Search Results

Search found 34016 results on 1361 pages for 'static content'.

Page 625/1361 | < Previous Page | 621 622 623 624 625 626 627 628 629 630 631 632  | Next Page >

  • UNIX tool to dump a selection of HTML?

    - by jldugger
    I'm looking to monitor changes on websites and my current approach is being defeated by a rotating top banner. Is there a UNIX tool that takes a selection parameter (id attribute or XPath), reads HTML from stdin and prints to stdout the subtree based on the selection? For example, given an html document I want to filter out everything but the subtree of the element with id="content". Basically, I'm looking for the simplest HTML/XML equivalent to grep.

    Read the article

  • How do I use different audio devices for different apps in Windows 8?

    - by Eclipse
    Besides switching the default audio device, how can I send the audio from one app (say x-box music) to one audio device, and another (say the video app) to another audio device? Edit: Looking further, I found this: http://channel9.msdn.com/Events/BUILD/BUILD2011/APP-408T At 16:16, he demonstrates exactly what I'm wanting to do, but when I go to the devices charm, I get a message: "You don't have any devices that can receive content from Music".

    Read the article

  • Blocking specific IP requests

    - by user42908
    Hi, I own a VPS running Ubuntu with Apache stuff. Recently I am getting continous request from IP static-195.22.94.120.addr.tdcsong.se.54303 : 12337 I already installed the 'arno-iptables-firewall'. Have iptables blocking 195.22.94.120 Still then I get the request from that IP if i see via tcpdump. May I know what else i can do to protect my VPS? Thank you.

    Read the article

  • Rename X11 input devices with hotplugging?

    - by buergi
    Is it possible to change the X11 input device identifiers, as they are for example listed by xinput? Preferably without switching to a static xorg.conf configuration, I'm using xorg-server 1.12.4 (archlinux). I need to do that since, as it seems Blender identifies the Pen and Eraser of a graphics tablet using the hardcoded names "stylus" and "eraser" but by default the names of my tablet are prefixed with the type e.g. "Wacom Bamboo 16FG 4x5 Pen stylus".

    Read the article

  • Can't ping Ip over bridge

    - by tmn29a
    I'm unable to ping another host over a bridge I created, I can't see the error -.- It's a remote machine running debian stable with some backports for which I want to set up DHCP on the new Subnet 172.30.xxx.xxx to be used for KVM-Guests. ifconfig : bond0 Link encap:Ethernet HWaddr e4:11:5b:d4:94:30 inet addr:10.54.2.84 Bcast:10.54.2.127 Mask:255.255.255.192 inet6 addr: fe80::e611:5bff:fed4:9430/64 Scope:Link UP BROADCAST RUNNING MASTER MULTICAST MTU:1500 Metric:1 RX packets:34277 errors:0 dropped:0 overruns:0 frame:0 TX packets:18379 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:0 RX bytes:2638709 (2.5 MiB) TX bytes:2887894 (2.7 MiB) br0 Link encap:Ethernet HWaddr f2:fc:4d:7f:15:f0 inet addr:172.30.254.66 Bcast:172.30.254.127 Mask:255.255.255.192 inet6 addr: fe80::f0fc:4dff:fe7f:15f0/64 Scope:Link UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:252 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:0 RX bytes:0 (0.0 B) TX bytes:10800 (10.5 KiB) Pings : ping -I br0 172.30.xxx.65 PING 172.30.xxx.65 (172.30.xxx.65) from 172.30.xxx.66 br0: 56(84) bytes of data. --- 172.30.xxx.65 ping statistics --- 3 packets transmitted, 0 received, 100% packet loss, time 2017ms ping -I bond0 172.30.254.65 PING 172.30.xxx.65 (172.30.xxx.65) from 10.54.2.84 bond0: 56(84) bytes of data. 64 bytes from 172.30.x.65: icmp_req=1 ttl=64 time=0.599 ms 64 bytes from 172.30.x.65: icmp_req=2 ttl=64 time=0.575 ms 64 bytes from 172.30.x.65: icmp_req=3 ttl=64 time=0.565 ms --- 172.30.x.65 ping statistics --- 3 packets transmitted, 3 received, 0% packet loss, time 1999ms rtt min/avg/max/mdev = 0.565/0.579/0.599/0.031 ms Route : Destination Gateway Genmask Flags Metric Ref Use Iface 172.30.x.64 * 255.255.255.192 U 0 0 0 br0 10.54.x.64 * 255.255.255.192 U 0 0 0 bond0 default 10.54.x.65 0.0.0.0 UG 0 0 0 bond0 default 172.30.x.65 0.0.0.0 UG 0 0 0 br0 The Interface : cat /etc/network/interfaces auto lo br0 iface lo inet loopback # Bonding Interface auto bond0 iface bond0 inet static address 10.54.x.84 netmask 255.255.255.192 network 10.54.x.64 gateway 10.54.x.65 slaves eth0 eth1 bond_mode active-backup bond_miimon 100 bond_downdelay 200 bond_updelay 200 iface br0 inet static bridge_ports bond0 address 172.30.x.66 broadcast 172.30.x.127 netmask 255.255.x.192 gateway 172.30.x.65 bridge_maxwait 0 If you need more info please ask. Thanks for your help !

    Read the article

  • Recover not properly burned DVD from camcoder

    - by tomo
    Can anybody suggest me any good and preferably free software - working on Vista / 7 - for recovering content from DVD disks? A few DVD-R VOB files cannot be read from disk by Windows. Probably the camera failed to burn it correctly. What I want to achieve is to skip a few invalid frames in VOB files and recreate proper MPEG stream - without re-encoding whole stream and loosing the quality.

    Read the article

  • How to control DVR connected cameras as IP Cameras

    - by Ajay
    We have analog IR cameras (not IP Cameras) and they are connected to DVR model no is (DVR Model: DVR H264, 16 Channel - ECOR264-16X1). We assigned a static IP to DVR and able to view all the cameras connected to it. Our requirement is to view individual cameras and recording option in remote location (the recorded data should store in remote) as like IP Cameras. Is it possible, if not, are there any DVR Model which can support like this.

    Read the article

  • mysqldump trigger crashed tables

    - by m4rc
    We had a database crash this morning starting at 1 minute past midnight (when the database backup runs). The exception emails I was getting said "Table './core/content' is marked as crashed and should be repaired". My question is basically, can mysqldump cause tables to crash, if so how and why? And are there any tools which can detect a crashed table and run a repair on it? Thanks in advance.

    Read the article

  • How to setup IIS subdomain pointing to folder on remote machine?

    - by zsharp
    Im trying to serve static content through a subdomain. The physical folder is shared on a second machine in the same local domain. How do I safely setup permissions on the shared folder so that when i do something like: src="subdomain.domain.com/Image1.png" I wont get access denied? IN IIS I have subdomain.domain.com as a separate website.

    Read the article

  • How to use rsync when filenames contain double quotes?

    - by wfoolhill
    I am trying to synchronize the content of the directory my_dir/ from /home to /backup. This directory contains a file which name has a double quote in it, such as to"to. Here is my rsync command: rsync -Cazh /home/my_dir/ /backup/my_dir/ And I get the following message: rsync: mkstemp "/backup/my_dir/.to"to.d93PZr" failed: Invalid argument (22) For info, rsync works well when the synchronized filenames contain single quote, parenthesis and space. Thus, why is it bugging with a double quote? Thanks for any help.

    Read the article

  • How to auto advance a PowerPoint slide after an exit animation is over?

    - by joooc
    PowerPoint entrance animation set up with "Start: With Previous" starts right when a new slide is advanced. However, if you set up an exit animation in the same way, it doesn't start with a slide ending sequence. Instead, the "Start: On Click" trigger needs to be used and after your exit animation is over you still need one extra click just to advance to the next slide. Workarounds to this are obvious: create a duplicate slide, make your ending animations from the original slide being your starting animations on the duplicate slide and let them be followed with whatever you want or create a transition slide with those ending animations only and set up "Change Advance slide - Automatically after - [the time it takes your animations to finish]". These workarounds will make it work for your audience, visually. However, it has an impact on slide numbers you might need to adjust accordingly and/or duplicate content changes. If you are the only one creating and using your presentation, this might be just fine. But if you are creating a presentation in collaborative mode with three other people and don't even know who will be the presenter at the end, you can mess things up. Let's be specific: most of my slides have 0.2s fly in entrance animation applied to blocks of content coming from right, bottom or left. Advancing to the next slide I want them to fly out in another 0.2s exit animation being followed by new slide 0.2s fly in entrance animation of the new blocks. The swapping of the blocks should be triggered while advancing to the next slide, as usually. As mentioned, I'm not able to achieve this without one extra click between the slides. I wrote a VBA script that should start together with an exit animation and will auto advance a slide after 0.3s when the exit animation is over. That way I should get rid of those extra clicks which are needed right now. Sub nextslide() iTime = 0.3 Start = Timer While Timer < Start + iTime DoEvents Wend With SlideShowWindows(1).View .GotoSlide (ActivePresentation.SlideShowWindow.View.Slide.SlideIndex + 1) End With End Sub It works well when binded on a box, button or another object. But I can't make it run on a single click (anywhere on the slide) so that it could start together with the exit animation onclick trigger. Creating a big transparent rectangular shape over the whole slide and binding the macro on it doesn't help either. By clicking it you only get the macro running, exit animation is not triggered. Anyway, I don't want to bind the macro to any other workaround object but the slide itself. Anyone knows how to trigger a PowerPoint VBA script on slide onclick event? Anyone knows a secret setting that will make the exit animation work as expected i.e. animating right before exiting a slide while transitioning to the next one? Anyone knows how to beat this dragon? Thank you!

    Read the article

  • How to ensure precedence of files over directories with Apache?

    - by janeden
    My httpd.conf uses the MultiViews option to serve HTML files for URLs like http://server/blog. This works fine, unless there are directories with the same name – Apache will then try to serve the directory. Is there any way to ensure precedence of blog.html over blog/, or rather: can I make Apache process content negotiation according to MultiView although a matching entity (the directory) is present? In nginx, I can do this explicitly: try_files $uri $uri.html $uri/ =404;

    Read the article

  • How can I make my eth0 connection default on startup?

    - by Alex
    I'm running kubuntu 9.10 and every time I log in auto eth0 is used instead of my custom connection called "batnet". I have batnet set to automatically connect, but despite this it is ignored and the default auto eth0 is used instead. This would be fine IF I could somehow figure out how to define a static ip for auto eth0. I would prefer to just make the 'batnet' connection default. How can I do this?

    Read the article

  • How can I read out internal pdf creation/modified date with Windows PowerShell?

    - by Martin
    PDF files seem to have a separate set of file properties which contain (among others) a creation date and a modified date (see screenshot here: http://ventajamarketing.com/writingblog/wp-content/uploads/2012/02/Acrobat-Document-Properties1-300x297.png). Those date obviously can differ from the creation and modified date shown in the file system (Windows Explorer). How can I access the date information in the PDF file and read it out in Windows 7 with Windows PowerShell (or maybe another method)?

    Read the article

  • Safe to disable compile options for Nginx (when used only as reverse proxy/cache)

    - by Alex
    I have read that I can do this to make a smaller footprint Nginx when used as static content cache/reverse proxy: --without-mail_pop3_module --without-mail_imap_module --without-mail_smtp_module What other options are safe to disable? SSI, FastCGI? Others? The only requirements for the reverse proxy is to be able to do https and gzip compression. Will disabling all the module really help with footprint and/or performance?

    Read the article

  • Multiple computers in SBS domain that need a Remote Desktop Connection with a sub domain

    - by Mark
    Hi all, I've been searching the internet for a while for this answer. I have a bunch of computers that are part of a small business server domain and would like to be able to connect to each one individually with remote desktop connection using a subdomain, like: computer1.mydomain.org computer2.mydomain.org etc... I can currently connect to the server easily using an A record with the subdomain pointing to the static IP address with home.mydomain.org, so computer1.home.mydomain.org would also be cool. Thanks!

    Read the article

  • Localhost service accessible from remote address

    - by dynback.com
    I have on my home Windows box - Cassini server with localhost:10000. And I want it be accessible in internet by my static IP. Tried netcat, "nc -l -p 10001 localhost 10000". But it results in "invalid connection to [IP] from [IP] 16074" Also before that it was working on Opera Unite properly, but now only writes a message: "An error occured. See error log for details". I dont know where to get that log.

    Read the article

  • Nginx: bug using if in location, how do I rectify

    - by Quintin Par
    I am using nginx in reverse proxy mode. In my server section I have this code to set expire and cache control of my static files. location ~* ^.+\.(css|js|png|gif)$ { access_log off; expires max; add_header Cache-Control public; if (!-f $request_filename) { proxy_pass http://localhost:82; } } This is quite obviously creating issues. Can someone help me correct this code to use try_files or rewrite?

    Read the article

  • Does hosting multiple sites on one server hurt your SEO?

    - by MarathonStudios
    I have a handful of (content unrelated) sites with decent PRs and I'm considering hosting them all on the same server. I've heard that if you do this, internal linking between two seperate domains on that server may be seen as less "valid" by Google in PageRank terms (since you obviously own both of the sites as they share an IP address). Anyone have any experience in this? I'd love to save some hosting cash by consolidating, but not at the expense of losing the ability to link my sites together powerfully.

    Read the article

  • Facebook, Twitter, Yahoo doesn't work

    - by Toktik
    Some sites doesn't work normally, they are open, without css, images and javascript errors... Facebook stucks on static.ak.fbcdn.net Twitter stucks on a1.twimg.com Yahoo stucks on l.yimg.com On firefox I'm receiving Waiting for ...(any of those). I can access facebook only with SSL. Like https://facebook.com I ping them, only receive request timed out.

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Beginner server local installation

    - by joanjgm
    Here's the thing I own a small business and currently my emails are being managed by some regular hosting using cpanel and that I bought a small server and installed windows server and exchange Can you tell what I did wrong here Installed and configured my current existing domain Configured all email address Installed noip in case my public address change In the cpanel of the domain I've added an MX record to the noip domain of the server with priority 0 so now emails are being received by my own server Now whenever I send an email to anyone gmail hotmail etc I get a response that cannot be delivered since may be junk This didn't happen when I sent emails from the hosting What's missing what did I do wrong heres the code mx.google.com rejected your message to the following e-mail addresses: Joan J. Guerra Makaren ([email protected]) mx.google.com gave this error: [186.88.202.13 12] Our system has detected that this message is likely unsolicited mail. To reduce the amount of spam sent to Gmail, this message has been blocked. Please visit http://support.google.com/mail/bin/answer.py?hl=en&answer=188131 for more information. cn9si815432vcb.71 - gsmtp Your message wasn't delivered due to a permission or security issue. It may have been rejected by a moderator, the address may only accept e-mail from certain senders, or another restriction may be preventing delivery. Diagnostic information for administrators: Generating server: SERVERMEGA.megaconstrucciones.com.ve [email protected] mx.google.com #550-5.7.1 [186.88.202.13 12] Our system has detected that this message is 550-5.7.1 likely unsolicited mail. To reduce the amount of spam sent to Gmail, 550-5.7.1 this message has been blocked. Please visit 550-5.7.1 http://support.google.com/mail/bin/answer.py?hl=en&answer=188131 for 550 5.7.1 more information. cn9si815432vcb.71 - gsmtp ## Original message headers: Received: from SERVERMEGA.megaconstrucciones.com.ve ([fe80::9096:e9c2:405b:6112]) by SERVERMEGA.megaconstrucciones.com.ve ([fe80::9096:e9c2:405b:6112%10]) with mapi; Thu, 29 May 2014 11:32:19 -0430 From: prueba <[email protected]> To: "Joan J. Guerra Makaren" <[email protected]> Subject: Probando correos Thread-Topic: Probando correos Thread-Index: Ac97V1eW4OBFmoqJTRGoD7IPTC2azg== Date: Thu, 29 May 2014 16:04:35 +0000 Message-ID: <[email protected]> Accept-Language: en-US, es-VE Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: Content-Type: multipart/alternative; boundary="_000_000f42494487966276f7b241megaconstruccionescomve_" MIME-Version: 1.0

    Read the article

  • Copying SharePoint DB to a new SharePoint 2010 server

    - by LJe
    Hi - we would like to know what is the best and easy way to configure a new SharePoint 2010 Server, we have backup the existing DB of SharePoint 2007 (up and running). We would like to mirror the same settings and content of our current SharePoint setup to the new server using the SharePoint 2010.

    Read the article

  • nginx url rewrites for php-urls

    - by Tronic
    i have to permament redirect some old urls in nginx. the old urls are old-style php urls including a parameter for loading content. they look like this: http://www.foo.com/index.php?site=foo http://www.foo.com/index.php?site=bar i want to redirect them to other urls like: http://www.foo.com/news http://www.foo.com/gallery any advice on how i can achieve this? my tries failed. thanks in advance!

    Read the article

< Previous Page | 621 622 623 624 625 626 627 628 629 630 631 632  | Next Page >