Search Results

Search found 4275 results on 171 pages for 'symbol capture'.

Page 72/171 | < Previous Page | 68 69 70 71 72 73 74 75 76 77 78 79  | Next Page >

• cannot access a site from Mac OSX Lion but can from other machines on network?

  - by house9

  SOLVED: The issue is with the hamachi client, hamachi is hi-jacking all of the 5.0.0.0/8 address block http://en.wikipedia.org/wiki/Hamachi_(software)#Criticism http://b.logme.in/2012/11/07/changes-to-hamachi-on-november-19th/ The fix on Mac LogMeIn Hamachi Preferences Settings Advanced Peer Connections IP protocol mode IPv6 only (default is both) If you can only connect to some of your network over IPv4 this 'fix' will NOT work for you ----- A few weeks ago I started using a service - https://semaphoreapp.com I think they made DNS changes a week ago and ever since I cannot access the site from my Mac OSX Lion (10.7.4) machine (my main development machine) but I can access the site from other machines on my network ipad windows machine MacMini (10.6.8) After some google searching I tried both of these dscacheutil -flushcache sudo killall -HUP mDNSResponder but no go, I've contacted semaphoreapp as well, but nothing so far - also of interest, one of my colleagues has the exact same problem, cannot access via Mac OSX Lion but can via windows machine, we work remotely and are not on the same ISP some additional info Lion (10.7.4) cannot access site host semaphoreapp.com semaphoreapp.com has address 5.9.53.16 ping semaphoreapp.com PING semaphoreapp.com (5.9.53.16): 56 data bytes Request timeout for icmp_seq 0 Request timeout for icmp_seq 1 Request timeout for icmp_seq 2 Request timeout for icmp_seq 3 ping: sendto: No route to host Request timeout for icmp_seq 4 ping: sendto: Host is down Request timeout for icmp_seq 5 ping: sendto: Host is down Request timeout for icmp_seq 6 ping: sendto: Host is down Request timeout for icmp_seq 7 .... traceroute semaphoreapp.com traceroute to semaphoreapp.com (5.9.53.16), 64 hops max, 52 byte packets 1 * * * 2 * * * traceroute: sendto: No route to host 3 traceroute: wrote semaphoreapp.com 52 chars, ret=-1 *traceroute: sendto: Host is down traceroute: wrote semaphoreapp.com 52 chars, ret=-1 .... and MacMini (10.6.8) can access it host semaphoreapp.com semaphoreapp.com has address 5.9.53.16 ping semaphoreapp.com PING semaphoreapp.com (5.9.53.16): 56 data bytes 64 bytes from 5.9.53.16: icmp_seq=0 ttl=44 time=191.458 ms 64 bytes from 5.9.53.16: icmp_seq=1 ttl=44 time=202.923 ms 64 bytes from 5.9.53.16: icmp_seq=2 ttl=44 time=180.746 ms 64 bytes from 5.9.53.16: icmp_seq=3 ttl=44 time=200.616 ms 64 bytes from 5.9.53.16: icmp_seq=4 ttl=44 time=178.818 ms .... traceroute semaphoreapp.com traceroute to semaphoreapp.com (5.9.53.16), 64 hops max, 52 byte packets 1 192.168.0.1 (192.168.0.1) 1.677 ms 1.446 ms 1.445 ms 2 * LOCAL ISP 11.957 ms * 3 etc... 10.704 ms 14.183 ms 9.341 ms 4 etc... 32.641 ms 12.147 ms 10.850 ms 5 etc.... 44.205 ms 54.563 ms 36.243 ms 6 vlan139.car1.seattle1.level3.net (4.53.145.165) 50.136 ms 45.873 ms 30.396 ms 7 ae-32-52.ebr2.seattle1.level3.net (4.69.147.182) 31.926 ms 40.507 ms 49.993 ms 8 ae-2-2.ebr2.denver1.level3.net (4.69.132.54) 78.129 ms 59.674 ms 49.905 ms 9 ae-3-3.ebr1.chicago2.level3.net (4.69.132.62) 99.019 ms 82.008 ms 76.074 ms 10 ae-1-100.ebr2.chicago2.level3.net (4.69.132.114) 96.185 ms 75.658 ms 75.662 ms 11 ae-6-6.ebr2.washington12.level3.net (4.69.148.145) 104.322 ms 105.563 ms 118.480 ms 12 ae-5-5.ebr2.washington1.level3.net (4.69.143.221) 93.646 ms 99.423 ms 96.067 ms 13 ae-41-41.ebr2.paris1.level3.net (4.69.137.49) 177.744 ms ae-44-44.ebr2.paris1.level3.net (4.69.137.61) 199.363 ms 198.405 ms 14 ae-47-47.ebr1.frankfurt1.level3.net (4.69.143.141) 176.876 ms ae-45-45.ebr1.frankfurt1.level3.net (4.69.143.133) 170.994 ms ae-46-46.ebr1.frankfurt1.level3.net (4.69.143.137) 177.308 ms 15 ae-61-61.csw1.frankfurt1.level3.net (4.69.140.2) 176.769 ms ae-91-91.csw4.frankfurt1.level3.net (4.69.140.14) 178.676 ms 173.644 ms 16 ae-2-70.edge7.frankfurt1.level3.net (4.69.154.75) 180.407 ms ae-3-80.edge7.frankfurt1.level3.net (4.69.154.139) 174.861 ms 176.578 ms 17 as33891-net.edge7.frankfurt1.level3.net (195.16.162.94) 175.448 ms 185.658 ms 177.081 ms 18 hos-bb1.juniper4.rz16.hetzner.de (213.239.240.202) 188.700 ms 190.332 ms 188.196 ms 19 hos-tr4.ex3k14.rz16.hetzner.de (213.239.233.98) 199.632 ms hos-tr3.ex3k14.rz16.hetzner.de (213.239.233.66) 185.938 ms hos-tr2.ex3k14.rz16.hetzner.de (213.239.230.34) 182.378 ms 20 * * * 21 * * * 22 * * * any ideas? EDIT: adding tcpdump MacMini (which can connect) while running - ping semaphoreapp.com sudo tcpdump -v -i en0 dst semaphoreapp.com Password: tcpdump: listening on en0, link-type EN10MB (Ethernet), capture size 65535 bytes 17:33:03.337165 IP (tos 0x0, ttl 64, id 20153, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->3129)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 0, length 64 17:33:04.337279 IP (tos 0x0, ttl 64, id 26049, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->1a21)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 1, length 64 17:33:05.337425 IP (tos 0x0, ttl 64, id 47854, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->c4f3)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 2, length 64 17:33:06.337548 IP (tos 0x0, ttl 64, id 24772, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->1f1e)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 3, length 64 17:33:07.337670 IP (tos 0x0, ttl 64, id 8171, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->5ff7)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 4, length 64 17:33:08.337816 IP (tos 0x0, ttl 64, id 35810, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->f3ff)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 5, length 64 17:33:09.337948 IP (tos 0x0, ttl 64, id 31120, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->652)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 6, length 64 ^C 7 packets captured 1047 packets received by filter 0 packets dropped by kernel OSX Lion (cannot connect) while running - ping semaphoreapp.com # wireless ~ $ sudo tcpdump -v -i en1 dst semaphoreapp.com Password: tcpdump: listening on en1, link-type EN10MB (Ethernet), capture size 65535 bytes ^C 0 packets captured 262 packets received by filter 0 packets dropped by kernel and # wired ~ $ sudo tcpdump -v -i en0 dst semaphoreapp.com tcpdump: listening on en0, link-type EN10MB (Ethernet), capture size 65535 bytes ^C 0 packets captured 219 packets received by filter 0 packets dropped by kernel above output after Request timeout for icmp_seq 25 or 30 times from ping. I don't know much about tcpdump, but to me it doesn't seem like the ping requests are leaving my machine?

  Read the article

• Program that does a screen print every 15 minutes and saves it to a file

  - by Gerhard Weiss

  I remember hearing of some software that would take a screen print every 15 minutes and store it in a file. They mentioned it can be used to keep track of the amount of time you spent on a project. I know of SnagIt. http://www.techsmith.com/screen-capture.asp What are some of the other packages out there?

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Complications registering a punycode domain name

  - by chaz

  Not sure if any of you have experience with this, but I am trying to include the anchor (?) in my domain name (using the appropriate punycode to allow it) but upon registering it I encounter the error that the symbol is not supported by the language I have chosen. Does anyone know what language would support this if I were to continue or even how I would go about doing so or if i can even do so. Thanks

  Read the article

• error in qemu monitor wavcapture with virsh

  - by Aniket Awati

  I have VM running on qemu-kvm. I am managing it with libvirt and command line tool virsh. I want to record the audio output of the VM. Here is what I am trying - virsh qemu-monitor-command -hmp VM_NAME wavcapture VM.wav This is the output I am getting : Failed to open wave file `vm.wav' Reason: Permission denied Failed to add wave capture I have tried to create a dummy vm.wav with 777 permissions. But I still get the same error.

  Read the article

• image filter that spits out pi

  - by patrickinmpls

  I've seen this before but I forgot what's its called. Does anyone know of software that takes a picture and spits out an image of the number pi, ie. 3.14... not the symbol? It basically kinda looks like ascii art but the numbers are different shades of gray so it is like a black and white photo. Thanks!

  Read the article

• How to email output of scheduled tasks?

  - by Starfish

  On Unix systems, the scheduled task service will email any output that a scheduled task produces. If no output is produced, no email is sent. How can I do the same thing on Windows Server 2003 or 2008? Is there a way to call a batch file or executable that will run my task, capture the output, and email it only if there is output? If you propose a PowerShell solution, please note that I only have PowerShell 1.0.

  Read the article

• using tcpdump to display XML API requests without headers or ack packets

  - by Carmageddon

  I need assistance, I am trying to use tcpdump in order to capture API requests and responses between two servers, so far I have the following command: tcpdump -iany -tpnAXs0 host xxx.xxx.xxx.xxx and port 6666 My problem is, that the output is still hard to read, because it sends the Headers, and the ack packets. I would like to remove those and only see the XML bodies. I tried to use grep -v, but apparently this is all one request, so it filters the entire thing... Thanks!

  Read the article

• Unreceived SNMP traps

  - by Stephen Murby

  I have 2 CISCO IE3000 and 2 IE3010 switches. They are each configured to send traps to the one host which hosts my NMS [ManageEngine]. The only traps I have enabled on the switches are authentication and linkStatus messages (Up/Down), currently I have my NMS polling with the right community and receiving as ManageEngine checks when adding a managed device, but no linkStatus traps are received. I know they are coming because I have capture them with wireshark, but they are not received by my NMS, any ideas?

  Read the article

• How do I record a screencast with picture-in-picture video of the presenter?

  - by joeforker

  What kind of setup do I need to live stream a presentation with audio and video of the presenter coupled with a screencast of their slides? I would like to use a Linux or Windows machine to do the capture (the slides will always come from a Windows machine) and Red5 to serve the video to Flash.

  Read the article

• Checking rtp stream audio quality.

  - by chills42

  We are working in a test environment and need to monitor the audio quality of an rtp stream that is being captured using tshark. Right now we are able to capture the audio and access the file through wireshark, but we would like to find a way to save the audio to a .wav file (or similar) via the command line. Does anyone know of a tool that can do this?

  Read the article

• Outlook 2007: How to make all appointments "private" by default?

  - by user1413

  In Outlook 2007, I can make an appointment "private" by clicking on Private (little lock symbol) in the Options area. I would like to make all appointments Private by default. Is there any way to do this?

  Read the article

• Windows doesn't get access to internet though linux easily does

  - by flashnik

  We have a very interesting problem. The network is configured in this way: internet is connected to Trendnet switch TS DHCP server at 192.168.0.1 running on Ubuntu (S) is connected to internet switch DNS is also configured on 192.168.0.1 on S D-Link Wi-Fi boosters are connected to switch TS PCs use D-Link PCI-E Wi-Fi cards to get access to network PCs have both Ubuntu and Windows 7 There are about 40 PCs. When PC is booted to Ubuntu it easily gets access to internet. But when it's booted to Windows 7, it gets a valid IP-address, but doesn't get access to internet. The address, mask, DNS, GW-address are totally the same as when it's booted under Ubuntu. The S is reacheble and pingable. Sometimes when we are lucky the PC gets access to Internet, but after rebooting it can lose it. When PC under Windows has access, it has totally the same settings as when it doesn't. What can be done? UPDATE I shared a dropbox with 2 captures of traffic. Ping.pcap is a capture of pinging 8.8.8.8. And google-browser.pcap is a capture of opening a google.com in a browser, both of them are in tcpdump formats and made by Wireshark on Win PC. The MAC of Win PC ends on b7:63 and IP is 192.168.0.130. UPDATE2 This is ifconfig output from Ubuntu Server eth0 Link encap:Ethernet HWaddr 00:1e:67:13:d5:8d inet addr:193.200.211.74 Bcast:193.200.211.78 Mask:255.255.255.0 inet6 addr: fe80::21e:67ff:fe13:d58d/64 Scope:Link UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:196284 errors:0 dropped:44 overruns:0 frame:0 TX packets:190682 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:158032255 (158.0 MB) TX bytes:156441225 (156.4 MB) Interrupt:19 Memory:c1400000-c1420000 eth0:2 Link encap:Ethernet HWaddr 00:1e:67:13:d5:8d inet addr:192.168.0.1 Bcast:192.168.0.254 Mask:255.255.255.0 UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 Interrupt:19 Memory:c1400000-c1420000 eth1 Link encap:Ethernet HWaddr 00:1e:67:13:d5:8c UP BROADCAST MULTICAST MTU:1500 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:0 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:0 (0.0 B) TX bytes:0 (0.0 B) Interrupt:16 Memory:c1300000-c1320000 nslookup from Win results in DNS request timeout, nbtstat in 'not found'.

  Read the article

• Looking for a tagging media library application for Windows

  - by E3 Group

  I'm looking for a program that can: 1) index specific folders and capture video, music and picture files. 2) allow me to assign tags or categories to these files 3) allow me to search by tags or filenames I have a large collection of movies, music, etc that I want to categorise and tag with multiple tags. Haven't yet been able to find any applications that will do this for me.

  Read the article

• How can I do Print-Screen on Windows Mobile Device?

  - by kamleshrao

  I am getting some error messages on my Windows Mobile Device(v6.1). How can I capture the Error Screen-shots on Windows Mobile? I am looking something like Print-Screen option in regular Desktop Windows OS.

  Read the article

• Clicked View Designer on a WinForm. Why was the file auto Checked out from Source Control?

  - by Chadworthington

  When I click "View Designer" to view a Winform in Design mode, VS2010 automatically checks out the file. I realize that there are probably options to silently check out the file without connfirmation, but why is VS thinking that it needs the file checked out in the first place? If I don't check it out, I can't view it. T Screen Capture

  Read the article

• Keep stdout on screen AND in File

  - by user18771

  I open a command prompt window in XP. There I run a command line program (foo.exe) and I want to capture stdout in a file. So I run it like this: foo fooResult.txt However, at the same time I would like stdout to still be fed to the screen of the command prompt window. What is the syntax for that?

  Read the article

• Trouble registering punycode domain!

  - by chaz

  Not sure if any of you have experience with this, but I am trying to include the anchor (?) in my domain name (using the appropriate punycode to allow it) but upon registering it I encounter the error that the symbol is not supported by the language I have chosen. Does anyone know what language would support this if I were to continue or even how I would go about doing so or if i can even do so. Thanks

  Read the article

• Making SnagIt 10 ask for filename while uploading to FTP

  - by Sathya

  I'm trying out SnagIt 10 ( I won it at a giveway, yay me!). Coming to the point: When I choose to capture and send it to FTP, Snagit seems to upload the files with a filename as - plain snagit. Is there any setting which I can change so that Snagit will prompt me for the filename ?

  Read the article

• error while loading shared libraries Dicom Store SCU / Echo SCU

  - by David Just

  I am running a dicom receiver on a Centos 6 box on top of a Xen server. If I attempt to send data to it from a remote server I get the following error: storescp: relocation error: /lib/libresolv.so.2: symbol memcpy, version GLIBC_2.0 not defined in file libc.so.6 with link time reference If I send data to the server locally it works, but sending to it from remote gives the above error. I do not think this is a problem that is specific to the storescp server.

  Read the article

• Windows 7 Virtual PC + Linux Ubuntu

  - by Daniel Henry

  I've installed Ubuntu inside a virtual machine running on Windows 7's Virtual PC. One thing I've noticed right away is that it has to capture the mouse and not all the hardware works as expected. I didn't have such problems in my virtual Windows XP. Is there anything I need to do to either Virtual PC or within Ubuntu that will get them to cooperate as well as Windows XP seems to?

  Read the article

• transform a trapezium into a rectangle

  - by Phuong Nguyen

  I use my iPhone to capture a painting. However, the angle was not perfect, so instead of getting a straight rectangle, I get a trapezium. However, I want to transform this trapezium back into a rectangle (using some affine transformation). However, I cannot find a good way to do it. Please advice.

  Read the article

• using gettext at arm-linux system

  - by savant

  I need to use gettext for web-interface localization. Translation saved in unicode and formatted with msgedit. when I try to execute something like #LC_MESSAGES=ru_RU.utf8 gettext -d domain "Sample text" then i get string like "?????? ????" where "?" is 0x3f symbol. What I forgot to do?

  Read the article

• Alternate Out of Order TCP Packets problem

  - by Sunil

  I am having a network of windows and embedded nodes connected on a series of cisco switch. I have been seeing some serious network problems from few days. Used wireshark to capture the network trace and see every alternate tcp packets being marked as "out of order". Any pointers on how to troubleshoot this problem?

  Read the article

• What would cause my SendMail server not to acknowledge receiving a TCP Sequence?

  - by Mike B

  My TCP/IP Stack knowledge is a little rusty so please bear with me.... I have a CentOS 5.7 server with SendMail and am having seeing intermittent timeout issues sending email (particularly larger email) to other remote domains. It doesn't happen with all attachments or recipient domains. Just some. After some extended troubleshooting, I think I've narrowed it down to TCP Sequences not being acknowledged. Here's a breakdown of the TCP session from a packet capture I collected directly on my MTA (fooMTA): Packet 1 - 11: Standard TCP handshake followed by initial SMTP conversation. No errors. Packet #12 Recipient MTA: TCP sequence 231. Ack 91. Packet #13 FooMTA: TCP sequence 91. Ack 305. Packet #14 FooMTA: TCP sequence 1115. Ack 305. Packet #15 Recipient MTA: TCP sequence 305. Ack 2495. Packet #16 FooMTA: TCP sequence 2495. Ack 305. Packet #17 FooMTA: TCP sequence 5255. Ack 305. Packet #18: Recipient MTA: TCP sequence 305. Ack 5255. Packet #19: FooMTA: TCP sequence 6635. Ack 305. Packet #20: FooMTA: TCP sequence 8015. Ack 305. Packet #21: Recipient MTA: TCP Sequence 305. Ack 8015. Packet #22: FooMTA: TCP Sequence 10775. Ack 305. Packet #23: FooMTA: TCP Sequence 13535. Ack 305. Packet #24: Recipient MTA: TCP sequence 305. Ack 10775 Packet #25: FooMTA: TCP Sequence 14915. Ack 305 It keeps going like this with my server still thinking it hasn’t received sequence 305… in response the remote side eventually retransmits its prior data thinking that it never arrived. Eventually the gap gets so large that no new data is sent and the remote MTA keeps retransmitting old stuff. This contributes to an exponential backoff and eventually the remote side gives up. What’s strange to me is that I see the “missing” TCP sequence (305 in this case) arriving back to my server (via a packet capture collected directly from fooMTA) So I don’t get why my server keeps asking for it. Could this be firewall related? What would be the next step in troubleshooting?

  Read the article

< Previous Page | 68 69 70 71 72 73 74 75 76 77 78 79  | Next Page >