Search Results

Search found 30896 results on 1236 pages for 'best buy'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 704/1236 | < Previous Page | 700 701 702 703 704 705 706 707 708 709 710 711  | Next Page >

  • textbox character countdown asp.net

    - by Ugene
    i have many textboxes on a form and all textboxes require to have a character limit / character countdown (50 character left of 150), what is the best way to achieve this and can anyone please provide code to implement. Much Grateful Thanks

    Read the article

  • Php pi help... (Loops)

    - by James Rattray
    Is this iteration the best? (Pi^2)/12 = 1 - 1/4 + 1/9 - 1/16 + 1/25 etc. -For converging faster? If not please answer with the iteration -preferably in the form above (an example) -not a splat of algebra ... I'm doing this to find Pi to 1,000,000,000 places online. http://www.zombiewrath.com/superpi.php or my 10,000 one: http://www.zombiewrath.com/pi.php

    Read the article

  • Java connecting to Http which method to use?

    - by jax
    I have been looking around at different ways to connect to URLs and there seem to be a few. My requirements are to do POST and GET queries on a URL and retrieve the result. I have seen URL class DefaultHttpClient class And there were some others in apache commons which method is best?

    Read the article

  • Compare string with all values in array

    - by Hallik
    I am trying to fumble through python, and learn the best way to do things. I have a string where I am doing a compare with another string to see if there is a match: if paid[j].find(d)>=0: #BLAH BLAH If 'd' were an array, what is the most efficient way to see if the string contained in paid[j] has a match to any value in 'd'?

    Read the article

  • Pass authentication between php and Ruby On Rails application

    - by Li
    Hi, I have a simple Ruby on rails application that I want to integrate with an existing php website. I only want that users who's been authenticated by the php application would have access to my Ruby on Rails application (it should appear to the user as the same website, in the same domain, though it can be a different sub-domain if I chose to) What's the best way to do that? Thanks for the help, Li

    Read the article

  • How to make a function retun after 5 second passes in python?

    - by alwbtc
    I want to write a function which will return after 5 seconds no matter what: def myfunction(): while passed_time < 5_seconds: do1() do2() do3() . . return I mean, this function run for 5 seconds only, after 5 seconds, it should end, and continue with other function: myfunction() otherfunction() ----> This should start 5 seconds after myfunction() is executed. Best Regards

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • A good way to release fixtures

    - by Luke
    Hey, my problem is as follows, I am trying to create code where a set of sporting fixtures are created with dates on. Say I have 8 teams, with 7 rounds of fixtures. I have generated the fixtures, but want to add a date generation on them. So if i had 7 rounds, I would put 28 days and it would make each round 4 days from now, 8 days from now, etc. What would be the best way to go about doing this? Thanks

    Read the article

  • NHibernate (or other worth recommendation ORM), real life example?

    - by migajek
    I'd like to learn database applications in C# and I'm about to select some framework. I heard many recommendations of NHibernate, however I haven't decided yet. Anyway, I'd like to know if there's any real-life example (with sources) of NHibernate in C#, to learn best practices etc.? I know all of them are probably covered in the docs, but working example helps a lot understanding the proper development pattern.

    Read the article

  • Accessing a database using visual c++ and OLEDB

    - by Shadi
    Does anybody have an example of working with database using Visual C++ and OLEDB? What should I include on top of my code? I have searched the internet and most examples are using C# or VB. Examples written by C++ are usually not complete. I really appreciate your help. Best, Shadi.

    Read the article

  • How to store data in a table locally and present it in C#

    - by joslinm
    I want to setup a table that can: Save the data on the user's machine Reference & present the data in the GUI Capable of adding rows dynamically during runtime What's the best way to go about this? DataGridView or TableLayoutPanel or...? I'm having trouble with SQL server CE, as I was going to connect it with the DataGridView, but I'm very new to this kind of work, and wondered if it was even necessary to use SQL.

    Read the article

  • Excel macro to change location of .cub files used by pivot tables? (to allow .xls files that depend

    - by Rory
    I often use Excel with pivot tables based on .cub files for OLAP-type analysis. This is great except when you want to move the xls and you realise internally it's got a non-relative reference to the location of the .cub file. How can we cope with this - ie make it convenient to move around xls files that depend on .cub files? The best answer I could come up with is writing a macro that updates the pivot tables' reference to the .cub file location....so I'll pop that in an answer.

    Read the article

  • iPhone payment portal development

    - by Mike Litt
    A client has asked me about building an iphone app that can take restaurant orders. I have the resources to get this app done, but I had a few questions. *Will this app require a portion of the sale to go to apple (if so how much?) *Whats the best way to integrate a payment portal to this? *Will I have to/should I have someone authorize the payments? Thanks, All feedback is appreciated.

    Read the article

  • Twitter RSS pubDate format

    - by Dave
    In a twitter RSS feed the pubDate is published as Sat, Jun 5, 2010 19:20 Using PHP, whats the best way to convert this into the time lasped since published. For eaxmple, posted 4 minutes ago posted 1 hour ago posted 4 hours ago posted 1 day ago posted 2 days ago posted 1 month ago posted 2 months ago You help much appreciated

    Read the article

  • getting all of the image absolute path in a page?

    - by ryanxu
    I am trying to get the src of all of the images in a page. But some pages use absolute paths and some do not. So I am wondering whats the best way to do this? right now I am using this. $imgsrc_regex = '#<\s*img [^\>]*src\s*=\s*(["\'])(.*?)\1#im'; preg_match_all($imgsrc_regex, $html, $matches);

    Read the article

  • Lookups in Multi-Tenant Database

    - by Huthaifa Afanah
    I am developing a SaaS application and I am looking for the best way to design lookup tables, taking in consideration: The look-up tables will have predefined data shared among all the tenants Each tenant must have the ability to extend the look-up table with his own data e.g adding a car class not defined I am thinking about adding TenantID column to each lookup and add the predefined data with setting that column to some value which represents the "Super Tenant" that belongs to the system itself

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 700 701 702 703 704 705 706 707 708 709 710 711  | Next Page >