Search Results

Search found 2199 results on 88 pages for 'printing'.

Page 64/88 | < Previous Page | 60 61 62 63 64 65 66 67 68 69 70 71  | Next Page >

  • Why am I not getting the expected results with fread() in C?

    - by mauvehead
    Here is my code: #include <stdio.h> int main(void) { FILE *fp; unsigned int i; char bytes[512]; fp = fopen("myFile","r"); for(i = 0;i <= 512;i++) { fread(&bytes, sizeof(bytes), 1, fp); printf("bytes[%d]: %x\n", i, bytes[i]); } } Here is the expected output $ hexdump myFile 0000000 aa55 aa55 0060 0000 0a17 0000 b1a5 a2ea 0000010 0000 0000 614c 7563 616e 0000 0000 0000 0000020 0000 0000 0a68 0000 1001 421e 0000 0000 0000030 f6a0 487d ffff ffff 0040 0000 002f 0000 But here is what I see from my program bytes[0]: 55 bytes[1]: 8 bytes[2]: ffffffc8 bytes[3]: ffffffdd bytes[4]: 22 bytes[5]: ffffffc8 bytes[6]: ffffff91 bytes[7]: 63 bytes[8]: ffffff82 My obvious guess is that I'm either addressing something incorrectly and receiving the wrong data back or I am printing it incorrectly and viewing it the wrong way.

    Read the article

  • Add characters to month loop?

    - by JM4
    I currently have a php loop running exactly how I need it with proper validations (in both php and javascript) with one exception, if the month is less than 2 digits, (i.e. 1,2,3,4), I need for a '0' to appear before: 01 - January 02 - February ... 10 - October My code for the loop is currently: <select name="Month"> <option value="">Month</option> <?php for ($i=1; $i<=12; $i++) { echo "<option value='$i'"; if ($fields["Month"] == $i) echo " selected"; echo ">$i</option>"; } ?> </select> any ideas? Also note, this month date is being stored in session, not interested in printing to screen

    Read the article

  • PostScript versus PDF as an output format

    - by Brecht Machiels
    I'm currently writing a typesetting application and I'm using PSG as the backend for producing postscript files. I'm now wondering whether that choice makes sense. It seems the ReportLab Toolkit offers all the features PSG offers, and more. ReportLab outputs PDF however. Advantages PDF offers: transparancy better support for character encodings (Unicode, for example) ability to embed TrueType and even OpenType fonts hyperlinks and bookmarks Is there any reason to use Postscript instead of directly outputting to PDF? While Postscript is a full programming language as opposed to PDF, as a basic output format for documents, that doesn't seem to offer any advantage. I assume a PDF can be readily converted to PostScript for printing? Some useful links: Wikipedia: PDF Adobe: PostScript vs. PDF

    Read the article

  • .NET Excel Interop - Why aren't my Footers displaying in my printed output file?

    - by Ryan
    I'm working with C# and Office 2007's Excel Interop API. I'm opening an Excel file, applying some formatting and then sending it to the printer. I've got a problem, though. The Footer text doesn't appear to be printing. If I check the PageSetup.RightFooter property, I can see the expected Page Number in the Footer. That Page Number doesn't appear anywhere on the printed output sheet. When I print using Excel, though, they appear. Does anyone know why my Footer text is not appearing? Here's my code. Pastebin of my C# code

    Read the article

  • RDLC item width is dynamic and causing extra pages to be generated (image included)?

    - by Paul Mendoza
    I'm trying to format an RDLC report file in Visual Studio 2008 and I am having a formatting issue. I have a list at the bottom that contains a matrix that expands horizontally to the right. That pink box is just to visualize the problem I'm having. When the report is rendered the matrix expands and instead of filling the pink box with the matrix is pushes the space in the pink box to the right resulting in an extra page when printing the reports. One solution would be to shrink the pink box to be the size of the matrix which I've done. But then when the matrix grows the fields at the top of the report get pushed to the right by the same amount as the growth of the matrix. Can someone please let me know what they think the solution would be? Thank you!

    Read the article

  • How to Ignore certain tags and replace texts in PHP

    - by Aakash Chakravarthy
    Hello, I have a variable like $content = "Lorem Ipsum is simply <b>dummy text of the printing</b> and typesetting industry. Lorem Ipsum has been the industry's <i>standard dummy text</i> ever since the 1500s <string>javascriptFunc();</script>" ; when i use str_replace('a', '', $content); all the 'a's get removed. But the 'a's within the <script> tag should not be removed. or is there any way to replace text other than this method Please help .

    Read the article

  • Executing certain code for every method call in C++

    - by Luís Guilherme
    I have a C++ class I want to inspect. So, I would like to all methods print their parameters and the return, just before getting out. The latter looks somewhat easy. If I do return() for everything, a macro #define return(a) cout << (a) << endl; return (a) would do it (might be wrong) if I padronize all returns to parenthesized (or whatever this may be called). If I want to take this out, just comment out the define. However, printing inputs seems more difficult. Is there a way I can do it, using C++ structures or with a workaroud hack?

    Read the article

  • Painting to Form then to Printer

    - by jp2code
    I often find myself needing to create custom reports that do NOT work with Crystal Reports or Report Viewer. Often, I hack a DataTable together and dumping that into a DataGridView control. It is never pretty, and printing is difficult. What I need is a class that I can call using the OnPaint event, but I've never sat down and written all of the Pen and Brush commands until now. Painting to the screen and painting to a printer both use the Graphics object, so I want to build a class that I'd pass in the Graphics object, my window bounds (a Rectangle), and some data (in the form of an instance of my class) that I'd use to paint a form or a sheet of paper. That sounds like a great concept! Surely, someone has done something like this before. Does anyone know of a book, a website tutorial, or video that goes into this? If someone wants to write all that out for me here, more power to you - but I'd think that would be too much work.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How can I change text on a win32 window?

    - by Will
    Looking for hints, tips and search terms for changing the text on a win32 window from C#. More specifically, I'm trying to change the text on the print dialog from "Print" to "OK", as I am using the dialog to create a print ticket and not do any printing. How can I find the dialog's window handle? Once I've got it, how would I go about finding the button in the child windows of the form? Once I've found that, how would I change the text on the button? And how can I do all this before the dialog is shown? There's a similar question here, but it points to a CodeProject article that is waaay more complex than needed and is taking me a bit longer to parse through than I'd like to spend on this. TIA.

    Read the article

  • QT clicked signal dosnt work on QStandardItemModel with tree view

    - by user63898
    Hello i have this code in QT and all i want to to catch the clicked event when some one clicking in one of the treeview rows without success here is my code: (parant is the qMmainwindow) m_model = new QStandardItemModel(0, 5, parent); // then later in the code i have proxyModel = new QSortFilterProxyModel; proxyModel->setDynamicSortFilter(true); setSourceModel(createMailModel(parent)); ui.treeView->setModel(proxyModel); ui.treeView->setSortingEnabled(true); ui.treeView->sortByColumn(4, Qt::DescendingOrder); // and my signal/slot looks like this but its not working //and im not getting eny clicked event fired connect(ui.treeView,SIGNAL(Clicked(const QModelIndex& ) ), this,SLOT( treeViewSelectedRow(const QModelIndex& ) ) ); also how can i debug QT signal/slots so i can see some debug massages printing when something is wrong ?

    Read the article

  • Resizing page format on iReport

    - by pringlesinn
    I've been trying to print a pdf made from iReport in less than a page A4. it's like half A4 page height. I'm using a Line Matrix printer, doesn't matter which one. So, when I try to print 2 files at same file, it should print everything on the right place, but just first file is printed correctly. The second one is based on a A4 page format, and just starts printing after A4 page height is over, skipping a big blank. Where can I set the size of page in iReport? The only thing I could do was setting size of what is shown on screen while I edit the file. I tried my best to explain the situation, any doubts, ask me and I'll try even harder.

    Read the article

  • Most Rails-y way to give different views of the same resource?

    - by Nathan Long
    In Rails, is there a canonical way of giving different views of the same resource? For example, a directory of people, where each person can have multiple photos, phone numbers, email addresses, etc. The people, photos and phone numbers are actually different resources with their own RESTful actions. But when viewing people, one page might shows everyone's name and associated photos; another page is names and associated contact information, formatted for printing. Would it be more "Rails-y" to: Create additional actions on the People controller besides the RESTful ones, like "index_with_contact_info"? Create a different controller and a different group of views? Neither seems quite right to me, but the first seems more likely. Any thoughts?

    Read the article

  • Event trigger print using VC++

    - by santhosh kumar
    I have requirement to print log data continuously whenever an event trigger (Without showing print dialog, using default printer). Event may occur twice a second or minit or hour. Also i don`t bother about printer status. example out of paper, communication problem. Printer should not leave empty page. Example event 1 have 4 lines of data to print. While printing event 2, printer should print continuously instead of fetching next paper. My development environment VC++ and MFC.

    Read the article

  • Java String Replace and null characters

    - by praspa
    Testing out someone elses code (of course it was ...) , I noticed a few JSP pages printing funky non-ascii characters. Taking a dip into the source I found this tidbit. // remove any periods from first name e.g. Mr. John --> Mr John firstName = firstName.trim().replace('.','\0'); Does replacing a character in a String with a null character even work in Java? I know that '\0' will terminate a c-string. Would this be the culprit to the funky characters? Thanks PR

    Read the article

  • T-SQL: How Do I Create A "Private" Function Inside A Stored Procedure

    - by RPM1984
    Okay so im writing a SQL Server 2008 Stored Procedure (maintenance script). In doing so, being a good boy i've done plenty of error handling, checking rowcounts, printing output messages, etc But in doing this, ive found myself writing over and over again something like this: SELECT @RowsAffected = @@ROWCOUNT IF @RowsAffected > 0 BEGIN PRINT CAST(@RowsAffected, NVARCHAR(2)) + 'rows updated.' END Or debug messages like this: PRINT 'User ' + CAST(@UserId AS NVARCHAR(5)) + ' modified successfully' Is there a way i can create a kind of 'subroutine' inside the stored procedure (like a private method) that can accept something as a parameter (doesnt have to though) and do some logic? I want to be able to do something like this: CheckRowCounts Or this: PrintUserUpatedMessage(@UserId) Which would then perform the above logic (check rowcount, print message, etc) And yes obviously i can create a UDF, but then i would need to create/drop it etc as this logic is only required for the life of the execution of this stored procedure. Getting sick and tired of writing the same code over and over again, and changing all the different areas ive used it when i get an error =) Can anyone help?

    Read the article

  • Trying to generate a pdf using Snappy (wkhtmltopdf wrapper)

    - by tirengarfio
    I'm trying to generate a pdf using snappy through this code: $snappy = new SnappyPdf; $snappy->setExecutable('/usr/bin/wkhtmltopdf'); $snappy->save('http://www.google.com', '/tmp/jander.pdf'); In the apache log i find this: Done Loading pages (1/6) [ ] 0% [====== ] 10% [========== ] 18% [============ ] 20% [============= ] 22% [=============== ] 25% [================ ] 28% [================== ] 30% [=================== ] 33% [===================== ] 35% [====================== ] 37% [========================= ] 43% [=========================== ] 46% [============================================================] 100% Counting pages (2/6) [============================================================] Object 1 of 1 Resolving links (4/6) [============================================================] Object 1 of 1 Loading headers and footers (5/6) Printing pages (6/6) [ ] Preparing [============================================================] Page 1 of 1 Done but the pdf is not generated. Any idea? Javier

    Read the article

  • Java NullPointerException when traversing a non-null recordset

    - by Tim
    Hello again - I am running a query on Sybase ASE that produces a ResultSet that I then traverse and write the contents out to a file. Sometimes, this will throw a NullPointerException, stating that the ResultSet is null. However, it will do this after printing out one or two records. Other times, with the same exact input, I will receive no errors. I have been unable to consistently produce this error. The error message is pointing to a line: output.print(rs.getString(1)); It appears to happen when the query takes a little longer to run, for some reason. The recordset returns thus far have been very small (4 to 7 records). Sometimes I'll have to run the app 3 or 4 times, then the errors will just stop, as though the query was getting "warmed up". I've run the query manually and there doesn't appear to be any performance problems. Thanks again!

    Read the article

  • F# Extention Methods on Lists, IEnumberable, etc

    - by flevine100
    I have searched StackOverflow (and other sources) for this answer, but can't seem to find anything. In C#, if I had a widget definition, say: class widget { public string PrettyName() { ... do stuff here } } and I wanted to allow for easy printing of a list of Widgets, I might do this: namespace ExtensionMethods { public static PrintAll( this IEnumerable<Widget> widgets, TextWriter writer ) { foreach(var w in widgets) { writer.WriteLine( w.PrettyName() ) } } } How would I accomplish something similar with a record type and a collection (List or Seq preferrably in F#). I'd love to have a list of Widgest and be able to call a function right on the collection that did something like this. Assume (since it's F#) that the function would not be changing the state of the collection that it's attached to, but returning some new value.

    Read the article

  • Resources for looking up differences in rendering behavior between web-browsers and browser bugs

    - by ICodeForCoffee
    I recently encountered a printing issue in Firefox that eventually turned out to be a problem with the fieldset tag we wrapped the entire page in. (Bugzilla: Bug 471015) All browsers have their own rendering quirks and issues, but it can be very hard to know what's causing different behaviors. Sure, you can Google, but that's often taking a shot in the dark about what you think is causing the problem. It also doesn't stop you from having to sort through multiple complains about the same behavior before you find someone who has the issue your looking for. Are there any websites out there that let you search for rendering behavior issues by browser version, browser function, css tag, or html tag? I've seen this SO Question, Wanted: Resource for documented Cross-Browser differences, but I'd like to find something more detailed that includes browser bugs.

    Read the article

  • Code/Approach Golf: Find row in text file with too many columns

    - by awshepard
    Given a text file that is supposed to contain 10 tab-delimited columns (i.e. 9 tabs), I'd like to find all rows that have more than 10 columns (more than 9 tabs). Each row ends with CR-LF. Assume nothing about the data, field widths, etc, other than the above. Comments regarding approach, and/or working code would be extremely appreciated. Bonus for printing line numbers of offending lines as well. Thanks in advance!

    Read the article

  • AJAX: Statusbar: force update of UpdatePanel while function executes

    - by John Bourke
    Hi Guys, I have a label inside an update panel which I wouldl ike to use as a status bar. Basically the user clicks a button which executes a main fucntion that performs a series of tasks. I'd like to inform the user as to the state of the function as it progresses e.g.: Stage 1: Retrieving data... Stage 2: Calculating values... Stage 3: Printing values... Stage 4: Done! I've tried updating the updatepanel directly from the function but it only updates the panel at the end of function (stage 4) and shows "Done!" (which I understand is how it should work). I've been looking into timers and threads to try and update the panel seperate to the main function but I thought I'd post here incase anyone has any better ideas? Thanks for any help in advance! John bourkeyo is offline Reply With Quote

    Read the article

  • How to get unique numbers using randomint python?

    - by user2519572
    I am creating a 'Euromillions Lottery generator' just for fun and I keep getting the same numbers printing out. How can I make it so that I get random numbers and never get the same number popping up: from random import randint numbers = randint(1,50) stars = randint(1,11) print "Your lucky numbers are: ", numbers, numbers, numbers, numbers, numbers print "Your lucky stars are: " , stars, stars The output is just: >>> Your lucky numbers are: 41 41 41 41 41 >>> Your lucky stars are: 8 8 >>> Good bye! How can I fix this? Regards

    Read the article

  • Print from Chrome without the print dialogs? Using Greasemonkey userscript maybe?

    - by Eric Hanson
    We're developing a browser-based warehouse app that needs to print labels and invoices regularly. We want to be able to print to the local printer without going the the usual browser print dialogs. Is this possible? Possibly using a greasemonkey userscript? We don't want to have to setup a whole CUPS printer network and deal with all that, but warehouse pickers having to click through a print dialog 1000 times a day isn't an option. We're printing PDFs, not sure if that matters. If we could do this another way using HTML5 or something else I'm open to course changes or other ideas here.

    Read the article

  • Opening Large (24 GB) File In C

    - by zacaj
    I'm trying to read in a 24 GB XML file in C, but it won't work. I'm printing out the current position using ftell() as I read it in, but once it gets to a big enough number, it goes back to a small number and starts over, never even getting 20% through the file. I assume this is a problem with the range of the variable that's used to store the position (long), which can go up to about 4,000,000,000 according to http://msdn.microsoft.com/en-us/library/s3f49ktz%28VS.80%29.aspx, while my file is 25,000,000,000 bytes in size. A long long should work, but how would I change what my compiler(Cygwin/mingw32) uses or get it to have fopen64?

    Read the article

< Previous Page | 60 61 62 63 64 65 66 67 68 69 70 71  | Next Page >