Search Results

Search found 51778 results on 2072 pages for 'super columns'.

Page 80/2072 | < Previous Page | 76 77 78 79 80 81 82 83 84 85 86 87  | Next Page >

  • Dns works, can ping, but cannot load web pages in browser

    - by user1224595
    Yesterday I changed routers, and my desktop computer started acting up. I could ping websites, and nslookup was able to resolve names to addresses, but neither chrome, firefox, nor ie could load any webpages. None of my other computers connected to the same wireless router have any problems. I connect my desktop to the router through a cheap wifi dongle. I did a wireshark capture of the browser request, and I have uploaded the pcap here. https://drive.google.com/file/d/0B7AsPdhWc-SwbTV0bUJLQXo4UUE/edit?usp=sharing One strange thing I noticed was the spamming of ssdp packets. I am not super familiar with networking, but it seems that it is not a problem with the router, as dns works, and so does dhcp (the desktop is assigned an address correctly). Any help would be appreciated.

    Read the article

  • Excel: How do I copy hyperlink address from one column of text to another column with different text?

    - by OfficeLackey
    I have a spreadsheet where column A displays names in a certain format. There are 200-odd names and each has a different hyperlink (which links to that person's web page). I want to reformat the name order so it is "Surname, Name" rather than "Name Surname" and retain the hyperlink in the newly formatted column. I have achieved "Surname, Name" easily by splitting the names into two columns (using LEFT and RIGHT formulae) - forename and surname - then I have a new column with a formula to return "Surname, Name." However, the hyperlinks are not in that new column and I need them. I don't want to do this manually, for obvious reasons. I cannot find a way of copying just hyperlinks from column A without copying the text from column A. So, effectively, what I need is some sort of macro to take, for example, the hyperlink from A2 and copy it to H2, with H2 still retaining the updated ordering of name. I don't have the knowledge to write this myself, so would appreciate solutions.

    Read the article

  • How can I make my browser(s) finish AJAX requests instead of stopping them when I switch to another page?

    - by Tom Wijsman
    I usually need to deal with things on a page right before switching to yet another page, this ranges from "liking / upvoting a comment or post" up to "an important action" and doesn't always come with feedback on whether the action actually proceeded. This is a huge problem! I assume the action to proceed once I start the particular AJAX request, but because I switch to another page it didn't actually happen because the AJAX request got aborted. This has left me several times with coming back to the page and seeing my action didn't take place at all; to give you an idea how bad this is, this even happened once when commenting on Super User! Is there a way to tell my browser to not drop these AJAX connections but simply let them finish?

    Read the article

  • How can I combine 30,000 images into a timelapse movie?

    - by Swift
    I have taken 30,000 still images that I want to combine into a timelapse movie. I have tried QuickTime Pro, TimeLapse 3, and Windows Movie Maker, but with such a huge amount of images, each of the programs fail (I tried SUPER ©, but couldn't get it to work either...?). It seems that all of these programs crash after a few thousand pictures. The images I have are all in .JPG format, at a resolution of 1280x800, and I'm looking for a program that can put these images into a timelapse movie in some kind of lossless format (raw/uncompressed AVI would be fine) for further editing. Does anyone have any ideas, or has anyone tried anything like this with a similar number of pictures?

    Read the article

  • Ranking tables from Excel data

    - by Joe
    Hi all (asking here because this meta question told me to). I have some data in an excel spreadsheet here. It's no more than a table with about five columns. Year Purchased Manufacturer Model Num Unit Price Total Price 2007 SMARTBOX FuturePad XP 1 £2,915.00 £2,915.00 2007 Attainment Company Inc Go Talk 9+ 1 £104.00 £104.00 2007 Attainment Company Inc Go Talk 20+ 1 £114.00 £114.00 I'd like to be able to build a 'top ten' of either manufacturers or models (and I'd like to be able to do it by either most mentioned, most sales, or highest value of sales) - but I've got no idea what the best method is in excel. Any suggestions...? The ideal output might be a set of sells that says something like Company Units A 5342 B 232 C 2 D 1

    Read the article

  • Wireless Connection unstable with multiple devices connected

    - by KingIsulgard
    My wireless network works perfectly when only 1 device is connected. Super fast, full strength. But as soon as multiple devices are connected to the wireless network the connections become unstable (constantly losing connection with the internet, not the network itself). It's quite annoying. I have a Sitecom Wireless 300N XR Gigabit Router WL-306, which should be a decent router so I'm guessing there must be something wrong with my configuration. Does any of you know what might cause this? Thanks

    Read the article

  • Comparing two strings in excel, add value for common variables

    - by overtime
    I'm comparing two large datasets containing strings in excel. Column A contains the numbers 1-1,000,000. Column B contains 1,000,000 strings, neatly organized in the desired order. Column C contains 100,000 randomly organized strings, that have identical values somewhere in column B. Example: A B C D 1 String1 String642 2 String2 String11 3 String3 String8000 4 String4 String78 What I'd like to do is find duplicate values in columns B and C then output the Column A value that corresponds with the string in Column C into Column D. Desired Output: A B C D 1 String1 String642 642 2 String2 String11 11 3 String3 String8000 8000 4 String4 String78 78

    Read the article

  • Are there any Spreadsheet apps that are as easy and powerful to use as Vim?

    - by ovatsug25
    I'd like to use a spreadsheet that lets me move around cells like I do in Vim. As well, the more commands that are attributed to keyboard shortcuts, the better. Particularly stuff like making Text-to-Columns which is one of my more frequently used features in Excel. I don't mind learning the shortcuts if they allow me to just look at the spreadsheet page and forget about everything else. edit: The way I am thinking about the Spreadsheet right now is as if every cell is its own unique file. There should be a command where I choose to open that file and edit it right on the spot within the view of the spreadsheet. So I guess I want different modes like in vim which have commands and there should be one mode that is hooked up just to do operations or formatting which would be similar to command mode in Vim.

    Read the article

  • How can I combine 30,000 images into a timelapse movie?

    - by Swift
    I have taken 30,000 still images that I want to combine into a timelapse movie. I have tried QuickTime Pro, TimeLapse 3, and Windows Movie Maker, but with such a huge amount of images, each of the programs fail (I tried SUPER ©, but couldn't get it to work either...?). It seems that all of these programs crash after a few thousand pictures. The images I have are all in .JPG format, at a resolution of 1280x800, and I'm looking for a program that can put these images into a timelapse movie in some kind of lossless format (raw/uncompressed AVI would be fine) for further editing. Does anyone have any ideas, or has anyone tried anything like this with a similar number of pictures?

    Read the article

  • How to download a URL as a file?

    - by Michelle
    A website URL has "hidden" some MP3 files by embedding them as Shockwave files, as follows. <span class="caption"><!-- Odeo player --><embed src="http://odeo.com/flash/audio_player_tiny_gray.swf"quality="high" name="audio_player_tiny_gray" align="middle" allowScriptAccess="always" wmode="transparent" type="application/x-shockwave-flash" flashvars="valid_sample_rate=true external_url=http://podcast.cbc.ca/mp3/sundayeditionstream_20081125_9524.mp3" pluginspage="http://www.macromedia.com/go/getflashplayer"></embed></span> How can I download the files for off-line listening? I've found two methods: 1. The Stack Overflow Method Create a new local HTML file with just the links, for example: <a href="http://podcast.cbc.ca/mp3/sundayeditionstream_20081125_9524.mp3">Sunday Edition 25Nov2008</a> Open the file in the browser, right click the link and File Save Link As. 2. The Super User Method Install the Firefox addin Iget. (Be sure to use the right version for your Firefox version.) Tools Downloads Enter URL in the field. Are there any other ways?

    Read the article

  • Unique string values in range

    - by Dean Smith
    I have some spreadsheets where there are large number of cells that have essentially been used for free text. There is a finite set of values for this free text and most, if not all repeat. eg. A B C D 1 Monkey Gorilla Cat Dog 2 Dog Cat Gorilla Gorilla 3 Dog Dog Dog Cat There are probably 50 or so different cell values spread over multiple sheets and hundreds of rows and columns. I need to analyse this data and count occurancies, which is not a problem other than getting a list of unique values to start with and this has been driving me up the wall. What is the best way to produce this list. So from the above we would have Monkey Dog Cat Gorilla In order of preferred solutions, as this will need to be done monthly. Dynamic formula based VB Script Other ( Advanced filtering or other manual steps )

    Read the article

  • Lost the shift+< and shift+> key combinations

    - by REA_ANDREW
    On my Laptop I have somehow lost the shift+< and shift+ key combinations. Setup: Ubuntu 12.10 OS Windows 7 running in Virtual box Synergyc running on the Linux Host Connected to Synergys running on my desktop machine, also running Ubuntu 12.10 Info The key mappings are fine in Linux. This has happened following an install of vsvim inside of Visual Studio 2012. Now globally inside this particular Virtual Box instance I can no longer use shift+< and shift+ Funnily enough when I go to the VS Key mapping finder it shows me that: Shift+< mapped to Ctrl+Shift+Alt+Z Shift+ mapped to Ctrl+Shift+Alt+X I have asked in super user as this is also affecting the windows environment. Any help, greatly appreciated. TIA

    Read the article

  • Excel - Disable AutoFormatting on Import

    - by Philip Wales
    How can I stop Microsoft Excel from auto formatting data when imported from a text file? Specifically, I want it to treat all of the values as text. I am auditing insurance data in excel before it is uploaded to the new database. The files come to me as tab delimited text files. When loaded, Excel auto-formats the data causing leading 0's on Zip Codes, Routing Numbers and other codes, to be chopped off. I don't have the patience to reformat all of the columns as text and guess how many zeros need to be replaced. Nor do I want to click through the import wizard an specify that each column is text. Ideally I just want to turn off Excel's Auto-Formatting completely, and just edit every cell as it were plain text. I don't do any formula's or charts, just grid plain text editing.

    Read the article

  • Best (physical) DRM free MP3 players [closed]

    - by alex
    I'm looking to purchase an MP3 player soon. It should: Be compatible with Windows Media Player Hold at least 40 GB Be completely DRM free Be reliable and well built. I don't want to repeat my iRiver experience. Be small enough to be comfortably carried in my pocket. I don't care about looks, this can be the ugliest beast ever. Knowing this, what should I buy? [I figured this is almost on topic for Super User, if not: vote to close it.]

    Read the article

  • Slot load DVD burner options for standard desktop case

    - by Michael Kohne
    I need a new DVD burner (internal) for my father-in-law's computer. He's apparently broken the current one - he forgot to push the tray back in after doing something and hit it with his chair. Given this, I'd like to get him a slot-loading DVD burner, so as to avoid the problem entirely. I need an internal device, and I'll be mounting in a 5 1/4" bay. He doesn't need any super-spec device - as long as it can read/write all the standard formats, it's good. I see a few options at newegg.com, but they all have mixed reviews. Are there any out there that are generally seen as reliable? How does one go about mounting slimline devices in a standard 5 1/4" bay? Is there a standard faceplate kit for that?

    Read the article

  • Using pivot tables to group transactions

    - by andreas
    I have my bank account statement and what I would like to do is group the descriptions of the transactions together with their debit or credit and sum their total. I could then see that, e.g., for ebay.com my total debit was $2000, etc. Description Debit Credit A 1 B 1 A 1 B 1 C 1 D 1 A 1 What I want to do is use a pivot table Description Debit Credit A 3 B 2 C 1 D 1 I am no able to do that, as I can't group the description and have additional debit and credit columns -- I get them all in rows with blanks.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Set an Excel cell's color based on multiple other cells' colors

    - by Lord Torgamus
    I have an Excel 2007 spreadsheet for a list of products and a bunch of factors to rate each one on, and I'm using Conditional Formatting to set the color of the cells in the individual attribute columns. It looks something like this: I want to fill in the rating column for each item with a color, based on the color ratings of its individual attributes. Examples of ways to determine this: the color of the category in which the item scored worst the statistical mode of the category colors the average of the category ratings, where each color is assigned a numerical value How can I implement any or all of the above rules? (I'm really just asking for a quick overview of the relevant Excel feature; I don't need step-by-step instructions for each rule.)

    Read the article

  • How to generalize a method call in Java (to avoid code duplication)

    - by dln385
    I have a process that needs to call a method and return its value. However, there are several different methods that this process may need to call, depending on the situation. If I could pass the method and its arguments to the process (like in Python), then this would be no problem. However, I don't know of any way to do this in Java. Here's a concrete example. (This example uses Apache ZooKeeper, but you don't need to know anything about ZooKeeper to understand the example.) The ZooKeeper object has several methods that will fail if the network goes down. In this case, I always want to retry the method. To make this easy, I made a "BetterZooKeeper" class that inherits the ZooKeeper class, and all of its methods automatically retry on failure. This is what the code looked like: public class BetterZooKeeper extends ZooKeeper { private void waitForReconnect() { // logic } @Override public Stat exists(String path, Watcher watcher) { while (true) { try { return super.exists(path, watcher); } catch (KeeperException e) { // We will retry. } waitForReconnect(); } } @Override public byte[] getData(String path, boolean watch, Stat stat) { while (true) { try { return super.getData(path, watch, stat); } catch (KeeperException e) { // We will retry. } waitForReconnect(); } } @Override public void delete(String path, int version) { while (true) { try { super.delete(path, version); return; } catch (KeeperException e) { // We will retry. } waitForReconnect(); } } } (In the actual program there is much more logic and many more methods that I took out of the example for simplicity.) We can see that I'm using the same retry logic, but the arguments, method call, and return type are all different for each of the methods. Here's what I did to eliminate the duplication of code: public class BetterZooKeeper extends ZooKeeper { private void waitForReconnect() { // logic } @Override public Stat exists(final String path, final Watcher watcher) { return new RetryableZooKeeperAction<Stat>() { @Override public Stat action() { return BetterZooKeeper.super.exists(path, watcher); } }.run(); } @Override public byte[] getData(final String path, final boolean watch, final Stat stat) { return new RetryableZooKeeperAction<byte[]>() { @Override public byte[] action() { return BetterZooKeeper.super.getData(path, watch, stat); } }.run(); } @Override public void delete(final String path, final int version) { new RetryableZooKeeperAction<Object>() { @Override public Object action() { BetterZooKeeper.super.delete(path, version); return null; } }.run(); return; } private abstract class RetryableZooKeeperAction<T> { public abstract T action(); public final T run() { while (true) { try { return action(); } catch (KeeperException e) { // We will retry. } waitForReconnect(); } } } } The RetryableZooKeeperAction is parameterized with the return type of the function. The run() method holds the retry logic, and the action() method is a placeholder for whichever ZooKeeper method needs to be run. Each of the public methods of BetterZooKeeper instantiates an anonymous inner class that is a subclass of the RetryableZooKeeperAction inner class, and it overrides the action() method. The local variables are (strangely enough) implicitly passed to the action() method, which is possible because they are final. In the end, this approach does work and it does eliminate the duplication of the retry logic. However, it has two major drawbacks: (1) it creates a new object every time a method is called, and (2) it's ugly and hardly readable. Also I had to workaround the 'delete' method which has a void return value. So, here is my question: is there a better way to do this in Java? This can't be a totally uncommon task, and other languages (like Python) make it easier by allowing methods to be passed. I suspect there might be a way to do this through reflection, but I haven't been able to wrap my head around it.

    Read the article

  • Help recovering lost text from a refreshed Chrome webpage (it was in the clipboard as well)? [closed]

    - by tobeannounced
    Possible Duplicate: Chrome: where is the location to save browse temporary files Ok, so here's what happened - and yes, it was pretty stupid by me: I wrote up and submitted a post on Stack Overflow It was not suited to be placed on Stack Overflow as someone pointed out to me, so I deleted the post (this was a few hours ago) I copied the text into a new question page on Super User, but didn't submit it yet I accidentally just refreshed the webpage that had the text, and the question has now been deleted from Stack Overflow I have Lazarus installed, however the Chrome version doesn't have many features and the text was not recoverable from there. I do not have a clipboard manager, but the text was copied to my clipboard - so is there any way to get this back (Windows 7)? Although the post on Stack Overflow was deleted, I suppose it would have existed in my cache - could I recover it from there? Would the post on Stack Overflow exist in an rss feed anywhere? Many thanks, and I hope I can find this - and I am sure that the solution will prove valuable for me (and others) in the not too distant future once again.

    Read the article

  • Enlarge partition on SD card

    - by chenwj
    I have followed Cloning an SD card onto a larger SD card to clone a 2G SD card to a 32G SD card, and the file system is ext4. However, on the 32G SD card I only can see 2G space available. Is there a way to maximize it out? Here is the output of fdisk: Command (m for help): p Disk /dev/sdb: 32.0 GB, 32026656768 bytes 64 heads, 32 sectors/track, 30543 cylinders, total 62552064 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x000e015a Device Boot Start End Blocks Id System /dev/sdb1 * 32 147455 73712 c W95 FAT32 (LBA) /dev/sdb2 147456 3994623 1923584 83 Linux I want to make /dev/sdb2 use up the remaining space. I try resize2fs /dev/sdb after dd, but get message below: $ sudo resize2fs /dev/sdb resize2fs 1.42 (29-Nov-2011) resize2fs: Bad magic number in super-block while trying to open /dev/sdb Couldn't find valid filesystem superblock. Any idea on what I am doing wrong? Thanks.

    Read the article

  • How can i lock images to a cell in excel 2010

    - by Jamie
    Ok, so i am using microsoft excel 2010 and have a set up currently where i have 2 views expanded and deflated using the Group or +/- function. My problem is that ui have images on the workbook too. The images are over the cells which are to be "hidden" when the - button is pressed and i would like the images to disappear with them. This is not curently happening instead they are moving to the next visible cell. I have included an example below incase i wasn't clear. I wish to hide Columns M:AU and the images are in various cells suchas N5 and O5. When i colapse (hide) the column range all of the images move to "AV5" the next row along that isn't hidden. This means the workbooks is looking messy when colapsed which is the oposite of what i was trying to do. Can anyone advise on a way around this?

    Read the article

  • Source File not updating Destination Files in Excel

    - by user127105
    I have one source file that holds all my input costs. I then have 30 to 40 destination files (costing sheets) that use links to data in this source file for their various formulae. I was sure when I started this system that any changes I made to the source file, including the insertion of new rows and columns was updated automatically by the destination files, such that the formula always pulled the correct input costs. Now all of a sudden if my destination files are closed and I change the structure of the source file by adding rows - the destination files go haywire? They pick up changes to their linked cells, but don't pick up changes to the source sheet that have shifted their relative positions in the sheet. Do I really need to open all 40 destination files at the same time I alter the source file structure? Further info: all the destination files are protected, and I am working on DropBox.

    Read the article

  • Windows 7 Enterprise, Service Pack 1. Software MS Office Excel 2010

    - by user327560
    In Excel I understand there is no mechanism to customise & re-label the Rows & Columns (i.e. Renaming Col. A to some text like "Item Number" and so on. My question is regarding if it's possible to start Row Numbering at zero, or to determine a pre-allocated number of rows which contain my Headers, and then the first Row with the detail is infact seen as Row 1? Reason for question is I work multiple INternational Projects and we use Excel to trsack alot of activities & issues. Oddly, many people will refer to, for example "Point 7"... Some people mean the ID 7 (which I have the first Column dedicated to ID Number), some mean Excel Row 7, which infact could be really ID 3, or 4 from Col. A.... Any easy way or workaround to just use the Excel Row Numbers but select from when Row 1 is counted?

    Read the article

  • How to line up columns using paste(1)? or how to make an aligned table merging lines in the shell?

    - by nn
    Hi, I want to merge lines such that the merged lines are aligned on the same boundary. UNIX paste(1) does this nicely when lines all meet at the same tab boundary, but when lines differ in size (in the file that lines are being merged into), the text comes out awkward. Example of paste(1) that has the desired effect: $ echo -e "a\nb\nccc\nd" | paste - - a b ccc d Example of paste(1) with undesired effect: $ echo -e "a\nb\ncccccccccccc\nd" | paste - - a b cccccccccccc d Note how the 2nd column doesn't line up. I want 'b' to line up with 'd', which requires an additional tab. Unfortunately I believe this is the limit for the paste utility, so if anyone has any idea of how to get the desired effect above, I'd love to hear it.

    Read the article

< Previous Page | 76 77 78 79 80 81 82 83 84 85 86 87  | Next Page >