Search Results

Search found 4144 results on 166 pages for 'undefined symbol'.

Page 62/166 | < Previous Page | 58 59 60 61 62 63 64 65 66 67 68 69  | Next Page >

  • Django CMS - not able to upload images through cmsplugin_filer_image

    - by Luke
    i have a problem with a local installation on django cms 2.3.3: i've installed it trough pip, in a separated virtualenv. next i followed the tutorial for settings.py configuration, i started the server. Then in the admin i created an page (home), and i've tried to add an image in the placeholder through the cmsplugin_filer_image, but the upload seems that doesn't work. here's my settings.py: # Django settings for cms1 project. # -*- coding: utf-8 -*- import os gettext = lambda s: s PROJECT_PATH = os.path.abspath(os.path.dirname(__file__)) DEBUG = True TEMPLATE_DEBUG = DEBUG ADMINS = ( # ('Your Name', '[email protected]'), ) MANAGERS = ADMINS DATABASES = { 'default': { 'ENGINE': 'django.db.backends.postgresql_psycopg2', # Add 'postgresql_psycopg2', 'mysql', 'sqlite3' or 'oracle'. 'NAME': 'cms1', # Or path to database file if using sqlite3. 'USER': 'cms', # Not used with sqlite3. 'PASSWORD': 'cms', # Not used with sqlite3. 'HOST': '', # Set to empty string for localhost. Not used with sqlite3. 'PORT': '', # Set to empty string for default. Not used with sqlite3. } } # Local time zone for this installation. Choices can be found here: # http://en.wikipedia.org/wiki/List_of_tz_zones_by_name # although not all choices may be available on all operating systems. # In a Windows environment this must be set to your system time zone. TIME_ZONE = 'Europe/Rome' # Language code for this installation. All choices can be found here: # http://www.i18nguy.com/unicode/language-identifiers.html LANGUAGE_CODE = 'it-it' SITE_ID = 1 # If you set this to False, Django will make some optimizations so as not # to load the internationalization machinery. USE_I18N = True # If you set this to False, Django will not format dates, numbers and # calendars according to the current locale. USE_L10N = True # If you set this to False, Django will not use timezone-aware datetimes. USE_TZ = True # Absolute filesystem path to the directory that will hold user-uploaded files. # Example: "/home/media/media.lawrence.com/media/" MEDIA_ROOT = os.path.join(PROJECT_PATH, "media") # URL that handles the media served from MEDIA_ROOT. Make sure to use a # trailing slash. # Examples: "http://media.lawrence.com/media/", "http://example.com/media/" MEDIA_URL = '/media/' # Absolute path to the directory static files should be collected to. # Don't put anything in this directory yourself; store your static files # in apps' "static/" subdirectories and in STATICFILES_DIRS. # Example: "/home/media/media.lawrence.com/static/" STATIC_ROOT = os.path.join(PROJECT_PATH, "static") STATIC_URL = "/static/" # Additional locations of static files STATICFILES_DIRS = ( os.path.join(PROJECT_PATH, "static_auto"), # Put strings here, like "/home/html/static" or "C:/www/django/static". # Always use forward slashes, even on Windows. # Don't forget to use absolute paths, not relative paths. ) # List of finder classes that know how to find static files in # various locations. STATICFILES_FINDERS = ( 'django.contrib.staticfiles.finders.FileSystemFinder', 'django.contrib.staticfiles.finders.AppDirectoriesFinder', # 'django.contrib.staticfiles.finders.DefaultStorageFinder', ) # Make this unique, and don't share it with anybody. SECRET_KEY = '^c2q3d8w)f#gk%5i)(#i*lwt%lm-!2=(*1d!1cf+rg&amp;-hqi_9u' # List of callables that know how to import templates from various sources. TEMPLATE_LOADERS = ( 'django.template.loaders.filesystem.Loader', 'django.template.loaders.app_directories.Loader', # 'django.template.loaders.eggs.Loader', ) MIDDLEWARE_CLASSES = ( 'django.middleware.common.CommonMiddleware', 'django.contrib.sessions.middleware.SessionMiddleware', 'django.middleware.csrf.CsrfViewMiddleware', 'django.contrib.auth.middleware.AuthenticationMiddleware', 'django.contrib.messages.middleware.MessageMiddleware', 'cms.middleware.multilingual.MultilingualURLMiddleware', 'cms.middleware.page.CurrentPageMiddleware', 'cms.middleware.user.CurrentUserMiddleware', 'cms.middleware.toolbar.ToolbarMiddleware', # Uncomment the next line for simple clickjacking protection: # 'django.middleware.clickjacking.XFrameOptionsMiddleware', ) ROOT_URLCONF = 'cms1.urls' # Python dotted path to the WSGI application used by Django's runserver. WSGI_APPLICATION = 'cms1.wsgi.application' TEMPLATE_DIRS = ( os.path.join(PROJECT_PATH, "templates"), # Put strings here, like "/home/html/django_templates" or "C:/www/django/templates". # Always use forward slashes, even on Windows. # Don't forget to use absolute paths, not relative paths. ) CMS_TEMPLATES = ( ('template_1.html', 'Template One'), ('template_2.html', 'Template Two'), ) TEMPLATE_CONTEXT_PROCESSORS = ( 'django.contrib.auth.context_processors.auth', 'django.core.context_processors.i18n', 'django.core.context_processors.request', 'django.core.context_processors.media', 'django.core.context_processors.static', 'cms.context_processors.media', 'sekizai.context_processors.sekizai', ) LANGUAGES = [ ('it', 'Italiano'), ('en', 'English'), ] INSTALLED_APPS = ( 'django.contrib.auth', 'django.contrib.contenttypes', 'django.contrib.sessions', 'django.contrib.sites', 'django.contrib.messages', 'django.contrib.staticfiles', 'cms', #django CMS itself 'mptt', #utilities for implementing a modified pre-order traversal tree 'menus', #helper for model independent hierarchical website navigation 'south', #intelligent schema and data migrations 'sekizai', #for javascript and css management #'cms.plugins.file', 'cms.plugins.flash', 'cms.plugins.googlemap', 'cms.plugins.link', #'cms.plugins.picture', 'cms.plugins.snippet', 'cms.plugins.teaser', 'cms.plugins.text', #'cms.plugins.video', 'cms.plugins.twitter', 'filer', 'cmsplugin_filer_file', 'cmsplugin_filer_folder', 'cmsplugin_filer_image', 'cmsplugin_filer_teaser', 'cmsplugin_filer_video', 'easy_thumbnails', 'PIL', # Uncomment the next line to enable the admin: 'django.contrib.admin', # Uncomment the next line to enable admin documentation: # 'django.contrib.admindocs', ) # A sample logging configuration. The only tangible logging # performed by this configuration is to send an email to # the site admins on every HTTP 500 error when DEBUG=False. # See http://docs.djangoproject.com/en/dev/topics/logging for # more details on how to customize your logging configuration. LOGGING = { 'version': 1, 'disable_existing_loggers': False, 'filters': { 'require_debug_false': { '()': 'django.utils.log.RequireDebugFalse' } }, 'handlers': { 'mail_admins': { 'level': 'ERROR', 'filters': ['require_debug_false'], 'class': 'django.utils.log.AdminEmailHandler' } }, 'loggers': { 'django.request': { 'handlers': ['mail_admins'], 'level': 'ERROR', 'propagate': True, }, } } when i try to upload an image, in the clipboard section i don't have the thumbnail, but just an 'undefined' message: and this is the runserver console while trying to upload: [20/Oct/2012 15:15:56] "POST /admin/filer/clipboard/operations/upload/?qqfile=29708_1306856312320_7706073_n.jpg HTTP/1.1" 500 248133 [20/Oct/2012 15:15:56] "GET /it/admin/filer/folder/unfiled_images/undefined HTTP/1.1" 301 0 [20/Oct/2012 15:15:56] "GET /it/admin/filer/folder/unfiled_images/undefined/ HTTP/1.1" 404 1739 Also, this is project filesystem: cms1 +-- cms1 ¦   +-- __init__.py ¦   +-- __init__.pyc ¦   +-- media ¦   ¦   +-- filer_public ¦   ¦   +-- 2012 ¦   ¦   +-- 10 ¦   ¦   +-- 20 ¦   ¦   +-- 29708_1306856312320_7706073_n_1.jpg ¦   ¦   +-- 29708_1306856312320_7706073_n_2.jpg ¦   ¦   +-- 29708_1306856312320_7706073_n_3.jpg ¦   ¦   +-- 29708_1306856312320_7706073_n_4.jpg ¦   ¦   +-- 29708_1306856312320_7706073_n_5.jpg ¦   ¦   +-- 29708_1306856312320_7706073_n_6.jpg ¦   ¦   +-- 29708_1306856312320_7706073_n_7.jpg ¦   ¦   +-- 29708_1306856312320_7706073_n.jpg ¦   ¦   +-- torrent-client-macosx.jpg ¦   +-- settings.py ¦   +-- settings.pyc ¦   +-- static ¦   +-- static_auto ¦   +-- static_manual ¦   +-- templates ¦   ¦   +-- base.html ¦   ¦   +-- template_1.html ¦   ¦   +-- template_2.html ¦   +-- urls.py ¦   +-- urls.pyc ¦   +-- wsgi.py ¦   +-- wsgi.pyc +-- manage.py So files are uploaded, but they are not accessible to cms. there's a similar question here, but doens't help me so much. It would be very helpful any help on this issue to me. Thanks, luke

    Read the article

  • How can I get LibreOffice to 'number' footnotes in the order *, †, ‡, § etc.?

    - by einpoklum
    With LaTeX, I can do: \documentclass[10pt]{article} \usepackage[symbol*]{footmisc} \begin{document} One\footnote{f1} Two \footnote{f2} Three \footnote{f3} Four \footnote{f4} \end{document} And get *, †, ‡, § ... as consecutive footnote markers. MS-Word has this feature too - an alternative footnote numbering scheme. How can I achieve the same with LibreOffice? PS - Shouldn't the OpenOffice and LibreOffice tags be merged?

    Read the article

  • I was adding a wordpress plugin when I received message : couldn't find constant VHOST, now site has

    - by jackie
    Can anyone help me get my site back? I was adding a site map plugin with wordpress and received the message Warning: constant() [function.constant]: Couldn't find constant VHOST in /home/content / xxxxxxxxxxx /html/wp-content/plugins/wordpress-mu-domain-mapping/domain_mapping.php on line 30 Fatal error: Call to undefined function is_site_admin() in /home/content/xxxxxxxxxxxxxxxxx/html/wp-content/plugins/wordpress-mu-domain-mapping/domain_mapping.php on line 33 Now I have no site? Can it be retrieved? Any advice would be greatly appreciated. Jackie

    Read the article

  • F3-F5 keys incorrectly behaving as audio keys

    - by obvio171
    I don't know if this is a configuration issue or a hardware issue, but I have a Kinesis Advantage USB keyboard and for some reason the F3-F5 keys aren't responding as they used to. They don't respond to anything and, when I tried using F5 on Emacs, it said <XF86AudioNext> is undefined, so I guess it's a weird mapping problem. Any idea how I could remap them to the original meaning?

    Read the article

  • SVN configuration problem

    - by Sreeraj
    Configured the SVN with httpd service including below modules but it gives an error as below: LoadModule dav_svn_module /usr/lib/httpd/modules/mod_dav_svn.so LoadModule authz_svn_module /usr/lib/httpd/modules/mod_authz_svn.so error: Starting httpd: httpd: Syntax error on line 206 of /etc/httpd/conf/httpd.conf: Cannot load /usr/lib/httpd/modules/mod_dav_svn.so into server: /usr/lib/httpd/modules/mod_dav_svn.so: undefined symbol: svn_mergeinfo__remove_prefix_from_catalog Server version: Apache/2.2.3 Server built: Nov 12 2008 07:09:27 RHEL 5.4 - 32 bit How would you troubleshoot this error message?

    Read the article

  • MDB2, Pear, Mysql error

    - by Kyle Hudson
    ORIGINALLY POSTED ON http://stackoverflow.com/questions/2682332/mdb2-pear-mysql-error however as its a server issue thought i may have more luck here. Hi Guys, I have PEAR, MDB2 and Mysql Driver installed however I keep getting: Fatal error: Call to undefined function: MDB2_Driver_mysql::_isNewLinkSet(). in /home/**/PEAR/MDB2.php on line 1937. The Server is CentOS I am stuck, any help would be appriciated. Thanks :)

    Read the article

  • Visual Studio Project build Error [closed]

    - by Mina Sobhy
    I installed Visual Studio 2010 on Windows7 SP1 but a debug error occurs: 1>------ Build started: Project: x, Configuration: Debug Win32 ------ 1>MSVCRTD.lib(crtexe.obj) : error LNK2019: unresolved external symbol main referenced in function __tmainCRTStartup 1>C:\Users\mina\Documents\Visual Studio 2010\Projects\x\Debug\x.exe : fatal error LNK1120: 1 unresolved externals ========== Build: 0 succeeded, 1 failed, 0 up-to-date, 0 skipped ==========

    Read the article

  • sqlite3 support on centos with PECL?

    - by shadow_of__soul
    i just realized that the rpm version of php that i have installed on the server don't have sqlite support (well it have the PDO support but for some reason don't work) so i installed as a PECL extension, and now it show the support on the phpinfo() but still the open inviter script give me the error of: Call to undefined function sqlite_open() and i already restarted httpd also any hint where i can find a solution or guide?

    Read the article

  • How to check if Emacs is in GUI mode (and execute `tool-bar-mode` only then)?

    - by dehmann
    I have this line in my .emacs file: (tool-bar-mode 0) because I hate the toolbars in my GUI emacs (/Applications/Emacs.app/Contents/MacOS/Emacs). But when I start up my other, text-based emacs in the terminal (/opt/local/bin/emacs) it complains about that command: Symbol's function definition is void: tool-bar-mode How can I add an if condition so that it executes the tool-bar-mode command only when I'm in the GUI emacs? Thanks!

    Read the article

  • avconv - not working with movflags

    - by MarKa
    With the Parameter "-movflags frag_custom" my avconv says [mp4 muxer @ 0x8d05f60] [Eval @ 0x7fffcc763f00] Undefined constant or missing '(' in 'frag_custom' [mp4 muxer @ 0x8d05f60] Unable to parse option value "frag_custom" [mp4 muxer @ 0x8d05f60] Error setting option movflags to value frag_custom. But with avconv is compiled with a mp4 muxer, so whats the problem ? Version is avconv 0.8.1-4:0.8.1-0ubuntu1

    Read the article

  • Logitech keboard wrong keys under MAC OSX

    - by David Casillas
    I have a Logitech MK250 keyboard I use with my Macbook. One day the "minor/mayor than" and the "back slash" keys flip their functionality, so I have to hit "backslash" to get a "minor than" symbol and press the "alt + minor than" key to get the "backslash". Is there any way to reverse this annoying behavior? I often switch to Windows, where the keys work the expected way, and I'm always missing the right key.

    Read the article

  • Unable to start rabbitmq-server on Ubuntu 12.04

    - by lxyu
    I try to install rabbitmq-server on ubuntu-server 12.04 but failed. Then I add the apt source list following the guide in http://www.rabbitmq.com/install-debian.html But reinstall still have the same error as following: $ sudo aptitude install rabbitmq-server ... Setting up rabbitmq-server (2.8.7-1) ... * Starting message broker rabbitmq-server * FAILED - check /var/log/rabbitmq/startup_\{log, _err\} ...fail! invoke-rc.d: initscript rabbitmq-server, action "start" failed. dpkg: error processing rabbitmq-server (--configure): subprocess installed post-installation script returned error exit status 1 No apport report written because MaxReports is reached already Processing triggers for libc-bin ... ldconfig deferred processing now taking place Errors were encountered while processing: rabbitmq-server E: Sub-process /usr/bin/dpkg returned an error code (1) A package failed to install. Trying to recover: Setting up rabbitmq-server (2.8.7-1) ... * Starting message broker rabbitmq-server * FAILED - check /var/log/rabbitmq/startup_\{log, _err\} ...fail! invoke-rc.d: initscript rabbitmq-server, action "start" failed. dpkg: error processing rabbitmq-server (--configure): subprocess installed post-installation script returned error exit status 1 Errors were encountered while processing: rabbitmq-server And error log seems show nothing useful neither: # startup_err shows this Crash dump was written to: erl_crash.dump Kernel pid terminated (application_controller) ({application_start_failure,kernel,{shutdown,{kernel,start,[normal,[]]}}}) # startup_log shows this {error_logger,{{2012,10,10},{22,31,54}},"Protocol: ~p: register error: ~p~n",["inet_tcp",{{badmatch,{error,epmd_close}},[{inet_tcp_dist,listen,1},{net_kernel,start_protos,4},{net_kernel,start_protos,3},{net_kernel,init_node,2},{net_kernel,init,1},{gen_server,init_it,6},{proc_lib,init_p_do_apply,3}]}]} {error_logger,{{2012,10,10},{22,31,54}},crash_report,[[{initial_call,{net_kernel,init,['Argument__1']}},{pid,<0.20.0>},{registered_name,[]},{error_info,{exit,{error,badarg},[{gen_server,init_it,6},{proc_lib,init_p_do_apply,3}]}},{ancestors,[net_sup,kernel_sup,<0.9.0>]},{messages,[]},{links,[#Port<0.90>,<0.17.0>]},{dictionary,[{longnames,false}]},{trap_exit,true},{status,running},{heap_size,610},{stack_size,24},{reductions,511}],[]]} {error_logger,{{2012,10,10},{22,31,54}},supervisor_report,[{supervisor,{local,net_sup}},{errorContext,start_error},{reason,{'EXIT',nodistribution}},{offender,[{pid,undefined},{name,net_kernel},{mfargs,{net_kernel,start_link,[[rabbitmqprelaunch18417,shortnames]]}},{restart_type,permanent},{shutdown,2000},{child_type,worker}]}]} {error_logger,{{2012,10,10},{22,31,54}},supervisor_report,[{supervisor,{local,kernel_sup}},{errorContext,start_error},{reason,shutdown},{offender,[{pid,undefined},{name,net_sup},{mfargs,{erl_distribution,start_link,[]}},{restart_type,permanent},{shutdown,infinity},{child_type,supervisor}]}]} {error_logger,{{2012,10,10},{22,31,54}},std_info,[{application,kernel},{exited,{shutdown,{kernel,start,[normal,[]]}}},{type,permanent}]} {"Kernel pid terminated",application_controller,"{application_start_failure,kernel,{shutdown,{kernel,start,[normal,[]]}}}"} I have googled for some time but got nothing useful. One solution on the internet is to make sure hostname pingable, but my /etc/hosts already have this line on top: 127.0.0.1 localhost myserver Any suggestion on how to get up rabbitmq-server?

    Read the article

  • How do I drag and drop between two listboxes in XUL?

    - by pc1oad1etter
    I am trying to implement drag and drop between two listboxes. I have a few problems 1) I am not detecting any drag events of any kind from the source list box/ I do not seem to be able to drag from it 2) I can drag from my desktop to the target listbox and I am able to detect 'dragenter' 'dragover' and 'dragexit' events. I am noticing that the event parameter is undefined in my 'dragenter' callback - is this a problem? 3) I cannot figure out how to complete the drag and drop operation. From https://developer.mozilla.org/En/DragDrop/Drag_Operations#Performing_... "If the mouse was released over an element that is a valid drop target, that is, one that cancelled the last dragenter or dragover event, then the drop will be successful, and a drop event will fire at the target. Otherwise, the drag operation is cancelled and no drop event is fired." This seems to be referring to a 'drop' event, though there is not one listed at https://developer.mozilla.org/en/XUL/Events . I can't seem to detect the end of the drag in order to call one of the example 'doDrop()' functions that I find on MDC. My example, so far: http://pastebin.mozilla.org/713676 <?xml version="1.0"?> <?xml-stylesheet href="chrome://global/skin/" type="text/css"?> <window xmlns="http://www.mozilla.org/keymaster/gatekeeper/ there.is.only.xul" onload="initialize();"> <vbox> <hbox> <vbox> <description>List1</description> <listbox id="source" draggable="true"> <listitem label="1"/> <listitem label="3"/> <listitem label="4"/> <listitem label="5"/> </listbox> </vbox> <vbox> <description>List2</description> <listbox id="target" ondragenter="onDragEnter();"> <listitem label="2"/> </listbox> </vbox> </hbox> </vbox> <script type="application/x-javascript"> <![CDATA[ function initialize(){ jsdump('adding events'); var origin = document.getElementById("source"); origin.addEventListener("drag", onDrag, false); origin.addEventListener("dragdrop", onDragDrop, false); origin.addEventListener("dragend", onDragEnd, false); origin.addEventListener("dragstart", onDragStart, false); var target = document.getElementById("target"); target.addEventListener("dragenter", onDragEnter, false); target.addEventListener("dragover", onDragOver, false); target.addEventListener("dragexit", onDragExit, false); target.addEventListener("drop", onDrop, false); target.addEventListener("drag", onDrag, false); target.addEventListener("dragdrop", onDragDrop, false); } function onDrag(){ jsdump('onDrag'); } function onDragDrop(){ jsdump('onDragDrop'); } function onDragStart(){ jsdump('onDragStart'); } function onDragEnd(){ jsdump('onDragEnd'); } function onDragEnter(event){ //debugger; if(event){ jsdump('onDragEnter event.preventDefault()'); event.preventDefault(); }else{ jsdump("event undefined in onDragEnter"); } } function onDragExit(){ jsdump('onDragExit'); } function onDragOver(event){ //debugger; if(event){ //jsdump('onDragOver event.preventDefault()'); event.preventDefault(); }else{ jsdump("event undefined in onDragOver"); } } function onDrop(event){ jsdump('onDrop'); var data = event.dataTransfer.getData("text/plain"); event.target.textContent = data; event.preventDefault(); } function jsdump(str) { Components.classes['[email protected]/consoleservice;1'] .getService(Components.interfaces.nsIConsoleService) .logStringMessage(str); } ]]> </script> </window>

    Read the article

  • Multiline code in Word 2007

    - by WaelJ
    I am using word 2007 and am inserting code into the document. I have a style with a fixed-width font and light grey background and all, and I use Notepad++ for syntax highlighting. My problem is with a "line" of code that is too long to display, so is there a way to auto-insert an arrow symbol at the beginning of a such lines to indicate that it is the same line (kind of like hyphenating, except on long lines instead of long words) So for e.g. something like this: public static void foo(String abcdefg, Boolean 123, ?String xyz)

    Read the article

  • Apache Error Upgrading to PHP 5.5

    - by user195385
    I am trying to upgrade php and received this error at the command line: httpd: Syntax error on line 493 of /private/etc/apache2/httpd.conf: Syntax error on line 8 of /private/etc/apache2/other/+php-osx.conf: Cannot load /usr/local/php5/libphp5.so into server: dlopen(/usr/local/php5/libphp5.so, 10): Symbol not found: _libiconv\n Referenced from: /usr/local/php5/lib/libintl.8.dylib\n Expected in: /usr/lib/libiconv.2.dylib\n in /usr/local/php5/lib/libintl.8.dylib I was trying to upgrade at http://php-osx.liip.ch/ using the command: curl -s http://php-osx.liip.ch/install.sh | bash -s 5.5 Any help would be appreciated!

    Read the article

  • Chef Knife-Windows

    - by Nick Zagoreos
    I'm trying to bootstrap a windows 2008 R2 Server with chef and i'm receiving this error :"CScript Error: Execution of the Windows Script Host failed. (0x800A0007)". After some research i find out that i must install the "specific_install" gem and use Knife-windows gem from git but when i'm trying to install gem with this command "gem specific_install -l https://github.com/opscode/knife-windows.git" i'm receiving the following error : "ERROR: While executing gem ... (NoMethodError) undefined method `build' for Gem::Package:Module" What am i doing wrog? Thank you in advance

    Read the article

  • Can't start apache in linux, because of proxy module

    - by Silmaril89
    When I try to start apache or run the command, httpd -M each fail and print the following error: httpd: Syntax error on line 137 of /etc/httpd/conf/httpd.conf: Syntax error on line 2 of /etc/httpd/conf.d/proxy_ajp.conf: Cannot load /etc/httpd/modules/mod_proxy_ajp.so into server: /etc/httpd/modules/mod_proxy_ajp.so: undefined symbol: proxy_module Any ideas on how to fix this? Thanks.

    Read the article

  • Scanstate.exe Migration Error

    - by user1438147
    I'm trying to create a migration store on a server using Scanstate and this is the error I recieve: C:\USMTscanstate.exe \(Server_Name)\migration\mystore /f:migdocs.xml /f: migapp.xml /v:13 /f:scan.log Failed. An error occurred processing the command line. scanstate.exe \svdataitfl1\migration\mystore ##ERROR## -- /f:migdocs.xml /f migapp.xml /v:13 /f:scan.log Undefined or incomplete command line option ScanState return code: 11 I can't seem to find the answer to this...need some help.

    Read the article

  • windows server 2008 r2 remote desktop issue with roaming clients

    - by Patrick D'Haese
    I have the following situation : a Dell windows server 2008 R2 computer, with remote desktop services installed. I have installed a java application making use of a PostgreSql database, and made this application available for clients using RDP. Clients are standard Win XP pc's and Psion Neo handheld devices running Windows CE 5 Pro. The application works fine for clients on standard XP pc's connected directly via cat 5E Ethernet cable to a Dell Powerconnect 2816 switch. The Psion Neo clients connect wireless to the network via Motorola AP6532 access points. These access points are connected via a POE adapter to the same switch as the XP pc's. The Psion devices can connect without any problem and very quickly to the server and to the application using RDP. So far, so good. When the Psion devices move around in the warehouse, and they roam from one access point to the other, the RDP session on the client freezes for approx 1 minute, and then it automatically resumes the session. This freezing is very annoying for the users. Can anyone help in solving this issue? Update (August 9) : After re-installing the access points we have a working situation, but only when connecting to the RDP host : * via a Win Xp SP3 laptop * via a Symbol MC9190 Win CE 6 mobile device When roaming we notice a small hick-up less then 1 second, what is very acceptable. With the Psion NEO it's still not working, when roaming the screen freezes from 2 to 30 seconds. The RDP client on the win xp sp3 laptop and the symbol mc9190 is version 6.0. The RDP client on the neo is version 5.2. I have changed the security layer on the RDP host to RDP security layer (based on forums on the internet), because older RDP clients seem to have issues with the RDP 7.1 protocol on the Win server 2088 R2. Psion adviced us to do some network logging activity on the different devices. We made this logging via wireshark, and based on this the conclusion of Psion is that the server fails in handling tcp-requests. Can anyone give me a second opinion by analysing the wireshark loggings. Thanks in advance. Regards Patrick

    Read the article

  • windows misconfigured keyboard after installing usb keyboard

    - by goliatone
    have a dell vostro 1520, installed an external usb keyboard which works fine but the laptop's keyboard does not work properly. in the log in screen everything works as it should, once logged in the keyboard breaks. keys that have an alternate symbol accessible with the FN key render it by default. Meaning i have to press the FN key for it to render the proper ones- p has the * as FN, in order to get the p i have to press p+FN.

    Read the article

  • Complications registering a punycode domain name

    - by chaz
    Not sure if any of you have experience with this, but I am trying to include the anchor (?) in my domain name (using the appropriate punycode to allow it) but upon registering it I encounter the error that the symbol is not supported by the language I have chosen. Does anyone know what language would support this if I were to continue or even how I would go about doing so or if i can even do so. Thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • image filter that spits out pi

    - by patrickinmpls
    I've seen this before but I forgot what's its called. Does anyone know of software that takes a picture and spits out an image of the number pi, ie. 3.14... not the symbol? It basically kinda looks like ascii art but the numbers are different shades of gray so it is like a black and white photo. Thanks!

    Read the article

< Previous Page | 58 59 60 61 62 63 64 65 66 67 68 69  | Next Page >