Search Results

Search found 38690 results on 1548 pages for 'try catch throw'.

Page 72/1548 | < Previous Page | 68 69 70 71 72 73 74 75 76 77 78 79  | Next Page >

  • Customizing / overriding ComboBox (2 replies)

    Hi, I would override a Windows.Forms.Combobox to have a MyObjectCollection instead of a ObjectCollection as Items property. I've try writing this code, but it seems that items are stored somewhere else (not in Items property). I can add items to collection but when I try to select an item from the combobox (at runtime) an exception tells me that there is no such element in Items (litterally it tel...

    Read the article

  • bumblebee does not work with metacity and KWin, but works with compiz

    - by cpu2
    If I try to launch something with optirun under compiz, it works. If I try to launch something with optirun under KDE or metacity, it gives me: [ 247.384077] [ERROR]Cannot access secondary GPU - error: [XORG] (EE) [ 247.384117] [ERROR]Aborting because fallback start is disabled. If it matters, I'm trying to launch Portal 2 with wine I have: Nvidia GeForce GT540M with optimus Acer Aspire Timeline X Intel core i5 and 3000 Integrated Graphics

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to configure dbus to allow ssh-user to suspend server?

    - by Produnis
    I try to suspend my server using dbus and UPower. The server runs Ubuntu LucidLynx 64bit. While everything works fine if I am sitting directly at the machine, it won't work via ssh. If I connect to the server via ssh and try to suspend the machine using dbus and upower, it gives back dbus.exceptions.DBusException: org.freedesktop.UPower.GeneralError: not authorized Could anyone please tell me how to configure dbus in order to allow ssh-users to suspend the machine?

    Read the article

  • permission denied to move files

    - by James
    i want to clear space on my computer in order to download drivers for my internet, so i tried moving files to a different location, unfortunately i dont have permission to do this, how do i change this, i should point out that i am not logged in, i think im a guest or something because if i log in i can not gain access to the internet to download the drivers that i need, so im using the cd and using the try ubunt feature to try achieve downloading the drivers. this is very frustrating for me as im new and have not got a clue how to do this

    Read the article

  • hibernate not picking sessionFactory

    - by Satya
    My application-context.xml is <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE beans PUBLIC "-//SPRING//DTD BEAN//EN" "http://www.springframework.org/dtd/spring-beans.dtd"> <beans> <bean id="myDataSource" class="org.apache.commons.dbcp.BasicDataSource" destroy-method="close"> <property name="driverClassName"><value>com.mysql.jdbc.Driver</value></property> <property name="url"><value>jdbc:mysql://localhost:3306/myDB</value></property> <property name="username"><value>myUser</value></property> <property name="password"><value>myUser</value></property> </bean> <bean id="mySessionFactory" class="org.springframework.orm.hibernate3.LocalSessionFactoryBean"> <property name="mappingResources"> <property name="dataSource"><ref bean="myDataSource"/></property> <list> <value>com/x/model/config/hibernate/user.hbm.xml</value> </list> </property> <property name="hibernateProperties" > <value> hibernate.dialect=org.hibernate.dialect.MySQLDialect </value> </property> </bean> <bean id="userdao" class="com.x.y.z.UserDao"> <property name="sessionFactory"><ref bean="mySessionFactory"/></property> </bean> </beans> user.hbm.xml is <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="com.cpt.model"> <class name="User" table="user"> <id name="userId" column="id"> <generator class="native"/> </id> <property name="firstname" column="firstName" /> <property name="lastName" column="lastName"/> <property name="login" column="login"/> <property name="pass" column="pass"/> <property name="superemail" column="superEmail"/> </class> </hibernate-mapping> and the UserDao is package com.x.y.z; import java.sql.Connection; import java.sql.DriverManager; import java.sql.SQLException; import java.sql.Statement; import org.hibernate.HibernateException; import org.hibernate.Session; import org.hibernate.SessionFactory; import org.hibernate.cfg.Configuration; import org.springframework.beans.factory.annotation.Autowired; import org.springframework.orm.hibernate.support.HibernateDaoSupport; import org.springframework.stereotype.Component; import com.x.model.User; @Component public class UserDao { private SessionFactory sessionFactory; public void addUser(User user) { Session session; try { try { session = getSessionFactory().openSession(); // session = sessionFactory.openSession(); session.save(user); } catch (RuntimeException e) { // TODO Auto-generated catch block e.printStackTrace(); } } catch (HibernateException e) { // TODO Auto-generated catch block System.out.println("printing in the catch"); e.printStackTrace(); } } public SessionFactory getSessionFactory() { System.out.println("returning session factory ::: sessionFactory == null :: "+sessionFactory.openSession()); return sessionFactory; } public void setSessionFactory(SessionFactory sessionFactory) { System.out.println("this is setting session factory" + sessionFactory.getClass()); System.out.println("setting session factory ::: sessionFactory == null :: "+sessionFactory==null); this.sessionFactory = sessionFactory; System.out.println("setting session factory ::: sessionFactory == null :: "+this.sessionFactory.openSession().getClass()); System.out.println(getSessionFactory().openSession().isOpen()); } } However, I keep getting 14:45:09,929 INFO [org.hibernate.impl.SessionFactoryImpl] building session fact ory 14:45:09,933 WARN [net.sf.ehcache.config.Configurator] No configuration found. Configuring ehcache from ehcache-failsafe.xml found in the classpath: vfs:/C:/jb /server/default/deploy/C.war/WEB-INF/lib/ehcache-1.1.jar/ehcache-failsafe.xml 14:45:10,007 INFO [org.hibernate.impl.SessionFactoryObjectFactory] Not binding factory to JNDI, no JNDI name configured 14:45:10,008 INFO [org.hibernate.impl.SessionFactoryImpl] Checking 0 named quer ies 14:45:10,017 INFO [STDOUT] this is setting session factoryclass $Proxy178 14:45:10,017 INFO [STDOUT] false 14:45:10,019 INFO [STDOUT] setting session factory ::: sessionFactory == null : : class org.hibernate.impl.SessionImpl 14:45:10,020 INFO [STDOUT] returning session factory ::: sessionFactory == null :: org.hibernate.impl.SessionImpl(PersistentContext[entitiesByKey={}] ActionQue ue[insertions=[] updates=[] deletions=[] collectionCreations=[] collectionRemova ls=[] collectionUpdates=[]]) It is giving sessionFactory null . Any Idea where am I failing ? Thanks

    Read the article

  • determine if udp socket can be accessed via external client

    - by JohnMerlino
    I don't have access to company firewall server. but supposedly the port 1720 is open on my one ubuntu server. So I want to test it with netcat: sudo nc -ul 1720 The port is listening on the machine ITSELF: sudo netstat -tulpn | grep nc udp 0 0 0.0.0.0:1720 0.0.0.0:* 29477/nc The port is open and in use on the machine ITSELF: lsof -i -n -P | grep 1720 gateway 980 myuser 8u IPv4 187284576 0t0 UDP *:1720 Checked the firewall on current server: sudo ufw allow 1720/udp Skipping adding existing rule Skipping adding existing rule (v6) sudo ufw status verbose | grep 1720 1720/udp ALLOW IN Anywhere 1720/udp ALLOW IN Anywhere (v6) But I try echoing data to it from another computer (I replaced the x's with the real integers): echo "Some data to send" | nc xx.xxx.xx.xxx 1720 But it didn't write anything. So then I try with telnet from the other computer as well: telnet xx.xxx.xx.xxx 1720 Trying xx.xxx.xx.xxx... telnet: connect to address xx.xxx.xx.xxx: Operation timed out telnet: Unable to connect to remote host Although I don't think telnet works with udp sockets. I ran nmap from another computer within the same local network and this is what I got: sudo nmap -v -A -sU -p 1720 xx.xxx.xx.xx Starting Nmap 5.21 ( http://nmap.org ) at 2013-10-31 15:41 EDT NSE: Loaded 36 scripts for scanning. Initiating Ping Scan at 15:41 Scanning xx.xxx.xx.xx [4 ports] Completed Ping Scan at 15:41, 0.10s elapsed (1 total hosts) Initiating Parallel DNS resolution of 1 host. at 15:41 Completed Parallel DNS resolution of 1 host. at 15:41, 0.00s elapsed Initiating UDP Scan at 15:41 Scanning xtremek.com (xx.xxx.xx.xx) [1 port] Completed UDP Scan at 15:41, 0.07s elapsed (1 total ports) Initiating Service scan at 15:41 Initiating OS detection (try #1) against xtremek.com (xx.xxx.xx.xx) Retrying OS detection (try #2) against xtremek.com (xx.xxx.xx.xx) Initiating Traceroute at 15:41 Completed Traceroute at 15:41, 0.01s elapsed NSE: Script scanning xx.xxx.xx.xx. NSE: Script Scanning completed. Nmap scan report for xtremek.com (xx.xxx.xx.xx) Host is up (0.00013s latency). PORT STATE SERVICE VERSION 1720/udp closed unknown Too many fingerprints match this host to give specific OS details Network Distance: 1 hop TRACEROUTE (using port 1720/udp) HOP RTT ADDRESS 1 0.13 ms xtremek.com (xx.xxx.xx.xx) Read data files from: /usr/share/nmap OS and Service detection performed. Please report any incorrect results at http://nmap.org/submit/ . Nmap done: 1 IP address (1 host up) scanned in 2.04 seconds Raw packets sent: 27 (2128B) | Rcvd: 24 (2248B). The only thing I can think of is a firewall or vpn issue. Is there anything else I can check for before requesting that they look at the firewall server again?

    Read the article

  • Can not authenticate to run GParted

    - by alfish
    Whenever I try to run a program from gnome gui, I get message Authenticated is required to run the Gparted Partition Editor The same goes for all programs that need root permission and I try to run from 'System tools' in my gnome-fallback. However the same user can become root in gnome terminal with no problem (I added the user to sudoers). I must mention that I've changed the user's password after OS install, so I think I need to update something but don't know what. I appreciate your hints.

    Read the article

  • Netbeans Java SE GUI Builder: private initComponents() problem

    - by maSnun
    When I build a GUI for my Java SE app with Netbeans GUI builder, it puts all the codes in the initComponents() method which is private. I could not change it to public. So, all the components are accessible only to the class containing the UI. I want to access those components from another class so that I can write custom event handlers and everything. Most importantly I want to separate my GUI code and non-GUI from each other. I can copy paste the GUI code and later make them public by hand to achieve what I want. But thats a pain. I have to handcraft a portion whenever I need to re-design the UI. What I tried to do: I used the variable identifier to make the text box public. Now how can I access the text box from the Main class? I think I need the component generated in a public method as well. I am new to Java. Any helps? Here's the sample classes: The UI (uiFrame.java) /* * To change this template, choose Tools | Templates * and open the template in the editor. */ /* * uiFrame.java * * Created on Jun 3, 2010, 9:33:15 PM */ package barcode; import java.util.logging.Level; import java.util.logging.Logger; import javax.swing.JFileChooser; import javax.swing.UIManager; import javax.swing.UnsupportedLookAndFeelException; import net.sourceforge.barbecue.output.OutputException; /** * * @author masnun */ public class uiFrame extends javax.swing.JFrame { /** Creates new form uiFrame */ public uiFrame() { try { try { // Set cross-platform Java L&F (also called "Metal") UIManager.setLookAndFeel(UIManager.getSystemLookAndFeelClassName()); } catch (ClassNotFoundException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (InstantiationException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (IllegalAccessException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (UnsupportedLookAndFeelException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } } finally { } initComponents(); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { label1 = new javax.swing.JLabel(); textBox = new javax.swing.JTextField(); saveButton = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); label1.setFont(label1.getFont().deriveFont(label1.getFont().getStyle() | java.awt.Font.BOLD, 13)); label1.setText("Type a text:"); label1.setName("label1"); // NOI18N saveButton.setText("Save"); saveButton.addMouseListener(new java.awt.event.MouseAdapter() { public void mousePressed(java.awt.event.MouseEvent evt) { saveButtonMousePressed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(56, 56, 56) .addComponent(textBox, javax.swing.GroupLayout.PREFERRED_SIZE, 272, javax.swing.GroupLayout.PREFERRED_SIZE) .addContainerGap(72, Short.MAX_VALUE)) .addGroup(javax.swing.GroupLayout.Alignment.TRAILING, layout.createSequentialGroup() .addContainerGap(154, Short.MAX_VALUE) .addComponent(saveButton, javax.swing.GroupLayout.PREFERRED_SIZE, 102, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(144, 144, 144)) .addGroup(javax.swing.GroupLayout.Alignment.TRAILING, layout.createSequentialGroup() .addContainerGap(140, Short.MAX_VALUE) .addComponent(label1, javax.swing.GroupLayout.PREFERRED_SIZE, 133, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(127, 127, 127)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(label1, javax.swing.GroupLayout.PREFERRED_SIZE, 25, javax.swing.GroupLayout.PREFERRED_SIZE) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.RELATED) .addComponent(textBox, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.UNRELATED) .addComponent(saveButton) .addContainerGap(193, Short.MAX_VALUE)) ); pack(); }// </editor-fold> @SuppressWarnings("static-access") private void saveButtonMousePressed(java.awt.event.MouseEvent evt) { JFileChooser file = new JFileChooser(); file.showSaveDialog(null); String data = file.getSelectedFile().getAbsolutePath(); String text = textBox.getText(); BarcodeGenerator barcodeFactory = new BarcodeGenerator(); try { barcodeFactory.generateBarcode(text, data); } catch (OutputException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } } /** * @param args the command line arguments */ // Variables declaration - do not modify private javax.swing.JLabel label1; private javax.swing.JButton saveButton; public javax.swing.JTextField textBox; // End of variables declaration } The Main Class (Main.java) package barcode; import javax.swing.JFrame; public class Main { public static void main(String[] args) { JFrame ui = new uiFrame(); ui.pack(); ui.show(); } }

    Read the article

  • ssh: connect to host 192.168.1.7 port 22: Connection refused

    - by Rudra
    I get this error when ever I try to connect my desktop with another desktop using SSH, but I'm able to ping the other desktop successfully. ssh: connect to host 192.168.1.7 port 22: Connection refused When I try to restart sshd, it says sshd : unrecognized service I can connect to remote server using SSH but I'm not able to connect within the local network. Please help me in this regards, Thanks in advance.

    Read the article

  • Can not authenticate form system tools

    - by alfish
    Whenever I try to run a program from gnome, I get messages like Authenticated is required to run the Gparted Partition Editor The same goes for all programs that need root permission and I try to run from 'System tools' in my gnome-fallback. However the same user can become root in gnome terminal with no problem (I added the user to sudoers). I must mention that I've changed the user's password after OS install, so I think I need to update something but don't know what. I appreciate your hints.

    Read the article

  • Brocken package manager due to incorrect Banshee package

    - by user54974
    Sup, so, I'm not familiar with linux at all so help is much appreciated. I've been trying to boot my pc up from a live CD unsuccessfully. I get to the stage at which there are the options to test without installing or install or so on where I select 'Install Ubuntu.' Here it relays through some fast DOS commands until it reaches 'end trace' and then, eventually, 'Killed.' I have already got a functional 11.10 version installed, could this be a problem? The reason I am attempting a reinstall is because the package system is damaged inside 11.10, a problem I can't seem to solve. If I try to install any new software from within the software centre it tells me that two banshee extensions must be removed. I try to remove these from inside the terminal, using apt-get remove, which results in:** You might want to run apt-get -f install to correct these: The following packages have unmet dependencies. banshee-extension-ubuntuonemusicstore : Depends: banshee (>= 2.2.1) but 2.2.0-1ubuntu2 is to be installed E: Unmet dependencies. Try 'apt-get -f install' with no packages (or specify a solution). The software centre suggests that I disable all third party repositories and run apt-get install -f I have done so but the package system remains damaged and apt-get install -fattempts to install banshee 2.2.1 but returns: Errors were encountered while processing: /var/cache/apt/archives/banshee_2.2.1-1ubuntu3_i386.deb E: Sub-process /usr/bin/dpkg returned an error code (1) I have also tried apt-get update (runs fine) and apt-get upgrade. The upgrade command apt-get upgrade results in: Reading package lists... Done Building dependency tree Reading state information... Done You might want to run ‘apt-get -f install’ to correct these. The following packages have unmet dependencies. banshee-extension-soundmenu : Depends: banshee (>= 2.2.1) but 2.2.0-1ubuntu2 is installed banshee-extension-ubuntuonemusicstore : Depends: banshee (>= 2.2.1) but 2.2.0-1ubuntu2 is installed E: Unmet dependencies. Try using -f. I seem to be going round and round in circles here! If only I could reinstall successfully. Only proposed updates (oneiric proposed) is not enabled.

    Read the article

  • NIS client authentication

    - by Tarun Gupta
    How to configure the nis client on ubuntu? and how to configure system authentication? there is no option for system authentication like system setting system info in my system etc. when ever i go to software center and search them nis authentication then i got one package for nis authentication and i try to install them then one error occur that is remove hostname utility. when i try to remove hostname utility then it does not remove.

    Read the article

  • install Ubuntu and remove Windows 7

    - by dani
    I'm using Windows 7 on my laptop (2GB RAM, 250 GB HDD). I want to install Ubuntu and remove Windows 7. I have Partitioned my laptop into 2 partitions: , C Drive - 105 GB and D Drive - 145 GB. I want to install Ubuntu on C drive all my data in D drive, no backup I have already selected the "Try something else option " /dev/sdb /dev/sdb1 ntfs 104855 MB unknown C drive /dev/sdb5 ntfs 145192 MB unknown D drive I need help using the "Try Something Else" Option My course of action: laptop power on bootubuntu nextsomething elsepartition.

    Read the article

  • Deleting Large Number of Records

    Often someone will try to perform a delete on a large number of records and run into a number of problems. Slow performance, log growth, and more. Lynn Pettis shows us how to better handle this situation in SQL Server 2000 and SQL Server 2005 The Future of SQL Server Monitoring "Being web-based, SQL Monitor 2.0 enables you to check on your servers from almost any location" Jonathan Allen.Try SQL Monitor now.

    Read the article

  • Java RMI cannot connect to host from external client.

    - by Koe
    I've been using RMI in this project for a while. I've gotten the client program to connect (amongst other things) to the server when running it over my LAN, however when running it over the internet I'm running into the following exception: java.rmi.ConnectException: Connection refused to host: (private IP of host machine); nested exception is: java.net.ConnectException: Connection timed out: connect at sun.rmi.transport.tcp.TCPEndpoint.newSocket(Unknown Source) at sun.rmi.transport.tcp.TCPChannel.createConnection(Unknown Source) at sun.rmi.transport.tcp.TCPChannel.newConnection(Unknown Source) at sun.rmi.server.UnicastRef.invoke(Unknown Source) at java.rmi.server.RemoteObjectInvocationHandler.invokeRemoteMethod(Unknown Source) at java.rmi.server.RemoteObjectInvocationHandler.invoke(Unknown Source) at $Proxy1.ping(Unknown Source) at client.Launcher$PingLabel.runPing(Launcher.java:366) at client.Launcher$PingLabel.<init>(Launcher.java:353) at client.Launcher.setupContentPane(Launcher.java:112) at client.Launcher.<init>(Launcher.java:99) at client.Launcher.main(Launcher.java:59) Caused by: java.net.ConnectException: Connection timed out: connect at java.net.PlainSocketImpl.socketConnect(Native Method) at java.net.PlainSocketImpl.doConnect(Unknown Source) at java.net.PlainSocketImpl.connectToAddress(Unknown Source) at java.net.PlainSocketImpl.connect(Unknown Source) at java.net.SocksSocketImpl.connect(Unknown Source) at java.net.Socket.connect(Unknown Source) at java.net.Socket.connect(Unknown Source) at java.net.Socket.<init>(Unknown Source) at java.net.Socket.<init>(Unknown Source) at sun.rmi.transport.proxy.RMIDirectSocketFactory.createSocket(Unknown Source) at sun.rmi.transport.proxy.RMIMasterSocketFactory.createSocket(Unknown Source) ... 12 more This error is remeniscent of my early implementation of RMI and I can obtain the error verbatum if I run the client locally without the server program running as well. To me Connection Timed Out means a problem with the server's response. Here's the client initiation: public static void main(String[] args) { try { String host = "<WAN IP>"; Registry registry = LocateRegistry.getRegistry(host, 1099); Login lstub = (Login) registry.lookup("Login Server"); Information istub = (Information) registry.lookup("Game Server"); new Launcher(istub, lstub); } catch (RemoteException e) { System.err.println("Client exception: " + e.toString()); e.printStackTrace(); } catch (NotBoundException e) { System.err.println("Client exception: " + e.toString()); e.printStackTrace(); } } Interestingly enough no Remote Exception is thrown here. Here's the server initiation: public static void main(String args[]) { try { GameServer gobj = new GameServer(); Information gstub = (Information) UnicastRemoteObject.exportObject( gobj, 1099); Registry registry = LocateRegistry.createRegistry(1099); registry.bind("Game Server", gstub); LoginServer lobj = new LoginServer(gobj); Login lstub = (Login) UnicastRemoteObject.exportObject(lobj, 7099); // Bind the remote object's stub in the registry registry.bind("Login Server", lstub); System.out.println("Server ready"); } catch (Exception e) { System.err.println("Server exception: " + e.toString()); e.printStackTrace(); } } Bad practice with the catch(Exception e) I know but bear with me. Up to this stage I know it works fine over the LAN, here's where the exception occurs over the WAN and is the first place a method in the server is called: private class PingLabel extends JLabel { private static final long serialVersionUID = 1L; public PingLabel() { super(""); runPing(); } public void setText(String text) { super.setText("Ping: " + text + "ms"); } public void runPing() { try { PingThread pt = new PingThread(); gameServer.ping(); pt.setRecieved(true); setText("" + pt.getTime()); } catch (RemoteException e) { e.printStackTrace(); } } } That's a label placed on the launcher as a ping test. the method ping(), in gameserver does nothing, as in is a null method. It's worth noting also that ports 1099 and 7099 are forwarded to the server machine (which should be obvious from the stack trace). Can anyone see anyting I'm missing/doing wrong? If you need any more information just ask. EDIT: I'm practically certain the problem has nothing to do with my router settings. When disabling my port forwarding settings I get a slightly different error: Client exception: java.rmi.ConnectException: Connection refused to host: (-WAN IP NOT LOCAL IP-); but it appears both on the machine locally connected to the server and on the remote machine. In addition, I got it to work seamlessly when connecting the server straight tho the modem (cutting out the router. I can only conclude the problem is in my router's settings but can't see where (I've checked and double checked the port forwarding page). That's the only answer i can come up with.

    Read the article

  • Building a Repository Pattern against an EF 5 EDMX Model - Part 1

    - by Juan
    I am part of a year long plus project that is re-writing an existing application for a client.  We have decided to develop the project using Visual Studio 2012 and .NET 4.5.  The project will be using a number of technologies and patterns to include Entity Framework 5, WCF Services, and WPF for the client UI.This is my attempt at documenting some of the successes and failures that I will be coming across in the development of the application.In building the data access layer we have to access a database that has already been designed by a dedicated dba. The dba insists on using Stored Procedures which has made the use of EF a little more difficult.  He will not allow direct table access but we did manage to get him to allow us to use Views.  Since EF 5 does not have good support to do Code First with Stored Procedures, my option was to create a model (EDMX) against the existing database views.   I then had to go select each entity and map the Insert/Update/Delete functions to their respective stored procedure. The next step after I had completed mapping the stored procedures to the entities in the EDMX model was to figure out how to build a generic repository that would work well with Entity Framework 5.  After reading the blog posts below, I adopted much of their code with some changes to allow for the use of Ninject for dependency injection.http://www.tcscblog.com/2012/06/22/entity-framework-generic-repository/ http://www.tugberkugurlu.com/archive/generic-repository-pattern-entity-framework-asp-net-mvc-and-unit-testing-triangle IRepository.cs public interface IRepository : IDisposable where T : class { void Add(T entity); void Update(T entity, int id); T GetById(object key); IQueryable Query(Expression> predicate); IQueryable GetAll(); int SaveChanges(); int SaveChanges(bool validateEntities); } GenericRepository.cs public abstract class GenericRepository : IRepository where T : class { public abstract void Add(T entity); public abstract void Update(T entity, int id); public abstract T GetById(object key); public abstract IQueryable Query(Expression> predicate); public abstract IQueryable GetAll(); public int SaveChanges() { return SaveChanges(true); } public abstract int SaveChanges(bool validateEntities); public abstract void Dispose(); } One of the issues I ran into was trying to do an update. I kept receiving errors so I posted a question on Stack Overflow http://stackoverflow.com/questions/12585664/an-object-with-the-same-key-already-exists-in-the-objectstatemanager-the-object and came up with the following hack. If someone has a better way, please let me know. DbContextRepository.cs public class DbContextRepository : GenericRepository where T : class { protected DbContext Context; protected DbSet DbSet; public DbContextRepository(DbContext context) { if (context == null) throw new ArgumentException("context"); Context = context; DbSet = Context.Set(); } public override void Add(T entity) { if (entity == null) throw new ArgumentException("Cannot add a null entity."); DbSet.Add(entity); } public override void Update(T entity, int id) { if (entity == null) throw new ArgumentException("Cannot update a null entity."); var entry = Context.Entry(entity); if (entry.State == EntityState.Detached) { var attachedEntity = DbSet.Find(id); // Need to have access to key if (attachedEntity != null) { var attachedEntry = Context.Entry(attachedEntity); attachedEntry.CurrentValues.SetValues(entity); } else { entry.State = EntityState.Modified; // This should attach entity } } } public override T GetById(object key) { return DbSet.Find(key); } public override IQueryable Query(Expression> predicate) { return DbSet.Where(predicate); } public override IQueryable GetAll() { return Context.Set(); } public override int SaveChanges(bool validateEntities) { Context.Configuration.ValidateOnSaveEnabled = validateEntities; return Context.SaveChanges(); } #region IDisposable implementation public override void Dispose() { if (Context != null) { Context.Dispose(); GC.SuppressFinalize(this); } } #endregion IDisposable implementation } At this point I am able to start creating individual repositories that are needed and add a Unit of Work.  Stay tuned for the next installment in my path to creating a Repository Pattern against EF5.

    Read the article

  • Starting software projects

    - by shox
    Always , when i try to start new project , with what i think new ideas , first of all i search the web to try to find some thing same, most of the time ( if not all ) , i find that my ideas of new project have been implemented hundred of times , i think every one in software industry , feel this every day , the question is : when should i approve an idea and start building it , although its implemented hundred of times around the world . How i can make my way in trying of build something new

    Read the article

  • Can't install a dependency?

    - by Chibueze Opata
    I've been trying to install 'boot-repair' but it keeps saying: The following packages have unmet dependencies: Depends: boot-sav (= 3.196) but 3.196~ppa3~quantal is to be installed E: Unable to correct problems, you have held broken packages. When I try installing 'boot-sav', everything seems okay, but when I try it again, it just shows the same message over and over again. How can I fix such a problem? Thanks.

    Read the article

  • Can't access windows 7 shared files on Ubuntu 11.10

    - by Corey
    I just set up ubuntu 11.10 and Samba. I got it to access shares on a Vista machine, but when I try to access the shares on a windows 7 machine it asks for a Username, Domain, and Password. I have no password set up on the windows 7 machine so I put in the username, and domain try to connect and the password prompt keeps appearing...also tried guest and admin with no luck...I've tried many different fixes(modifying registry entries & advanced securities on the win 7 machine) with no luck. Thanks

    Read the article

  • Protected Videos not Playing Ubuntu 13.10 (Amazon Prime)

    - by Radeesh Koonichere
    Unable to play amazon prime videos with Chrome/Firefox browser. Tried deleting the Flash folder, re-installed OS. Ubuntu 13.10 Flash Version: flashplugin-installer 11.2.202.310ubuntu1 Youtube works but not Amazon Prime. Try 1 Clear Cache Flash cd ~/.adobe/Flash_Player rm -rf NativeCache AssetCache APSPrivateData2 Try 2 Install Older version of Flash /usr/lib/flashplugin-installer/Flashplayer.so Some other sites have installing HAL and running hald but that was not working either as it seems to be a deprecated. sudo apt-get install hal

    Read the article

  • How can I export emacs documents in 13.04?

    - by Whippy
    When I try to export a document from org-mode in emacs, c-X, c-E now results in 'Can't find library org' whereas in 10.04 it opened the export dialog allowing me to produce html, pdf etc. from the source org file. Searching with Google, I found this bug for redhat which looks closely related. The trouble is I don't know how to get hold of the emacs-el package it talks about in ubuntu in order to try its workaround so I'm currently stuck.

    Read the article

  • Cannot boot from K/Ubuntu install disk on my UEFI system

    - by user93241
    I just got a new system and have been trying to get it set up w/ Win7 & Kubuntu dual-boot, but I've got a major problem. The BIOS of my motherboard (an Asus Crosshair 990FX) is strictly UEFI -- there is no legacy support mode available. I've been reading up on how to get Kubuntu installed in UEFI mode but no matter what I try I cannot seem to even boot into my install CD/USB key properly. I can get as far as the selection screen ("Try Kubuntu", "Install Kubuntu"...) but this screen starts off not appearing correctly. If I try moving the cursor around it sometimes seems to correct itself and show me my choices. But once I select "Try Kubuntu" it starts loading, the screen goes black and then proceeds to flicker -- about once every 5-10 seconds or so. This continues indefinitely. I've tried this with both Kubuntu & Ubuntu installation media, even the AMD64+Mac Ubuntu variety that is supposed to be a lot more flexible w.r.t. UEFI. The only hint I've had that the system might have booted correctly is a little drum sound that plays when booting from the Ubuntu install disk. Well, that and the fact that when I hit my system's power button it seems to shut down correctly, even ejecting the CD at the end. This might be a video driver issue; my system has two nVidia 550's, one of which is attached to my primary monitor. (The secondary isn't hooked up yet.) I'll keep looking over similar questions but any advice would be greatly appreciated. UPDATE: I've tried booting into my 12.04 install CD twice now, each time using two different options supplied by my BIOS. One seemed to offer the ability to boot into my CD under UEFI mode -- this didn't even produce the initial boot menu. The other method offers the ability to boot into my CD NOT under UEFI mode. This DOES produce the boot menu, but after this point it seems I still cannot get to a proper video mode to see what's going on.

    Read the article

  • Why has hibernation stopped working after moving my 12.04 install to a different laptop?

    - by megabytephreak
    I recently got a new laptop (Thinkpad X230). I didn't really have time to do a fresh install so I copied my install (xubuntu 12.04) over from my old machine (Thinkpad X61). Now when I try to hibernate it seems to do the Hibernate step fine, but doesn't seem to try and resume when booting back up. It just does a fresh boot. Is there something I need to do so the system knows where to look for the hibernation data?

    Read the article

  • Using the Same Domain to Bury Bad Publicity

    Receiving bad publicity can be a devastating blow to a brand's online reputation, and in order to mitigate the damage often the best course of action is to try to create enough alternate content to push the negative publicity down to the second, third, or even deeper, search result pages. Most people do this by creating a number of different pages on new or alternate domains, but in fact it can be much more effective to try to create pages on the same domain.

    Read the article

< Previous Page | 68 69 70 71 72 73 74 75 76 77 78 79  | Next Page >