Search Results

Search found 4275 results on 171 pages for 'symbol capture'.

Page 72/171 | < Previous Page | 68 69 70 71 72 73 74 75 76 77 78 79  | Next Page >

  • How to get stack dump from crashing ASP.NET process?

    - by Dylan
    An unhandled exception ('System.Net.Sockets.SocketException') occurred in w3wp.exe [9740]. Just-In-Time debugging this exception failed with the following error: Debugger could not be started because no user is logged on. We're getting the above error in the Application log. Is there a way to capture a .NET stack trace that doesn't require user interactivity?

    Read the article

  • Complications registering a punycode domain name

    - by chaz
    Not sure if any of you have experience with this, but I am trying to include the anchor (?) in my domain name (using the appropriate punycode to allow it) but upon registering it I encounter the error that the symbol is not supported by the language I have chosen. Does anyone know what language would support this if I were to continue or even how I would go about doing so or if i can even do so. Thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • error in qemu monitor wavcapture with virsh

    - by Aniket Awati
    I have VM running on qemu-kvm. I am managing it with libvirt and command line tool virsh. I want to record the audio output of the VM. Here is what I am trying - virsh qemu-monitor-command -hmp VM_NAME wavcapture VM.wav This is the output I am getting : Failed to open wave file `vm.wav' Reason: Permission denied Failed to add wave capture I have tried to create a dummy vm.wav with 777 permissions. But I still get the same error.

    Read the article

  • image filter that spits out pi

    - by patrickinmpls
    I've seen this before but I forgot what's its called. Does anyone know of software that takes a picture and spits out an image of the number pi, ie. 3.14... not the symbol? It basically kinda looks like ascii art but the numbers are different shades of gray so it is like a black and white photo. Thanks!

    Read the article

  • How to email output of scheduled tasks?

    - by Starfish
    On Unix systems, the scheduled task service will email any output that a scheduled task produces. If no output is produced, no email is sent. How can I do the same thing on Windows Server 2003 or 2008? Is there a way to call a batch file or executable that will run my task, capture the output, and email it only if there is output? If you propose a PowerShell solution, please note that I only have PowerShell 1.0.

    Read the article

  • using tcpdump to display XML API requests without headers or ack packets

    - by Carmageddon
    I need assistance, I am trying to use tcpdump in order to capture API requests and responses between two servers, so far I have the following command: tcpdump -iany -tpnAXs0 host xxx.xxx.xxx.xxx and port 6666 My problem is, that the output is still hard to read, because it sends the Headers, and the ack packets. I would like to remove those and only see the XML bodies. I tried to use grep -v, but apparently this is all one request, so it filters the entire thing... Thanks!

    Read the article

  • Unreceived SNMP traps

    - by Stephen Murby
    I have 2 CISCO IE3000 and 2 IE3010 switches. They are each configured to send traps to the one host which hosts my NMS [ManageEngine]. The only traps I have enabled on the switches are authentication and linkStatus messages (Up/Down), currently I have my NMS polling with the right community and receiving as ManageEngine checks when adding a managed device, but no linkStatus traps are received. I know they are coming because I have capture them with wireshark, but they are not received by my NMS, any ideas?

    Read the article

  • Trouble registering punycode domain!

    - by chaz
    Not sure if any of you have experience with this, but I am trying to include the anchor (?) in my domain name (using the appropriate punycode to allow it) but upon registering it I encounter the error that the symbol is not supported by the language I have chosen. Does anyone know what language would support this if I were to continue or even how I would go about doing so or if i can even do so. Thanks

    Read the article

  • Checking rtp stream audio quality.

    - by chills42
    We are working in a test environment and need to monitor the audio quality of an rtp stream that is being captured using tshark. Right now we are able to capture the audio and access the file through wireshark, but we would like to find a way to save the audio to a .wav file (or similar) via the command line. Does anyone know of a tool that can do this?

    Read the article

  • Looking for a tagging media library application for Windows

    - by E3 Group
    I'm looking for a program that can: 1) index specific folders and capture video, music and picture files. 2) allow me to assign tags or categories to these files 3) allow me to search by tags or filenames I have a large collection of movies, music, etc that I want to categorise and tag with multiple tags. Haven't yet been able to find any applications that will do this for me.

    Read the article

  • Keep stdout on screen AND in File

    - by user18771
    I open a command prompt window in XP. There I run a command line program (foo.exe) and I want to capture stdout in a file. So I run it like this: foo fooResult.txt However, at the same time I would like stdout to still be fed to the screen of the command prompt window. What is the syntax for that?

    Read the article

  • Windows doesn't get access to internet though linux easily does

    - by flashnik
    We have a very interesting problem. The network is configured in this way: internet is connected to Trendnet switch TS DHCP server at 192.168.0.1 running on Ubuntu (S) is connected to internet switch DNS is also configured on 192.168.0.1 on S D-Link Wi-Fi boosters are connected to switch TS PCs use D-Link PCI-E Wi-Fi cards to get access to network PCs have both Ubuntu and Windows 7 There are about 40 PCs. When PC is booted to Ubuntu it easily gets access to internet. But when it's booted to Windows 7, it gets a valid IP-address, but doesn't get access to internet. The address, mask, DNS, GW-address are totally the same as when it's booted under Ubuntu. The S is reacheble and pingable. Sometimes when we are lucky the PC gets access to Internet, but after rebooting it can lose it. When PC under Windows has access, it has totally the same settings as when it doesn't. What can be done? UPDATE I shared a dropbox with 2 captures of traffic. Ping.pcap is a capture of pinging 8.8.8.8. And google-browser.pcap is a capture of opening a google.com in a browser, both of them are in tcpdump formats and made by Wireshark on Win PC. The MAC of Win PC ends on b7:63 and IP is 192.168.0.130. UPDATE2 This is ifconfig output from Ubuntu Server eth0 Link encap:Ethernet HWaddr 00:1e:67:13:d5:8d inet addr:193.200.211.74 Bcast:193.200.211.78 Mask:255.255.255.0 inet6 addr: fe80::21e:67ff:fe13:d58d/64 Scope:Link UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:196284 errors:0 dropped:44 overruns:0 frame:0 TX packets:190682 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:158032255 (158.0 MB) TX bytes:156441225 (156.4 MB) Interrupt:19 Memory:c1400000-c1420000 eth0:2 Link encap:Ethernet HWaddr 00:1e:67:13:d5:8d inet addr:192.168.0.1 Bcast:192.168.0.254 Mask:255.255.255.0 UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 Interrupt:19 Memory:c1400000-c1420000 eth1 Link encap:Ethernet HWaddr 00:1e:67:13:d5:8c UP BROADCAST MULTICAST MTU:1500 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:0 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:0 (0.0 B) TX bytes:0 (0.0 B) Interrupt:16 Memory:c1300000-c1320000 nslookup from Win results in DNS request timeout, nbtstat in 'not found'.

    Read the article

  • error while loading shared libraries Dicom Store SCU / Echo SCU

    - by David Just
    I am running a dicom receiver on a Centos 6 box on top of a Xen server. If I attempt to send data to it from a remote server I get the following error: storescp: relocation error: /lib/libresolv.so.2: symbol memcpy, version GLIBC_2.0 not defined in file libc.so.6 with link time reference If I send data to the server locally it works, but sending to it from remote gives the above error. I do not think this is a problem that is specific to the storescp server.

    Read the article

  • transform a trapezium into a rectangle

    - by Phuong Nguyen
    I use my iPhone to capture a painting. However, the angle was not perfect, so instead of getting a straight rectangle, I get a trapezium. However, I want to transform this trapezium back into a rectangle (using some affine transformation). However, I cannot find a good way to do it. Please advice.

    Read the article

  • Windows 7 Virtual PC + Linux Ubuntu

    - by Daniel Henry
    I've installed Ubuntu inside a virtual machine running on Windows 7's Virtual PC. One thing I've noticed right away is that it has to capture the mouse and not all the hardware works as expected. I didn't have such problems in my virtual Windows XP. Is there anything I need to do to either Virtual PC or within Ubuntu that will get them to cooperate as well as Windows XP seems to?

    Read the article

  • redirect get URL?

    - by Wolfr
    I'm almost done writing the .htaccess file to redirect some URLs to a new domain. One final thing: I have URLs with this structure: http://www.domain.be/?s=searchterm How do I capture them? RewriteRule ^\?s=(.*)$ http://newsubdomain.domain.be/?s=$1 [NC,L] Any ideas?

    Read the article

  • using gettext at arm-linux system

    - by savant
    I need to use gettext for web-interface localization. Translation saved in unicode and formatted with msgedit. when I try to execute something like #LC_MESSAGES=ru_RU.utf8 gettext -d domain "Sample text" then i get string like "?????? ????" where "?" is 0x3f symbol. What I forgot to do?

    Read the article

  • Alternate Out of Order TCP Packets problem

    - by Sunil
    I am having a network of windows and embedded nodes connected on a series of cisco switch. I have been seeing some serious network problems from few days. Used wireshark to capture the network trace and see every alternate tcp packets being marked as "out of order". Any pointers on how to troubleshoot this problem?

    Read the article

< Previous Page | 68 69 70 71 72 73 74 75 76 77 78 79  | Next Page >