Search Results

Search found 14936 results on 598 pages for 'format conversion'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 72/598 | < Previous Page | 68 69 70 71 72 73 74 75 76 77 78 79  | Next Page >

  • Converting Powerpoint to PDF solutions?

    - by OWiz
    I asked a version of this question earlier, but I'm in need of other solutions, so this is a more pointed question. I'm in need of a server-based solution for converting ppt files to pdf files. This solution can either sit on the current web server as a console command-triggered service, it can be integrated into the C# code of the web all, or it can be it's own server. It also can't be based off of Libreoffice or Openoffice, as those two have problems converting SmartArt. I'm currently using Libreoffice. I've tried Powerpoint console commands combined with a PDF driver but I can't get that to work from C#. I've tried a .vbs script, but that briefly opens the powerpoint window.

    Read the article

  • How to suppress the unsolicited footer when converting HTML -> PDF with Acrobat?

    - by gojira
    I often convert & combine (via contextmenu) HTML pages to PDF using Acrobat (not Acrobat Reader). I use Adobe Acrobat Pro 9 Extended, version 9.1.2. The converted PDFs always have the full path of the original file on the bottom of the PDF-page, also they have an additional header line with the document. I need to suppress that. I do not want the unsolicited header and footer in the resulting PDF files as they are a pain to reomve manually, with a certain page count per document it becomes impossible. Is it possible to suppres that and if, how?

    Read the article

  • Batch convert of Word docs with images to HTML

    - by dylpickle
    OK, here is my situation: I made a knowledge base for a company, they have about 500 word documents with screenshots in them explaining procedures and such. I can easily paste the text into the cms wysiwyg editor on the knowledge base but the images need to be uploaded one at a time, then sized and placed in the article. Question: Is there any suggestions for an automatic method to to convert the documents to html with the appropriate image tags and links to the images in them, and export/package the images for ftp upload? I can already convert them to HTML automatically using a batch file and a program, but converting the images to the correct tags with href link, then exporting them for ftp is where i need some help. Might not even be possible, but if anyone has tried to do something like this I would like to here how you approached this.

    Read the article

  • How to import this data set into excel? (column headings on each row delimited by a colon)

    - by Anonymous
    I'm trying to import the following data set into Excel. I've had no luck with the text import wizard. I'd like Excel to make id, name, street, etc the column names and insert each record onto a new row. , id: sdfg:435-345, name: Some Name, type: , street: Address Line 1, Some Place, postalcode: DN2 5FF, city: Cityhere, telephoneNumber: 01234 567890, mobileNumber: 01234 567890, faxNumber: /, url: http://www.website.co.uk, email: [email protected], remark: , geocode: 526.2456;-0.8520, category: some, more, info , id: sdfg:435-345f, name: Some Name, type: , street: Address Line 1, Some Place, postalcode: DN2 5FF, city: Cityhere, telephoneNumber: 01234 567890, mobileNumber: 01234 567890, faxNumber: /, url: http://www.website.co.uk, email: [email protected], remark: , geocode: 526.2456;-0.8520, category: some, more, info Is there any easy way to do this with Excel? I'm struggling to think of a way to convert this to a conventional CSV easily. As far as I can think, I'd have to remove the labels from each line, enclose each line in quotes, then delimit them with commas. Obviously that's made a little more difficult to script though seeing as some fields (address, for instance) contain comma-delimited data. I'm not good with regex at all. What's the best way to tackle this?

    Read the article

  • Batch convert AppleWorks files into PDF within originating folder, delete original file?

    - by Manca Weeks
    Probably AppleScript is the way to go with this - I have found scripts online that do this, but snag on oversize printable area and put files in the same folder - I need files to stay in the folder the source came from. If the script also deleted the original AppleWorks file, that would be even better, but not required. I have tried the last script from this post: https://discussions.apple.com/message/10127260#10127260#10127260 Any suggestions would be much appreciated.

    Read the article

  • ms excel 2010 in windows xp - when open workbook the data is formatted differently than when i saved it

    - by Justin
    I haven't been able to find an answer to this. I have multiple files that I use regularly in excel that now have cell formats of "date". Every single cell in the entire workbook (all sheets) is now formatted as "date". The problem is that I lost my formatting for percents, numbers years, etc and now everything is converted to date (xx/xx/xxxx). I am able to open previously saved versions of a file (prior to me having the problem) and the cells are formatted as I intend them to be (percents, numbers, general, as well as dates). Since this has happened on a couple different files recently, I am wondering how this is happening and how do I prevent it from happening in the future. I cannot cure the problem just by highlighting the entire sheet and converting back to general because I lose all my percents and number formatting. Example (Correct formatting): Month Year Working Days MTD POS Curr Rem May 2012 22 0 1,553,549 June 2012 22 0 1,516,903 June 2011 22 0 1,555,512 June 2010 22 0 1,584,704 Example (Incorrect formatting): Month Year Working Days MTD POS Curr Rem June Tuesday, July 04, 1905 Wednesday, January 04, 1900 Wednesday, January 18, 1900 213,320 July Tuesday, July 04, 1905 Wednesday, January 04, 1900 Monday, January 16, 1900 314,261 July Monday, July 03, 1905 Wednesday, January 04, 1900 Sunday, January 15, 1900 447,759 July Sunday, July 02, 1905 Wednesday, January 04, 1900 Monday, January 16, 1900 321,952 Sorry for the mess. Any suggestions?

    Read the article

  • convert video to images

    - by Liam
    How can I convert a video file to a sequence of images, for example one frame every N seconds. Can mplayer or ffmpeg do this? I have used MPlayer to grab screenshots manually but I would like to automate this for a long video.

    Read the article

  • Is there a good, free way to fix broken/corrupt .wmv files?

    - by chbtn
    I've recovered some files from an hdd that weren't supposed to be deleted in the first place, but they have seeking problems/crash the players. Since they have the right size, I'm thinking it might be a problem of corrupt index/header, so I'm trying to find a way to fix them. It's easy to find examples on how to fix corrupt .avi files with mencoder, but .wmv seems trickier. Also, I realize there might not be a way to fix these files, but I figure I might as well as try. As far as players go, I've tried opening it with vlc/mplayer/windows media player. I can use anything on Windows XP/7 and Ubuntu, as long as it's free. Since the files are 200mb+ and there are quite a few, I don't think trial software would work.

    Read the article

  • Windows Reformatting

    - by Shimz187
    I recently began formatting a hard drive via USB extenal drive when the power went off. When i powered it up again and connected the drive the drives dont show up under my computer. When i go to disk management, i see the drive but now it says unallocated space. The drive was initialy partitioned into 2 drives. I cant see both drives now. Tried running GetDataBack NTFS recovery tool and it only comes up with errors. There seem to be no information on the drive from the data recovery utility. I know the information is there but how do i find it. HELP!!!!

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Convert file from VOC to MP3

    - by Thomas
    I would like to convert a sound file (from a digital voice recorder) with the extension .voc to an .mp3 file or some other common sound files. I am on Windows 7 64 bit. I have tried the program voc2wav but it gives me an error message saying that the program isn't 64 bit. The program has to be free and able to run without installing. (The voice recorder did come with a program that I could install, but I would like to avoid that).

    Read the article

  • creating video from set of images on windows with java language [on hold]

    - by Atif
    I am stuck in making video from set of images, i am using ffmpeg tool on windows platform with java language, for single image it is converting into mp4 but for the set of images it gets failed, i have converted single % to double % with doube quotes but unsuccessful ffmpeg -r 1/5 -i "D:\novoworkspace\MGram\src\biz\novosol\mgram\main\img%%04d.jpg" -c:v libx264 -r 30 -pix_fmt yuv420p D:\novoworkspace\MGram\src\biz\novosol\mgram\main\video.mp4 Above is the exact command i tried from the command line as well from the java language with getRuntime() method. Environment is widows please suggest is it possibe under windows or I have to use some alternative Thanks Atif

    Read the article

  • Flatten Word document

    - by user126389
    I have a document with some precise formatting, created in Word. This doc was converted to PDF for distribution. Now the original is lost, and reconverting to Word using a PDF to word add-on from Microsoft results in many text boxes in the new DOC file. How can I 'flatten' this to remove the text boxes and retain most of the formatting in order to update the contents? Recreating the original formatting would take a long time.

    Read the article

  • How to run a command from anywhere in Mac OS X

    - by pabloruiz55
    I need to use a command for converting my images to pvrtc. It is located in /Developer/Platforms/iPhoneOS.platform/Developer/usr/bin/texturetool. Right now I have to be inside that folder to be able to use the command. How can I set it up so I can run this command from anywhere? Thanks

    Read the article

  • What is the significance of these different width, height and resolution parameters?

    - by ??????? ???????????
    An image with a pixel resolution of 640 x 480 has additional dimension and resolution parameters according to exiftool. I'm unsure what they mean. Why are the X / Y Resolution parameters the same?Should they not reflect the pixel dimensions of the image? What does Exif Image Size mean and how is it different from the pixel dimensions? What is the focal plane? Does it have any relation to the device used to capture this image? $ exiftool evil1.jpg | egrep 'Width|Height|Resolution' X Resolution : 180 Y Resolution : 180 Resolution Unit : inches Exif Image Width : 400 Exif Image Height : 300 Focal Plane X Resolution : 8114.285714 Focal Plane Y Resolution : 8114.285714 Focal Plane Resolution Unit : inches Image Width : 640 Image Height : 480 If needed, the original image can be obtained from: here=http://www.pythonchallenge.com/pc/return/evil1.jpg wget --user=huge --password=file $here

    Read the article

  • ffmpeg - creating DNxHD MFX files with alphas

    - by Hugh
    I'm struggling with something in FFMpeg at the moment... I'm trying to make DNxHD 1080p/24, 36Mb/s MXF files from a sequence of PNG files. My current command-line is: ffmpeg -y -f image2 -i /tmp/temp.%04d.png -s 1920x1080 -r 24 -vcodec dnxhd -f mxf -pix_fmt rgb32 -b 36Mb /tmp/temp.mxf To which ffmpeg gives me the output: Input #0, image2, from '/tmp/temp.%04d.png': Duration: 00:00:01.60, start: 0.000000, bitrate: N/A Stream #0.0: Video: png, rgb32, 1920x1080, 25 tbr, 25 tbn, 25 tbc Output #0, mxf, to '/tmp/temp.mxf': Stream #0.0: Video: dnxhd, yuv422p, 1920x1080, q=2-31, 36000 kb/s, 90k tbn, 24 tbc Stream mapping: Stream #0.0 -> #0.0 [mxf @ 0x1005800]unsupported video frame rate Could not write header for output file #0 (incorrect codec parameters ?) There are a few things in here that concern me: The output stream is insisting on being yuv422p, which doesn't support alpha. 24fps is an unsupported video frame rate? I've tried 23.976 too, and get the same thing. I then tried the same thing, but writing to a quicktime (still DNxHD, though) with: ffmpeg -y -f image2 -i /tmp/temp.%04d.png -s 1920x1080 -r 24 -vcodec dnxhd -f mov -pix_fmt rgb32 -b 36Mb /tmp/temp.mov This gives me the output: Input #0, image2, from '/tmp/1274263259.28098.%04d.png': Duration: 00:00:01.60, start: 0.000000, bitrate: N/A Stream #0.0: Video: png, rgb32, 1920x1080, 25 tbr, 25 tbn, 25 tbc Output #0, mov, to '/tmp/1274263259.28098.mov': Stream #0.0: Video: dnxhd, yuv422p, 1920x1080, q=2-31, 36000 kb/s, 90k tbn, 24 tbc Stream mapping: Stream #0.0 -> #0.0 Press [q] to stop encoding frame= 39 fps= 9 q=1.0 Lsize= 7177kB time=1.62 bitrate=36180.8kbits/s video:7176kB audio:0kB global headers:0kB muxing overhead 0.013636% Which obviously works, to a certain extent, but still has the issue of being yuv422p, and therefore losing the alpha. If I'm going to QuickTime, then I can get what I need using Shake, but my main aim here is to be able to generate .mxf files. Any thoughts? Thanks

    Read the article

  • How to convert a 1 page PDF to a 2 page per sheet PDF?

    - by mokasin
    I would like to print a PDF so that on the front of the first page are the first two pages, on the back the 3rd and 4th and so on. ----------------- ----------------- | | | | | | | | | | | | | 1 | 2 | | 3 | 4 | . . . | | | | | | |_______|_______| |_______|_______| page 1 - front page 1 - front Because my printer using Linux fails to support manual duplex printing I'd thought, maybe I could edit the pdf in a according way. But how?

    Read the article

  • Would SSD drives benefit from a non-default allocation unit size?

    - by davebug
    The default allocation unit size recommended when formatting a drive in our current set-up is 4096 bytes. I understand the basics of the pros and cons of larger and smaller sizes (performance boost vs. space preservation) but it seems the benefits of a solid state drive (seek times massively lower than hard disks) may create a situation where a much smaller allocation size is not detrimental. Were this the case it would at least partially help to overcome the disadvantage of SSD (massively higher prices per GB). Is there a way to determine the 'cost' of smaller allocation sizes specifically related to seek times? Or are there any studies or articles recommending a change from the default based on this newer tech? (Assume the most average scattering of sizes program files, OS files, data, mp3s, text files, etc.)

    Read the article

  • How to train users converting from PC to Mac/Apple at a small non profit?

    - by Everette Mills
    Background: I am part of a team that provides volunteer tech support to a local non profit. We are in the position to obtain a grant to update almost all of our computers (many of them 5 to 7 year old machines running XP), provide laptops for users that need them, etc. We are considering switching our users from PC (WinXP) to Macs. The technical aspects of switching will not be an issue for the team. We are in the process of planning data conversions, machine setup, server changes, etc regardless of whether we switch to Macs or much newer PCs. About 1/4 of the staff uses or has access to a Mac at home, these users already understand the basics of using the equipment. We have another set of (generally younger) users that are technically savvy and while slightly inconvenienced and slowed for a few days should be able to switch over quickly. Finally, several members of the staff are older and have many issues using there computers today. We think in the long run switching to Macs may provide a better user experience, fewer IT headaches, and more effective use of computers. The questions we have is what resources and training (webpages, Books, online training materials or online courses) do you recommend that we provide to users to enable the switchover to happen smoothly. Especially, with a focus on providing different levels of training and support to users with different skill levels. If you have done this in your own organization, what steps were successful, what areas were less successful?

    Read the article

  • How can I reorder parts of a video file

    - by sandeep
    I have download a mkv movie file which gave me 3 files suffixed .001, .002, and .003. When i join them together with different tools like winrar, 7zip, hjsplit, concatenated file shows only last 40 min/1.22 hrs of the total length of the movie. If I play all the (.001, .002, .003) parts with vlc player, I can see that .003 is the first part of the video and .001 is the last part. Can anyone tell me how can join this parts of movie with correct position or how I can convert .003 file into .001 file.

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 68 69 70 71 72 73 74 75 76 77 78 79  | Next Page >