Search Results

Search found 6501 results on 261 pages for 'audio conversion'.

Page 80/261 | < Previous Page | 76 77 78 79 80 81 82 83 84 85 86 87  | Next Page >

  • Sound leaks from speaker even when headphones are inserted

    - by instantsetsuna
    I've a Dell Optiplex 960 (which I presume has a speaker inside the tower). This speaker is normally in use whenever I play music (lets call this "tower speaker"), and when I insert my headphones in the 3.5mm jack (of the tower), the tower speaker stops and the music is played through the headphones (an obvious thing to happen). But sometimes, the tower speaker starts playing the music even when the headphones are inserted! So, the music is played through both of them! This gets quite embarrassing. So, my question is - Is there a way to turn off this "tower speaker"? EDIT : I'm using Windows XP

    Read the article

  • Batch convert AppleWorks files into PDF within originating folder, delete original file?

    - by Manca Weeks
    Probably AppleScript is the way to go with this - I have found scripts online that do this, but snag on oversize printable area and put files in the same folder - I need files to stay in the folder the source came from. If the script also deleted the original AppleWorks file, that would be even better, but not required. I have tried the last script from this post: https://discussions.apple.com/message/10127260#10127260#10127260 Any suggestions would be much appreciated.

    Read the article

  • how to know if a video file can be played on a dvd player

    - by user23950
    Is there an application that can emulate a dvd player? I've converted a .mp4 video using allok video converter. And choose the output format to be xVid(.avi)<--that is exactly what is written on the application. I don't want to waste a blank dvd and try if it really can be played. So if you have tried this before please tell me if it works. And I have tried burning .avi files and it works because they are genuine avi files which I did not convert

    Read the article

  • Make headphone output mono

    - by Jonathan.
    my headphones are stereo but I would like the sound from the left and right to be combined then sent to both headphones. The reason is I'm watching a video where the people speaking are in the right ear as well as the music but they never speak in the left ear (it is not because they on the right side of the screen) If I take the right headphone off then I only hear the music in my left and there is no speaking.

    Read the article

  • How can I transfer metadata from several flac files to aac (m4a) files?

    - by abckookooman
    Suppose I have two folders, dir1 and dir2, with deveral files in each of them, and all the files in dir1 are named like "ExampleFileName.flac" and all the files in dir2 are named as "ExampleFileName.m4a" - basically their names are the same except the extension. What I need to do is transfer all of the metadata for each of the files somehow - even though their codecs are different. It would be great if I can do this via command line, but anything is appreciated. Thank you.

    Read the article

  • Reset sound volume in Windows 8

    - by Svish
    There seems to be a bug in Windows 8 causing the maximum volume to become lower than it really should be. I'm now at a stage where I put the volume up to max and the sound is still very low. I have a couple of Logitech Z-10 speakers with a display on them and when I touch the increase volume button on that it shows me the volume (but not able to increase it) is actually below middle even though Windows claims it to be maxed out. Is there any way I can reset the volume in Windows 8 so that I can get it up fully max again? A registry setting or something? Really don't want to have to reinstall windows or drivers or anything like that cause if it is a bug it'll probably happen again and I really don't want to have to do that every time this happens :p Any ideas? Manged to fix it by unplugging the usb connection to my speakers, turning the volume down on my computer and up on the speakers, and finally reconnecting the usb connection. Seems to have been an issue with the speakers and not Windows this time. BUT, I'm still curious how you can adjust/reset the Windows 8 sound volume without using the volume controls. Like, where is the value of the current volume setting(s) really stored? And can you manually adjust them?

    Read the article

  • Easy way to switch default sound output device

    - by robertpateii
    I want an easier way to change my default sound device from my sound card to my usb headset. Currently it takes a very precise right click, a left click, another right click, and two more left clicks. Ideally i could just have it swap with a shortcut key. (it was a little easier in XP but not by much.) A software solution is preferred, but I am open to suggestions that use hardware. I am running Windows 7 currently.

    Read the article

  • HP Pavilion dv3 volume control display driver on Windows 7

    - by Farinha
    I've recently bought an HP Pavilion dv3-2150ep and I'm having a hard time getting the volume control display to work as expected. The control is a back-lit touch-sensitive bar above the keyboard. Now the buttons to turn the volume up and down actually do it, but the lightning is not changing at all. The mute button does change color when toggled. I'm not sure if I'm missing any drivers here (I've installed all of those on the HP support page that seem to have something to do with sound and/or display) or if I have to activate this somewhere. Any ideas?

    Read the article

  • Is there software to automatically change song speed without transposing it

    - by Peter P
    Goal: automatically adjusting speed (bpm) of a given set of MP3 files in order to have a collection of music optimized to be heard when I am running. (I realized that I prefer to run with about 168 bpm in my ears). Of course, I could have some software to detect BPM and then calculate and stretch/squeeze each song using Audacity or a similar tool, however, I'd prefer a solution which requires less manual operation.

    Read the article

  • Sound feels to come from far in my headphones [closed]

    - by Rakesh
    I bought new headphones just yesterday. The strange thing is when I hear sound from my headphone I feel like it is coming from far away. Main problem comes in games, when I hear the footsteps of enemies and think he is on the other side of the wall while he is near to me. :D I also heard virtual haircut on youtube . I tried this with my new headphones and HTC desire S earphones. In case of HTC earphones I felt that scissors and electric razor( @ 3:04 ) is too much near to my ear but in case of the headphones I didn't felt such thing. I felt electric razor is almost 6 inches away from my ear. Have you ever encountered such problem? What can I do in this case?

    Read the article

  • PowerISO for Mac can't convert .img

    - by None
    I have a bootable .img file that I want to convert to a bootable .iso file. I downloaded poweriso for Mac and used this command: poweriso convert MyOS.img -o MyOS.iso -ot iso which returned this output: PowerISO Copyright(C) 2004-2008 PowerISO Computing, Inc Type poweriso -? for help MyOS.img: The file format is invalid or unsupported. I thought PowerISO could convert .img to .iso. Was I incorrect, or did I use the wrong commands or something like that?

    Read the article

  • convert video to images

    - by Liam
    How can I convert a video file to a sequence of images, for example one frame every N seconds. Can mplayer or ffmpeg do this? I have used MPlayer to grab screenshots manually but I would like to automate this for a long video.

    Read the article

  • Is there a good, free way to fix broken/corrupt .wmv files?

    - by chbtn
    I've recovered some files from an hdd that weren't supposed to be deleted in the first place, but they have seeking problems/crash the players. Since they have the right size, I'm thinking it might be a problem of corrupt index/header, so I'm trying to find a way to fix them. It's easy to find examples on how to fix corrupt .avi files with mencoder, but .wmv seems trickier. Also, I realize there might not be a way to fix these files, but I figure I might as well as try. As far as players go, I've tried opening it with vlc/mplayer/windows media player. I can use anything on Windows XP/7 and Ubuntu, as long as it's free. Since the files are 200mb+ and there are quite a few, I don't think trial software would work.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • creating video from set of images on windows with java language [on hold]

    - by Atif
    I am stuck in making video from set of images, i am using ffmpeg tool on windows platform with java language, for single image it is converting into mp4 but for the set of images it gets failed, i have converted single % to double % with doube quotes but unsuccessful ffmpeg -r 1/5 -i "D:\novoworkspace\MGram\src\biz\novosol\mgram\main\img%%04d.jpg" -c:v libx264 -r 30 -pix_fmt yuv420p D:\novoworkspace\MGram\src\biz\novosol\mgram\main\video.mp4 Above is the exact command i tried from the command line as well from the java language with getRuntime() method. Environment is widows please suggest is it possibe under windows or I have to use some alternative Thanks Atif

    Read the article

  • Importer or converter for ClarisWorks cwk format?

    - by Justin Dearing
    I have several ClarisWorks documents (*.CWK) that I'd like to import into a more modern format like Microsoft Word or Open Office. It seems Star Office can apparently open cwk files, but the product is discontinued and cannot be downloaded any more. There has been a feature request to add a cwk importer to OpenOffice since 2002, so I doubt that OpenOffice will support cwk files any time soon. Are there any utilities that can open a cwk file besides ClarisWorks itself?

    Read the article

  • PDF - re/generate image using stream content

    - by tom_tap
    I have pdf file with 8 content streams (bytes) which behave like image layers (but they are not layers that I can turn off/on in Adobe Reader). I would like to extract these images separately, because they overlap each other (thus I am not able to "Take a Snapshot" or "Copy File to Clipboard"). So now I have these streams in below format: <Start Stream> q 599.7601 0 0 71.99921 5951.03423 4282.48177 cm /Im0 Do Q q 599.7601 0 0 71.99921 5951.03432 4210.48177 cm /Im1 Do Q q 599.7601 0 0 71.99921 5951.03441 4138.48177 cm /Im2 Do [...] My question is: how to use these data to generate or regenerate these images to be able to save it as raster or vector file? I have already tried pstoedit, but it doesn't work properly beacuse of these multi streams. Same with PDFedit.

    Read the article

  • Truecrypt and hidden volumes

    - by user51166
    I would like to know the opinion of some users using (or not) the hidden volume encryption feature of Truecrypt. Personally until now I never used this feature: on Windows I encrypt the system drive as a standard volume, on GNU/Linux I encrypt using LUKS which is Truecrypt's equivalent to standard volume. As for data I use the standard volume approach as well. I read that this feature is nice and all, but it isn't really used by most people. Do you use it or not? Why? Do you only store inside it VERY sensible data or what else? Because technically speaking doing a hidden volume which has (almost) the same size as the outer one doesn't make sense: the outer volume will be encrypted but no data will be on it, which will appear very strange. So not only one has to plan which data store where, but has even to remember each time to mount the outer volume with hidden volume protection (otherwise there'll be a data loss when writing to it). It's a bit messy: hidden OS + outer OS + outer volume + hidden volume = 4 partitions :( Similar question about the hidden operating system (which I don't use [yet]).

    Read the article

  • Flatten Word document

    - by user126389
    I have a document with some precise formatting, created in Word. This doc was converted to PDF for distribution. Now the original is lost, and reconverting to Word using a PDF to word add-on from Microsoft results in many text boxes in the new DOC file. How can I 'flatten' this to remove the text boxes and retain most of the formatting in order to update the contents? Recreating the original formatting would take a long time.

    Read the article

  • Convert file from VOC to MP3

    - by Thomas
    I would like to convert a sound file (from a digital voice recorder) with the extension .voc to an .mp3 file or some other common sound files. I am on Windows 7 64 bit. I have tried the program voc2wav but it gives me an error message saying that the program isn't 64 bit. The program has to be free and able to run without installing. (The voice recorder did come with a program that I could install, but I would like to avoid that).

    Read the article

  • How to run a command from anywhere in Mac OS X

    - by pabloruiz55
    I need to use a command for converting my images to pvrtc. It is located in /Developer/Platforms/iPhoneOS.platform/Developer/usr/bin/texturetool. Right now I have to be inside that folder to be able to use the command. How can I set it up so I can run this command from anywhere? Thanks

    Read the article

  • How to convert a power point pdf to a pdf that is easy to read on kindle?

    - by SpaceTrucker
    I have several power point presentations as pdfs. I would like to read them on the original kindle in landscape format. When I read the original on the kindle then a single slide won't fit on the kindles display. I thought the easiest way to convert the pdf was to repring it with a pdf printer. However I don't know the paper size to use. I already tried using Calibre as suggested by this question. However the output is not usable because of formatting issues. So what paper size should I use for the pdf printer to reprint them in landscape format or are there any other tools I could use for that task?

    Read the article

  • Sennheiser PC360 Microphone Suddenly Stopped Working

    - by Michaelwm
    Just recently, my Sennheiser PC360's microphone stopped working. Yesterday Night, it was working 100% fine. Muting correctly, un-muting, volume boosting, etc. I woke up this morning, and got into a skype call (After not changing a single setting on my computer), and it wasn't working. I tried mumble, and it didn't work there either. After that, I checked my sound devices and found out it was plugged in, but not responding to my voice. I unplugged the headset, and it correctly showed that it was unplugged. So, a quick run-down: Sennheiser PC360 Headset suddenly stops working after a few hours of sleep. Software is up to date I can hear the mute sound when I raise and lower the microphone arm Windows Sound Device Manager shows that it is plugged in Unplugging the headset correctly shows it is unplugged Windows Sound Device Manager shows that the microphone isn't receiving any input

    Read the article

< Previous Page | 76 77 78 79 80 81 82 83 84 85 86 87  | Next Page >