaderStyle Height="200px" Width="200px" /> <ItemStyle Height="200px" Width="200px" /> </asp:ImageField> </Columns> </asp:GridView> <asp:SqlDataSource ID="SqlDataSource1" runat="server"></asp:SqlDataSource> <asp:SqlDataSource ID="SqlDataSource2" runat="server" ConnectionString="<%$ ConnectionStrings:ConnectionString5 %>" ProviderName="<%$ ConnectionStrings:ConnectionString5.ProviderName %>" SelectCommand="SELECT [Limo_Types], [Images] FROM [tag]"> </asp:SqlDataSource> </div> </asp:Content> details.aspx page <%@ Page Language="VB" MasterPageFile="~/Limo.master" AutoEventWireup="false" CodeFile="Details.aspx.vb" Inherits="Details" title="Details Page" %> <asp:Content ID="Content1" ContentPlaceHolderID="ContentPlaceHolder1" Runat="Server"> <asp:GridView ID="GridView1" runat="server" AutoGenerateColumns="False" DataSourceID="SqlDataSource1" AllowSorting="True" BackColor="White" BorderColor="#999999" BorderStyle="Solid" BorderWidth="1px" CellPadding="3" ForeColor="Black" GridLines="Vertical"> <Columns> <asp:BoundField DataField="Limo_Types" HeaderText="Limo_Types" SortExpression="Limo_Types" /> <asp:BoundField DataField="Name" HeaderText="Name" SortExpression="Name" /> <asp:BoundField DataField="Price" HeaderText="Price" SortExpression="Price" /> <asp:BoundField DataField="Description" HeaderText="Description" SortExpression="Description" /> <asp:BoundField DataField="Color" HeaderText="Color" SortExpression="Color" /> <asp:ImageField DataImageUrlField="Image" DataImageUrlFormatString="images/{0}" HeaderImageUrl="~/App_Data/images/1.jpg" HeaderText="Image" AccessibleHeaderText="Image" AlternateText="Image"> <ControlStyle Height="300px" Width="300px" /> </asp:ImageField> </Columns> <FooterStyle BackColor="#CCCCCC" /> <PagerStyle BackColor="#999999" ForeColor="Black" HorizontalAlign="Center" /> <SelectedRowStyle BackColor="#000099" Font-Bold="True" ForeColor="White" /> <HeaderStyle BackColor="Black" Font-Bold="True" ForeColor="White" /> <AlternatingRowStyle BackColor="#CCCCCC" /> </asp:GridView> <asp:SqlDataSource ID="SqlDataSource1" runat="server" ConnectionString="<%$ ConnectionStrings:ConnectionString %>" ProviderName="<%$ ConnectionStrings:ConnectionString.ProviderName %>" SelectCommand="SELECT [Limo_Types], [Name], [Price], [Image], [Description], [Color] FROM [Query1] WHERE ([Limo_Types] = ?)"> <SelectParameters> <asp:QueryStringParameter Name="Limo_Types" QueryStringField="tag" Type="String" /> </SelectParameters> </asp:SqlDataSource> </asp:Content> <asp:Content ID="Content2" ContentPlaceHolderID="ContentPlaceHolder2" Runat="Server"> </asp:Content>

    Read the article

  • I have this broken php upload script

    - by Anders Kitson
    I have this script for uploading a image and content from a form, it works in one project but not the other. I have spent a good few hours trying to debug it, I am hoping someone could point out the issue I might be having. Where there are comments is where I have tried to debug. The first error I got was the "echo invalid file" at the beginning of the last comment. With these specific areas commented out the upload name and type that I am supposed to be grabbing from the form is not being echoed, I am thinking this is where the error is occurring, but can't quite seem to find it. Thanks. <?php include("../includes/connect.php"); /* if ((($_FILES["file"]["type"] == "image/gif") || ($_FILES["file"]["type"] == "image/jpeg") || ($_FILES["file"]["type"] == "image/pjpeg")) && ($_FILES["file"]["size"] < 2000000)) { */ if ($_FILES["file"]["error"] > 0) { echo "Return Code: " . $_FILES["file"]["error"] . "<br />"; } else { echo "Upload: " . $_FILES["file"]["name"] . "<br />"; echo "Type: " . $_FILES["file"]["type"] . "<br />"; echo "Size: " . ($_FILES["file"]["size"] / 1024) . " Kb<br />"; echo "Temp file: " . $_FILES["file"]["tmp_name"] . "<br />"; /* GRAB FORM DATA */ $title = $_POST['title']; $date = $_POST['date']; $content = $_POST['content']; $imageName1 = $_FILES["file"]["name"]; echo $title; echo "<br/>"; echo $date; echo "<br/>"; echo $content; echo "<br/>"; echo $imageName1; $sql = "INSERT INTO blog (title,date,content,image)VALUES( \"$title\", \"$date\", \"$content\", \"$imageName1\" )"; $results = mysql_query($sql)or die(mysql_error()); echo "<br/>"; if (file_exists("../images/blog/" . $_FILES["file"]["name"])) { echo $_FILES["file"]["name"] . " already exists. "; } else { move_uploaded_file($_FILES["file"]["tmp_name"], "../images/blog/" . $_FILES["file"]["name"]); echo "Stored in: " . "../images/blog/" . $_FILES["file"]["name"]; } } /* } else { echo "Invalid file" . "<br/>"; echo "Type: " . $_FILES["file"]["type"] . "<br />"; } */ //lets create a thumbnail of this uploaded image. /* $fileName = $_FILES["file"]["name"]; createThumb($fileName,310,"../images/blog/thumbs/"); function createThumb($thisFileName, $thisThumbWidth, $thisThumbDest){ $thisOriginalFilePath = "../images/blog/". $thisFileName; list($width, $height) = getimagesize($thisOriginalFilePath); $imgRatio =$width/$height; $thisThumbHeight = $thisThumbWidth/$imgRatio; $thumb = imagecreatetruecolor($thisThumbWidth,$thisThumbHeight); $source = imagecreatefromjpeg($thisOriginalFilePath); imagecopyresampled($thumb, $source, 0, 0, 0, 0, $thisThumbWidth,$thisThumbHeight, $width, $height); $newFileName = $thisThumbDest.$thisFileName; imagejpeg($thumb,$newFileName, 80); echo "<p><img src=\"$newFileName\" /></p>"; //header("location: http://www.google.ca"); } */ ?>

    Read the article

  • Changing the action of a form with javascript/jquery

    - by Micah
    I'm having an issue that is driving me crazy. I'm trying to modify the openid-selector to support facebook. I'm using RPXNow as my provider so it requires the form to be submitted to a different url than the standard. For example. RpxNow requires me to setup my form like this: <form action="https://wikipediamaze.rpxnow.com/openid/start?token_url=..."> This works for every provider except for facebook and myspace. Those require the form to be posted to a different url like this: <form action="https://wikipediamaze.rpxnow.com/facebook/start?token_url=..."> and <form action="https://wikipediamaze.rpxnow.com/myspace/start?token_url=..."> The open id selector has a bunch of buttons on the form each representing the openid providers. What I'm trying to do is detect when the facebook or myspace button is clicked and changed the action on the form before submitting. However it's not working. Here is my code. I've tried several variations all with the same "not supported" exception $("#openid_form").attr("action", form_url) document.forms[0].action = form_url Any suggestions? Update Here are more details on the code. I've ommitted some for brevity. The only thing i've done is added the facebook section to the "providers_large" object (which successfully adds the logo to the website), and instead of supply a url identifying the user, I'm creating a property called "form_url" which is what I want to set the action of my form to. If you look at the section title "Provider image click" you'll see where I'm checking for the presence of the property "form_url" and using jquery to change the action and submit the form. However when I step through the javascript in debug mode it tells me it's an ivalid operation. var providers_large = { google: { name: 'Google', url: 'https://www.google.com/accounts/o8/id' }, facebook: { name: 'Facebook', form_url: 'http://wikipediamaze.rpxnow.com/facebook/start?token_url=http://www.wikipediamaze.com/Accounts/Logon' }, }; var providers_small = { myopenid: { name: 'MyOpenID', label: 'Enter your MyOpenID username.', url: 'http://{username}.myopenid.com/' }, livejournal: { name: 'LiveJournal', label: 'Enter your Livejournal username.', url: 'http://{username}.livejournal.com/' }, flickr: { name: 'Flickr', label: 'Enter your Flickr username.', url: 'http://flickr.com/{username}/' }, technorati: { name: 'Technorati', label: 'Enter your Technorati username.', url: 'http://technorati.com/people/technorati/{username}/' }, wordpress: { name: 'Wordpress', label: 'Enter your Wordpress.com username.', url: 'http://{username}.wordpress.com/' }, blogger: { name: 'Blogger', label: 'Your Blogger account', url: 'http://{username}.blogspot.com/' }, verisign: { name: 'Verisign', label: 'Your Verisign username', url: 'http://{username}.pip.verisignlabs.com/' }, vidoop: { name: 'Vidoop', label: 'Your Vidoop username', url: 'http://{username}.myvidoop.com/' }, verisign: { name: 'Verisign', label: 'Your Verisign username', url: 'http://{username}.pip.verisignlabs.com/' }, claimid: { name: 'ClaimID', label: 'Your ClaimID username', url: 'http://claimid.com/{username}' } }; var providers = $.extend({}, providers_large, providers_small); var openid = { cookie_expires: 6*30, // 6 months. cookie_name: 'openid_provider', cookie_path: '/', img_path: 'images/', input_id: null, provider_url: null, init: function(input_id) { var openid_btns = $('#openid_btns'); this.input_id = input_id; $('#openid_choice').show(); $('#openid_input_area').empty(); // add box for each provider for (id in providers_large) { openid_btns.append(this.getBoxHTML(providers_large[id], 'large', '.gif')); } if (providers_small) { openid_btns.append('<br/>'); for (id in providers_small) { openid_btns.append(this.getBoxHTML(providers_small[id], 'small', '.ico')); } } $('#openid_form').submit(this.submit); var box_id = this.readCookie(); if (box_id) { this.signin(box_id, true); } }, getBoxHTML: function(provider, box_size, image_ext) { var box_id = provider["name"].toLowerCase(); return '<a title="'+provider["name"]+'" href="javascript: openid.signin(\''+ box_id +'\');"' + ' style="background: #FFF url(' + this.img_path + box_id + image_ext+') no-repeat center center" ' + 'class="' + box_id + ' openid_' + box_size + '_btn"></a>'; }, /* Provider image click */ signin: function(box_id, onload) { var provider = providers[box_id]; if (! provider) { return; } this.highlight(box_id); this.setCookie(box_id); // prompt user for input? if (provider['label']) { this.useInputBox(provider); this.provider_url = provider['url']; } else if(provider['form_url']) { $('#openid_form').attr("action", provider['form_url']); $('#openid_form').submit(); } else { this.setOpenIdUrl(provider['url']); if (! onload) { $('#openid_form').submit(); } } }, /* Sign-in button click */ submit: function() { var url = openid.provider_url; if (url) { url = url.replace('{username}', $('#openid_username').val()); openid.setOpenIdUrl(url); } return true; }, setOpenIdUrl: function (url) { var hidden = $('#'+this.input_id); if (hidden.length > 0) { hidden.value = url; } else { $('#openid_form').append('<input type="hidden" id="' + this.input_id + '" name="' + this.input_id + '" value="'+url+'"/>'); } }, highlight: function (box_id) { // remove previous highlight. var highlight = $('#openid_highlight'); if (highlight) { highlight.replaceWith($('#openid_highlight a')[0]); } // add new highlight. $('.'+box_id).wrap('<div id="openid_highlight"></div>'); }, setCookie: function (value) { var date = new Date(); date.setTime(date.getTime()+(this.cookie_expires*24*60*60*1000)); var expires = "; expires="+date.toGMTString(); document.cookie = this.cookie_name+"="+value+expires+"; path=" + this.cookie_path; }, readCookie: function () { var nameEQ = this.cookie_name + "="; var ca = document.cookie.split(';'); for(var i=0;i < ca.length;i++) { var c = ca[i]; while (c.charAt(0)==' ') c = c.substring(1,c.length); if (c.indexOf(nameEQ) == 0) return c.substring(nameEQ.length,c.length); } return null; }, useInputBox: function (provider) { var input_area = $('#openid_input_area'); var html = ''; var id = 'openid_username'; var value = ''; var label = provider['label']; var style = ''; if (label) { html = '<p>' + label + '</p>'; } if (provider['name'] == 'OpenID') { id = this.input_id; value = 'http://'; style = 'background:#FFF url('+this.img_path+'openid-inputicon.gif) no-repeat scroll 0 50%; padding-left:18px;'; } html += '<input id="'+id+'" type="text" style="'+style+'" name="'+id+'" value="'+value+'" />' + '<input id="openid_submit" type="submit" value="Sign-In"/>'; input_area.empty(); input_area.append(html); $('#'+id).focus(); } };

    Read the article

  • Problem in generation of custom classes at web service client

    - by user443324
    I have a web service which receives an custom object and returns another custom object. It can be deployed successfully on GlassFish or JBoss. @WebMethod(operationName = "providerRQ") @WebResult(name = "BookingInfoResponse" , targetNamespace = "http://tlonewayresprovidrs.jaxbutil.rakes.nhst.com/") public com.nhst.rakes.jaxbutil.tlonewayresprovidrs.BookingInfoResponse providerRQ(@WebParam(name = "BookingInfoRequest" , targetNamespace = "http://tlonewayresprovidrq.jaxbutil.rakes.nhst.com/") com.nhst.rakes.jaxbutil.tlonewayresprovidrq.BookingInfoRequest BookingInfoRequest) { com.nhst.rakes.jaxbutil.tlonewayresprovidrs.BookingInfoResponse BookingInfoResponse = new com.nhst.rakes.jaxbutil.tlonewayresprovidrs.BookingInfoResponse(); return BookingInfoResponse; } But when I create a client for this web service, two instances of BookingInfoRequest and BookingInfoResponse generated even I need only one instance. This time an error is returned that says multiple classes with same name are can not be possible....... Here is wsdl..... <?xml version='1.0' encoding='UTF-8'?><!-- Published by JAX-WS RI at http://jax-ws.dev.java.net. RI's version is JAX-WS RI 2.2.1-hudson-28-. --><!-- Generated by JAX-WS RI at http://jax-ws.dev.java.net. RI's version is JAX-WS RI 2.2.1-hudson-28-. --><definitions xmlns:wsu="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd" xmlns:wsp="http://www.w3.org/ns/ws-policy" xmlns:wsp1_2="http://schemas.xmlsoap.org/ws/2004/09/policy" xmlns:wsam="http://www.w3.org/2007/05/addressing/metadata" xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:tns="http://demo/" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns="http://schemas.xmlsoap.org/wsdl/" targetNamespace="http://demo/" name="DemoJAXBParamService"> <wsp:Policy wsu:Id="DemoJAXBParamPortBindingPolicy"> <ns1:OptimizedMimeSerialization xmlns:ns1="http://schemas.xmlsoap.org/ws/2004/09/policy/optimizedmimeserialization" /> </wsp:Policy> <types> <xsd:schema> <xsd:import namespace="http://tlonewayresprovidrs.jaxbutil.rakes.nhst.com/" schemaLocation="http://localhost:31133/DemoJAXBParamService/DemoJAXBParamService?xsd=1" /> </xsd:schema> <xsd:schema> <xsd:import namespace="http://tlonewayresprovidrs.jaxbutil.rakes.nhst.com" schemaLocation="http://localhost:31133/DemoJAXBParamService/DemoJAXBParamService?xsd=2" /> </xsd:schema> <xsd:schema> <xsd:import namespace="http://tlonewayresprovidrq.jaxbutil.rakes.nhst.com/" schemaLocation="http://localhost:31133/DemoJAXBParamService/DemoJAXBParamService?xsd=3" /> </xsd:schema> <xsd:schema> <xsd:import namespace="http://tlonewayresprovidrq.jaxbutil.rakes.nhst.com" schemaLocation="http://localhost:31133/DemoJAXBParamService/DemoJAXBParamService?xsd=4" /> </xsd:schema> <xsd:schema> <xsd:import namespace="http://demo/" schemaLocation="http://localhost:31133/DemoJAXBParamService/DemoJAXBParamService?xsd=5" /> </xsd:schema> </types> <message name="providerRQ"> <part name="parameters" element="tns:providerRQ" /> </message> <message name="providerRQResponse"> <part name="parameters" element="tns:providerRQResponse" /> </message> <portType name="DemoJAXBParam"> <operation name="providerRQ"> <input wsam:Action="http://demo/DemoJAXBParam/providerRQRequest" message="tns:providerRQ" /> <output wsam:Action="http://demo/DemoJAXBParam/providerRQResponse" message="tns:providerRQResponse" /> </operation> </portType> <binding name="DemoJAXBParamPortBinding" type="tns:DemoJAXBParam"> <wsp:PolicyReference URI="#DemoJAXBParamPortBindingPolicy" /> <soap:binding transport="http://schemas.xmlsoap.org/soap/http" style="document" /> <operation name="providerRQ"> <soap:operation soapAction="" /> <input> <soap:body use="literal" /> </input> <output> <soap:body use="literal" /> </output> </operation> </binding> <service name="DemoJAXBParamService"> <port name="DemoJAXBParamPort" binding="tns:DemoJAXBParamPortBinding"> <soap:address location="http://localhost:31133/DemoJAXBParamService/DemoJAXBParamService" /> </port> </service> </definitions> So, I want to know that how to generate only one instance(I don't know why two instances are generated at client side?). Please help me to move in right direction.

    Read the article

  • when rendering the page on different browsers layout changes

    - by user1776590
    I have create a website using asp.net and when I render the the website on firefox and IE the website look the same and when rendering it on Chrome it move the button lower and changes the location of it this is my master page code <%@ Master Language="C#" AutoEventWireup="true" CodeBehind="UMSite.master.cs" Inherits="WebApplication4.UMSiteMaster" %> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en"> <head runat="server"> <title></title> <link href="~/Styles/UM.css" rel="stylesheet" type="text/css" /> <asp:ContentPlaceHolder ID="HeadContent" runat="server"> </asp:ContentPlaceHolder> </head> <body> <form id="Form1" runat="server"> <div class="page"> <div class="header"> <div class="title"> <h1><img alt="" src="Styles/UMHeader.png" width= "950" height= "65" /></h1> <div class="clear hideSkiplink"> <asp:Menu ID="NavigationMenu" runat="server" CssClass="menu" EnableViewState="false" IncludeStyleBlock="false" Orientation="Horizontal"> <Items> <asp:MenuItem NavigateUrl="~/Home.aspx" Text="Home"/> </Items> </asp:Menu> </div> </div> </div></h1> <div class="main" runat="server"> <asp:ContentPlaceHolder ID="MainContent" runat="server"/> </div> </form> </body> </html> the below is the css /* DEFAULTS ----------------------------------------------------------*/ body { background: #b6b7bc; font-size: .80em; font-family: "Helvetica Neue", "Lucida Grande", "Segoe UI", Arial, Helvetica, Verdana, sans-serif; margin: 0px; padding: 0px; color: #696969; height: 192px; } a:link, a:visited { color: #034af3; } a:hover { color: #1d60ff; text-decoration: none; } a:active { color: #034af3; } p { margin-bottom: 10px; line-height: 1.6em; } /* HEADINGS ----------------------------------------------------------*/ h1, h2, h3, h4, h5, h6 { font-size: 1.5em; color: #666666; font-variant: small-caps; text-transform: none; font-weight: 200; margin-bottom: 0px; } h1 { font-size: 1.6em; padding-bottom: 0px; margin-bottom: 0px; } h2 { font-size: 1.5em; font-weight: 600; } h3 { font-size: 1.2em; } h4 { font-size: 1.1em; } h5, h6 { font-size: 1em; } /* this rule styles <h1> and <h2> tags that are the first child of the left and right table columns */ .rightColumn > h1, .rightColumn > h2, .leftColumn > h1, .leftColumn > h2 { margin-top: 0px; } /* PRIMARY LAYOUT ELEMENTS ----------------------------------------------------------*/ .page { width: 950px; height:auto; background-color: #fff; margin: 10px auto 5px auto; border: 1px solid #496077; } .header { position:relative; margin: 0px; padding: 0px; background: #E30613; width: 100%; top: 0px; left: 0px; height: 90px; } .header h1 { font-weight: 700; margin: 0px; padding: 0px 0px 0px 0px; color: #E30613; border: none; line-height: 2em; font-size: 2em; } .main { padding: 0px 12px; margin: 0px 0px 0px 0px; min-height: 630px; width:auto; background-image:url('UMBackground.png'); } .leftCol { padding: 6px 0px; margin: 0px 0px 0px 0px; width: 200px; min-height: 200px; width:auto; } .footer { color: #4e5766; padding: 0px 0px 0px 0px; margin: 0px auto; text-align: center; line-height: normal; } /* TAB MENU ----------------------------------------------------------*/ div.hideSkiplink { background-color:#E30613; width: 950px; height: 35px; margin-top: 0px; } div.menu { padding: 1px 0px 1px 2px; } div.menu ul { list-style: none; margin: 0px; padding: 5px; width: auto; } div.menu ul li a, div.menu ul li a:visited { background-color: #E30613; border: 1.25px #00BFFF solid; color: #F5FFFA; display:inline; line-height: 1.35em; padding: 10px 30px; text-decoration: none; white-space: nowrap; } div.menu ul li a:hover { background-color: #000000; color: #F5FFFA; text-decoration: none; } div.menu ul li a:active { background-color: #E30613; color: #cfdbe6; text-decoration: none; } /* FORM ELEMENTS ----------------------------------------------------------*/ fieldset { margin: 1em 0px; padding: 1em; border: 1px solid #ccc; } fieldset p { margin: 2px 12px 10px 10px; } fieldset.login label, fieldset.register label, fieldset.changePassword label { display: block; } fieldset label.inline { display: inline; } legend { font-size: 1.1em; font-weight: 600; padding: 2px 4px 8px 4px; } input.textEntry { width: 320px; border: 1px solid #ccc; } input.passwordEntry { width: 320px; border: 1px solid #ccc; } div.accountInfo { width: 42%; } /* MISC ----------------------------------------------------------*/ .clear { clear: both; } .title { display: block; float: left; text-align: left; width: 947px; height: 132px; } .loginDisplay { font-size: 1.1em; display: block; text-align: right; padding: 10px; color: White; } .loginDisplay a:link { color: white; } .loginDisplay a:visited { color: white; } .loginDisplay a:hover { color: white; } .failureNotification { font-size: 1.2em; color: Red; } .bold { font-weight: bold; } .submitButton { text-align: right; padding-right: 10px; }

    Read the article

  • I can't use Spring filters in servlet-context XML

    - by gotch4
    For some reason both Eclipse and Spring can't find the filter tag (there is even a red mark)... What's wrong? <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:mvc="http://www.springframework.org/schema/mvc" xmlns:context="http://www.springframework.org/schema/context" xmlns:aop="http://www.springframework.org/schema/aop" xmlns:tx="http://www.springframework.org/schema/tx" xmlns:p="http://www.springframework.org/schema/p" xsi:schemaLocation="http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans-2.5.xsd http://www.springframework.org/schema/aop http://www.springframework.org/schema/aop/spring-aop-3.0.xsd http://www.springframework.org/schema/tx http://www.springframework.org/schema/tx/spring-tx-3.0.xsd http://www.springframework.org/schema/context http://www.springframework.org/schema/context/spring-context-3.0.xsd http://www.springframework.org/schema/mvc http://www.springframework.org/schema/mvc/spring-mvc-3.0.xsd"> <bean class="org.springframework.dao.annotation.PersistenceExceptionTranslationPostProcessor"></bean> <bean id="myDataSource" class="org.apache.commons.dbcp.BasicDataSource" destroy-method="close"> <property name="driverClassName" value="com.mysql.jdbc.Driver" /> <property name="url" value="jdbc:mysql://localhost/jacciseweb" /> <property name="username" value="root" /> <property name="password" value="siussi" /> </bean> <bean id="mySessionFactory" class="org.springframework.orm.hibernate3.annotation.AnnotationSessionFactoryBean"> <property name="dataSource" ref="myDataSource" /> <property name="annotatedClasses"> <list> <value>it.jsoftware.jacciseweb.beans.Utente </value> <value>it.jsoftware.jacciseweb.beans.Ordine </value> </list> </property> <property name="hibernateProperties"> <props> <prop key="hibernate.dialect"> org.hibernate.dialect.MySQLDialect </prop> <prop key="hibernate.show_sql"> true </prop> <prop key="hibernate.hbm2ddl.auto"> update </prop> <prop key="hibernate.cache.provider_class">org.hibernate.cache.NoCacheProvider</prop> </props> </property> </bean> <filter> <filter-name>hibernateFilter</filter-name> <filter-class> org.springframework.orm.hibernate3.support.OpenSessionInViewFilter </filter-class> <init-param> <param-name>singleSession</param-name> <param-value>true</param-value> </init-param> <init-param> <param-name>sessionFactoryBeanName</param-name> <param-value>mySessionFactory</param-value> </init-param> </filter> <!-- <aop:config> --> <!-- <aop:pointcut id="productServiceMethods" --> <!-- expression="execution(* product.ProductService.*(..))" /> --> <!-- <aop:advisor advice-ref="txAdvice" pointcut-ref="productServiceMethods" /> --> <!-- </aop:config> --> <bean id="acciseHibernateDao" class="it.jsoftware.jacciseweb.model.JAcciseWebManagementDaoHibernate"> <property name="sessionFactory" ref="mySessionFactory" /> </bean> <bean id="transactionManager" class="org.springframework.orm.hibernate3.HibernateTransactionManager"> <property name="sessionFactory" ref="mySessionFactory" /> </bean> <tx:annotation-driven /> <bean id="acciseService" class="it.jsoftware.jacciseweb.model.JAcciseWebManagementServiceImpl"> <property name="dao" ref="acciseHibernateDao" /> </bean> <context:component-scan base-package="it.jsoftware.jacciseweb.controllers"></context:component-scan> <mvc:annotation-driven /> <bean class="org.springframework.web.servlet.mvc.annotation.AnnotationMethodHandlerAdapter" p:synchronizeOnSession="true" /> <bean class="org.springframework.web.servlet.handler.BeanNameUrlHandlerMapping" /> <mvc:resources mapping="/resources/**" location="/resources/" /> <!-- non serve, è annotato --> <!-- <bean name="/accise" class="it.jsoftware.jacciseweb.controllers.MainController"> </bean> --> </beans> in particular it says "filter" is invalid content

    Read the article

  • I want to keep the values on textbox after onchange function

    - by user1908045
    hello i have problem with this code..I want to keep the values of the textboxes when the pageload and didnt write again the values. I have two drop down list. the First one is the country when the country selected then the page load and appear the city to select but afte the pageload the values on textbox is empty. I want to keep the values of textbox when the page load. This is the code <head> <script type="text/javascript"> function Load_id() { var Count = document.getElementById("Count").value; var Count_txt = "?Count=" location = Count_txt + Count } </script> <meta charset="UTF-8"> </head> <body> <div class="main"> <div class="headers"> <table> <tr><td rowspan="2"><img alt="unipi" src="/Images/logo.jpeg" height="75" width="52"></td> <td>University</td></tr> <tr><td>Data</td></tr> </table> </div> <div class="form"> <h3>Personal</h3><br/><br/><br/> <form id="Page1" name="Page1" action="Form1Sub.php" method="Post"> <table style="width:520px;text-align:left;"> <tr><td><label>Number:</label></td> <td><input type="text" required="required" id="AM" name="AM" value=""/></td> </tr> <tr><td><label>Name:</label></td> <td><input type="text" required="required" name="Name"/></td> </tr> <?php $host="localhost"; $username=""; $password=""; $dbName="Database"; $connection = mysql_connect($host, $username, $password) or die("Couldn't Connect to the Server"); $db = mysql_select_db($dbName, $connection) or die("cannot select DataBase"); $Count = $_GET['Count']; echo "<tr><td><label>Country</label></td>\n"; $country = mysql_query("select DISTINCT Country FROM lut_country_city "); echo " <td><select id=\"Count\" name=\"cat\" onChange=\"Load_id(this)\">\n"; echo " `<option>Select Country</option>\n"; while($nt=mysql_fetch_array($country)){ $selected = ($nt["Country"] == $Count)? "SELECTED":""; echo"<option value=\"".$nt['Country']."\"". $selected." >".$nt['Country']."</option>"; } echo " </select></td></tr>\n"; echo"<tr><td><label>City:</label></td>\n"; $q2 = mysql_query("Select id,City,Country FROM lut_country_city WHERE Country = '$Count'"); echo"<td><select name=\"SelectCity\">\n"; while($row = mysql_fetch_array($q2)) { echo"<option value=\"".$row['id']."\">".$row['City']."</option>"; } echo " </select></td></tr>\n"; ?> </table> <p> <button type="submit" id="Next">Next</button> </form> <form id="form1" action="index.php"> <button id="Back" type="submit">Back</button> </form> </p> </div> </div> </body> </html>

    Read the article

  • Optimizing python code performance when importing zipped csv to a mongo collection

    - by mark
    I need to import a zipped csv into a mongo collection, but there is a catch - every record contains a timestamp in Pacific Time, which must be converted to the local time corresponding to the (longitude,latitude) pair found in the same record. The code looks like so: def read_csv_zip(path, timezones): with ZipFile(path) as z, z.open(z.namelist()[0]) as input: csv_rows = csv.reader(input) header = csv_rows.next() check,converters = get_aux_stuff(header) for csv_row in csv_rows: if check(csv_row): row = { converter[0]:converter[1](value) for converter, value in zip(converters, csv_row) if allow_field(converter) } ts = row['ts'] lng, lat = row['loc'] found_tz_entry = timezones.find_one(SON({'loc': {'$within': {'$box': [[lng-tz_lookup_radius, lat-tz_lookup_radius],[lng+tz_lookup_radius, lat+tz_lookup_radius]]}}})) if found_tz_entry: tz_name = found_tz_entry['tz'] local_ts = ts.astimezone(timezone(tz_name)).replace(tzinfo=None) row['tz'] = tz_name else: local_ts = (ts.astimezone(utc) + timedelta(hours = int(lng/15))).replace(tzinfo = None) row['local_ts'] = local_ts yield row def insert_documents(collection, source, batch_size): while True: items = list(itertools.islice(source, batch_size)) if len(items) == 0: break; try: collection.insert(items) except: for item in items: try: collection.insert(item) except Exception as exc: print("Failed to insert record {0} - {1}".format(item['_id'], exc)) def main(zip_path): with Connection() as connection: data = connection.mydb.data timezones = connection.timezones.data insert_documents(data, read_csv_zip(zip_path, timezones), 1000) The code proceeds as follows: Every record read from the csv is checked and converted to a dictionary, where some fields may be skipped, some titles be renamed (from those appearing in the csv header), some values may be converted (to datetime, to integers, to floats. etc ...) For each record read from the csv, a lookup is made into the timezones collection to map the record location to the respective time zone. If the mapping is successful - that timezone is used to convert the record timestamp (pacific time) to the respective local timestamp. If no mapping is found - a rough approximation is calculated. The timezones collection is appropriately indexed, of course - calling explain() confirms it. The process is slow. Naturally, having to query the timezones collection for every record kills the performance. I am looking for advises on how to improve it. Thanks. EDIT The timezones collection contains 8176040 records, each containing four values: > db.data.findOne() { "_id" : 3038814, "loc" : [ 1.48333, 42.5 ], "tz" : "Europe/Andorra" } EDIT2 OK, I have compiled a release build of http://toblerity.github.com/rtree/ and configured the rtree package. Then I have created an rtree dat/idx pair of files corresponding to my timezones collection. So, instead of calling collection.find_one I call index.intersection. Surprisingly, not only there is no improvement, but it works even more slowly now! May be rtree could be fine tuned to load the entire dat/idx pair into RAM (704M), but I do not know how to do it. Until then, it is not an alternative. In general, I think the solution should involve parallelization of the task. EDIT3 Profile output when using collection.find_one: >>> p.sort_stats('cumulative').print_stats(10) Tue Apr 10 14:28:39 2012 ImportDataIntoMongo.profile 64549590 function calls (64549180 primitive calls) in 1231.257 seconds Ordered by: cumulative time List reduced from 730 to 10 due to restriction <10> ncalls tottime percall cumtime percall filename:lineno(function) 1 0.012 0.012 1231.257 1231.257 ImportDataIntoMongo.py:1(<module>) 1 0.001 0.001 1230.959 1230.959 ImportDataIntoMongo.py:187(main) 1 853.558 853.558 853.558 853.558 {raw_input} 1 0.598 0.598 370.510 370.510 ImportDataIntoMongo.py:165(insert_documents) 343407 9.965 0.000 359.034 0.001 ImportDataIntoMongo.py:137(read_csv_zip) 343408 2.927 0.000 287.035 0.001 c:\python27\lib\site-packages\pymongo\collection.py:489(find_one) 343408 1.842 0.000 274.803 0.001 c:\python27\lib\site-packages\pymongo\cursor.py:699(next) 343408 2.542 0.000 271.212 0.001 c:\python27\lib\site-packages\pymongo\cursor.py:644(_refresh) 343408 4.512 0.000 253.673 0.001 c:\python27\lib\site-packages\pymongo\cursor.py:605(__send_message) 343408 0.971 0.000 242.078 0.001 c:\python27\lib\site-packages\pymongo\connection.py:871(_send_message_with_response) Profile output when using index.intersection: >>> p.sort_stats('cumulative').print_stats(10) Wed Apr 11 16:21:31 2012 ImportDataIntoMongo.profile 41542960 function calls (41542536 primitive calls) in 2889.164 seconds Ordered by: cumulative time List reduced from 778 to 10 due to restriction <10> ncalls tottime percall cumtime percall filename:lineno(function) 1 0.028 0.028 2889.164 2889.164 ImportDataIntoMongo.py:1(<module>) 1 0.017 0.017 2888.679 2888.679 ImportDataIntoMongo.py:202(main) 1 2365.526 2365.526 2365.526 2365.526 {raw_input} 1 0.766 0.766 502.817 502.817 ImportDataIntoMongo.py:180(insert_documents) 343407 9.147 0.000 491.433 0.001 ImportDataIntoMongo.py:152(read_csv_zip) 343406 0.571 0.000 391.394 0.001 c:\python27\lib\site-packages\rtree-0.7.0-py2.7.egg\rtree\index.py:384(intersection) 343406 379.957 0.001 390.824 0.001 c:\python27\lib\site-packages\rtree-0.7.0-py2.7.egg\rtree\index.py:435(_intersection_obj) 686513 22.616 0.000 38.705 0.000 c:\python27\lib\site-packages\rtree-0.7.0-py2.7.egg\rtree\index.py:451(_get_objects) 343406 6.134 0.000 33.326 0.000 ImportDataIntoMongo.py:162(<dictcomp>) 346 0.396 0.001 30.665 0.089 c:\python27\lib\site-packages\pymongo\collection.py:240(insert) EDIT4 I have parallelized the code, but the results are still not very encouraging. I am convinced it could be done better. See my own answer to this question for details.

    Read the article

< Previous Page | 615 616 617 618 619 620 621 622 623 624 625 626  | Next Page >