Search Results

Search found 2723 results on 109 pages for 'ssrs printing'.

Page 83/109 | < Previous Page | 79 80 81 82 83 84 85 86 87 88 89 90  | Next Page >

  • java updating text area

    - by n0ob
    for my application I have to build a little customized time ticker which ticks over after whatever delay I tell it to and writes the new value in my textArea. The problem is that the ticker is running fully until the termination time and then printing all the values. How can I make the text area change while the code is running. while(tick<terminationTime){ if ((System.currentTimeMillis()) > (msNow + delay)){ msNow = System.currentTimeMillis(); tick = tick + 1; currentTime.setText(""+tick); sourceTextArea.append(""+tick+" " + System.currentTimeMillis() +" \n"); } currentTime and sourceTextArea are both text areas and both are getting updated after the while loop ends.

    Read the article

  • How do I get the size of a response from a Spring 2.5 HTTP remoting call?

    - by aarestad
    I've been poking around the org.springframework.remoting.httpinvoker package in Spring 2.5 trying to find a way to get visibility into the size of the response, but I keep going around in circles. Via another question I saw here, I think what I want to do is get a handle on the InputStream that represents the response from the server, and then wrap it with an Apache commons-io CountingInputStream. What's the best way to go about doing this? For the moment, I'd be happy with just printing the size of the response to stdout, but eventually I want to store it in a well-known location in my app for optional display.

    Read the article

  • How to configure tomahawk and trinidad to work together

    - by ashtaganesh
    Hi, I am new to JSF. I want to use inputListOfValues component from Trinidad in my application which also uses Tomahawk. I have added the required jars for Trinidad and before getting inputListOfValues I tried one simple inputText to be printed on browser using Trinidad. I was not getting any configuration errors but it was not printing the corresponding text on browser. So I wonder if I can use tomahawk and trinidad together ? If yes, is there any configuration setting we need to do for this ? Any help will be greatly appreciated. Thanks, Ganesh.

    Read the article

  • Floor function returning EXC_BAD_ACCESS

    - by fastrack20
    The cod that I am using contains these snippets of code. I am calling ThetaG_JD with the argument 2455343.50000 which is just a sample Julian date. Every time I run the program, I receive a EXC_BAD_ACCESS on the indicated line. When using gdb and printing out the intermediary values and passing them through the floor function, I get no error, but when Frac() is used it always returns an error. double Frac(double arg) { /* Returns fractional part of double argument */ return arg - floor(arg); } double ThetaG_JD(double jd) { /* Reference: The 1992 Astronomical Almanac, page B6. */ double UT=0, TU=0, GMST=0; //THIS LINE UT=Frac(jd+0.5); // THAT ONE ^^ jd=jd-UT; TU=(jd-2451545.0)/36525; GMST=24110.54841+TU*(8640184.812866+TU*(0.093104-TU*6.2E-6)); GMST=Modulus(GMST+secday*omega_E*UT,secday); return (twopi*GMST/secday); }

    Read the article

  • Can a http server detect that a client has cancelled their request?

    - by Nick Retallack
    My web app must process and serve a lot of data to display certain pages. Sometimes, the user closes or refreshes a page while the server is still busy processing it. This means the server will continue to process data for several minutes only to send it to a client who is no longer listening. Is it possible to detect that the connection has been broken, and react to it? In this particular project, we're using Django and NginX, or Apache. I assumed this is possible because the Django development server appears to react to cancelled requests by printing Broken Pipe exceptions. I'd love to have it raise an exception that my application code could catch. Alternatively, I could register an unload event handler on the page in question, have it do a synchronous XHR requesting that the previous request from this user be cancelled, and do some kind of inter-process communication to make it so. Perhaps if the slower data processing were handed to another process that I could more easily identify and kill, without killing the responding process...

    Read the article

  • 8 byte Integer with Doctrine and PHP

    - by Rufinus
    Hi, the players: 64bit linux with php 5 (ZendFramework 1.10.2) PostgreSQL 7.3 Doctrine 1.2 Via a Flash/Flex client i get an 8byte integer value. the field in the database is an BIGINT (8 byte) PHP_INT_SIZE show that system supports 8byte integer. printing out the value in the code as it is and as intval() leads to this: Plain: 1269452776100 intval: 1269452776099 float rounding failure ? but what really driving me nuts is ERROR: invalid input syntax for integer: "1269452776099.000000"' when i try to use it in a query. like: Doctrine_Core::getTable('table')->findBy('external_id',$external_id); or Doctrine_Core::getTable('table')->findBy('external_id',intval($external_id)); How i am supposed to handle this ? or how can i give doctrine a floating point number which it should use on a bigint field ? Any help is much appreciated! TIA

    Read the article

  • Dynamically creating a member ID card as pdf using PHP?

    - by aefxx
    I need to code a PHP script that would let me generate a pdf file which displays a member ID card (something like a credit card used to identify oneself) at a certain resolution. Let me explain: I do have the basic blueprint of the card in png file format. The script needs to drop in a member's name and birthday along with a serial. So far, no problem - there are plenty of good working PHP libraries out there. My problem is to ensure that the resulting pdf (the generated image of the card, to be precise) meets a certain resolution (preferably 300dpi), so that printing it would look right. Any ideas? EDIT I solved it using the TCPDF library which lets you scale images at a certain resolution. Get it here: http://www.tecnick.com/public/code/cp_dpage.php?aiocp_dp=tcpdf

    Read the article

  • flex3 Format date without timezone

    - by Maurits de Boer
    I'm receiving a date from a server in milliseconds since 1-1-1970. I then use the DateFormatter to print the date to the screen. However, Flex adds timedifference and thus it displays a different time than what I got from the server. I've fixed this by changing the date before printing to screen. But I think that's a bad solution because the date object doesn't hold the correct date. Does anyone know how to use the dateFormatter to print the date, ignoring the timezone? this is how I did it: function getDateString(value:Date):String { var millisecondsPerMinute:int = 1000*60; var newDate:Date = new Date(value.time - (millisecondsPerMinute*value.timezoneOffset)); var dateFormatter:DateFormatter = new DateFormatter(); dateFormatter.formatString = "EEEE DD-MM-YYYY LL:MM AA"; return dateFormatter.format(newDate); }

    Read the article

  • Anybody know why the Output of this program is like this?(using iterator in c#)

    - by Babu
    using System; using System.Collections; namespace Iterator_test { class Day { int days_idx = -1; private String[] days = { "mon", "tue", "wed","thu","fri","sat","sun" }; public IEnumerable getdays() { days_idx++; yield return days[days_idx]; } } class Program { static void Main(string[] args) { Day d = new Day(); foreach (string day in d.getdays()) { Console.WriteLine(day); } } } } Actually the output should be, mon tue wed thu fri sat sun but its printing only "mon" as, mon What will be the reason?

    Read the article

  • How do you printf an unsigned long long int?

    - by superjoe30
    #include <stdio.h>int main() { unsigned long long int num = 285212672; //FYI: fits in 29 bits int normalInt = 5; printf("My number is %d bytes wide and its value is %ul. A normal number is %d.\n", sizeof(num), num, normalInt); return 0;} Output: My number is 8 bytes wide and its value is 285212672l. A normal number is 0. I assume this unexpected result is from printing the unsigned long long int. How do you printf an unsigned long long int?

    Read the article

  • ASP.NET MVC AJAX value not displaying

    - by mazhar kaunain baig
    View: function success(arg) { var obj = arg.get_response().get_object(); if (obj.ErrorMessage === '') { var answer = document.createElement('div'); answer.appendChild(document.createTextNode(obj.Answer)); document.getElementById('answers').appendChild(answer); } else { document.getElementById('errors').innerHTML = obj.ErrorMessage; } } <% using (Ajax.BeginForm("EditOrganizationMeta", "Organization", new AjaxOptions { HttpMethod = "POST", OnSuccess = "success" })) { %> <input type="submit" name="button<%=OrganizationMeta.vcr_MetaKey + Lang.int_LangId %>" value="Save" /> <div id="errors"></div> <div id="answers"></div> <% } %> Controller: [HttpPost] [ValidateInput(false)] public ActionResult EditOrganizationMeta(FormCollection collection) { return Json(new { Answer = "Record Successfully Saved", ErrorMessages = "Title is required" }); } The thing is that success method in the javascript is not getting the required parameters. It is printing undefined there. Is there a problem in javascript method OnSuccess?

    Read the article

  • Manipulate Page Theme Programatically

    - by Aren B
    I've got the following Setup in my Theme: \App_Themes\Default\StyleSheet.css \App_Themes\Default\PrintStyleSheet.css The PrintStyleSheet.css file has a set of printing css rules set in them wrapped in an @Media Print { } block. I need a way to programmatically remove the PrintStyleSheet.css from the list of css files for ASP.NET to inject based on some flags. (Some instances we want to print the site verbatim without custom formatting). I know i could build a seperate theme without the PrintStyleSheet.css in it and switch the theme programmatically, however this would introduce duplication of my master stylesheet which is not acceptable. Any ideas?

    Read the article

  • sql query question

    - by bu0489
    hey guys, just having a bit of difficulty with a query, i'm trying to figure out how to show the most popular naturopath that has been visited in a centre. My tables look as follows; Patient(patientId, name, gender, DoB, address, state,postcode, homePhone, businessPhone, maritalStatus, occupation, duration,unit, race, registrationDate , GPNo, NaturopathNo) and Naturopath (NaturopathNo, name, contactNo, officeStartTime, officeEndTime, emailAddress) now to query this i've come up with SELECT count(*), naturopathno FROM dbf10.patient WHERE naturopathno != 'NULL' GROUP BY naturopathno; which results in; COUNT(*) NATUROPATH 2 NP5 1 NP6 3 NP2 1 NP1 2 NP3 1 NP7 2 NP8 My question is, how would I go about selecting the highest count from this list, and printing that value with the naturopaths name? Any suggestions are very welcome, Brad

    Read the article

  • Purpose of Trigraph sequences in C++?

    - by Kirill V. Lyadvinsky
    According to C++'03 Standard 2.3/1: Before any other processing takes place, each occurrence of one of the following sequences of three characters (“trigraph sequences”) is replaced by the single character indicated in Table 1. ---------------------------------------------------------------------------- | trigraph | replacement | trigraph | replacement | trigraph | replacement | ---------------------------------------------------------------------------- | ??= | # | ??( | [ | ??< | { | | ??/ | \ | ??) | ] | ??> | } | | ??’ | ˆ | ??! | | | ??- | ˜ | ---------------------------------------------------------------------------- In real life that means that code printf( "What??!\n" ); will result in printing What| because ??! is a trigraph sequence that is replaced with the | character. My question is what purpose of using trigraphs? Is there any practical advantage of using trigraphs? UPD: In answers was mentioned that some European keyboards don't have all the punctuation characters, so non-US programmers have to use trigraphs in everyday life? UPD2: Visual Studio 2010 has trigraph support turned off by default.

    Read the article

  • Two '==' equality operators in same 'if' condition are not working as intended.

    - by Manav MN
    I am trying to establish equality of three equal variables, but the following code is not printing the obvious true answer which it should print. Can someone explain, how the compiler is parsing the given if condition internally? #include<stdio.h> int main() { int i = 123, j = 123, k = 123; if ( i == j == k) printf("Equal\n"); else printf("NOT Equal\n"); return 0; } Output: manav@workstation:~$ gcc -Wall -pedantic calc.c calc.c: In function ‘main’: calc.c:5: warning: suggest parentheses around comparison in operand of ‘==’ manav@workstation:~$ ./a.out NOT Equal manav@workstation:~$ EDIT: Going by the answers given below, is the following statement okay to check above equality? if ( (i==j) == (j==k))

    Read the article

  • Add characters to month loop?

    - by JM4
    I currently have a php loop running exactly how I need it with proper validations (in both php and javascript) with one exception, if the month is less than 2 digits, (i.e. 1,2,3,4), I need for a '0' to appear before: 01 - January 02 - February ... 10 - October My code for the loop is currently: <select name="Month"> <option value="">Month</option> <?php for ($i=1; $i<=12; $i++) { echo "<option value='$i'"; if ($fields["Month"] == $i) echo " selected"; echo ">$i</option>"; } ?> </select> any ideas? Also note, this month date is being stored in session, not interested in printing to screen

    Read the article

  • Why am I not getting the expected results with fread() in C?

    - by mauvehead
    Here is my code: #include <stdio.h> int main(void) { FILE *fp; unsigned int i; char bytes[512]; fp = fopen("myFile","r"); for(i = 0;i <= 512;i++) { fread(&bytes, sizeof(bytes), 1, fp); printf("bytes[%d]: %x\n", i, bytes[i]); } } Here is the expected output $ hexdump myFile 0000000 aa55 aa55 0060 0000 0a17 0000 b1a5 a2ea 0000010 0000 0000 614c 7563 616e 0000 0000 0000 0000020 0000 0000 0a68 0000 1001 421e 0000 0000 0000030 f6a0 487d ffff ffff 0040 0000 002f 0000 But here is what I see from my program bytes[0]: 55 bytes[1]: 8 bytes[2]: ffffffc8 bytes[3]: ffffffdd bytes[4]: 22 bytes[5]: ffffffc8 bytes[6]: ffffff91 bytes[7]: 63 bytes[8]: ffffff82 My obvious guess is that I'm either addressing something incorrectly and receiving the wrong data back or I am printing it incorrectly and viewing it the wrong way.

    Read the article

  • PostScript versus PDF as an output format

    - by Brecht Machiels
    I'm currently writing a typesetting application and I'm using PSG as the backend for producing postscript files. I'm now wondering whether that choice makes sense. It seems the ReportLab Toolkit offers all the features PSG offers, and more. ReportLab outputs PDF however. Advantages PDF offers: transparancy better support for character encodings (Unicode, for example) ability to embed TrueType and even OpenType fonts hyperlinks and bookmarks Is there any reason to use Postscript instead of directly outputting to PDF? While Postscript is a full programming language as opposed to PDF, as a basic output format for documents, that doesn't seem to offer any advantage. I assume a PDF can be readily converted to PostScript for printing? Some useful links: Wikipedia: PDF Adobe: PostScript vs. PDF

    Read the article

  • .NET Excel Interop - Why aren't my Footers displaying in my printed output file?

    - by Ryan
    I'm working with C# and Office 2007's Excel Interop API. I'm opening an Excel file, applying some formatting and then sending it to the printer. I've got a problem, though. The Footer text doesn't appear to be printing. If I check the PageSetup.RightFooter property, I can see the expected Page Number in the Footer. That Page Number doesn't appear anywhere on the printed output sheet. When I print using Excel, though, they appear. Does anyone know why my Footer text is not appearing? Here's my code. Pastebin of my C# code

    Read the article

  • How to Ignore certain tags and replace texts in PHP

    - by Aakash Chakravarthy
    Hello, I have a variable like $content = "Lorem Ipsum is simply <b>dummy text of the printing</b> and typesetting industry. Lorem Ipsum has been the industry's <i>standard dummy text</i> ever since the 1500s <string>javascriptFunc();</script>" ; when i use str_replace('a', '', $content); all the 'a's get removed. But the 'a's within the <script> tag should not be removed. or is there any way to replace text other than this method Please help .

    Read the article

  • RDLC item width is dynamic and causing extra pages to be generated (image included)?

    - by Paul Mendoza
    I'm trying to format an RDLC report file in Visual Studio 2008 and I am having a formatting issue. I have a list at the bottom that contains a matrix that expands horizontally to the right. That pink box is just to visualize the problem I'm having. When the report is rendered the matrix expands and instead of filling the pink box with the matrix is pushes the space in the pink box to the right resulting in an extra page when printing the reports. One solution would be to shrink the pink box to be the size of the matrix which I've done. But then when the matrix grows the fields at the top of the report get pushed to the right by the same amount as the growth of the matrix. Can someone please let me know what they think the solution would be? Thank you!

    Read the article

  • Executing certain code for every method call in C++

    - by Luís Guilherme
    I have a C++ class I want to inspect. So, I would like to all methods print their parameters and the return, just before getting out. The latter looks somewhat easy. If I do return() for everything, a macro #define return(a) cout << (a) << endl; return (a) would do it (might be wrong) if I padronize all returns to parenthesized (or whatever this may be called). If I want to take this out, just comment out the define. However, printing inputs seems more difficult. Is there a way I can do it, using C++ structures or with a workaroud hack?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Painting to Form then to Printer

    - by jp2code
    I often find myself needing to create custom reports that do NOT work with Crystal Reports or Report Viewer. Often, I hack a DataTable together and dumping that into a DataGridView control. It is never pretty, and printing is difficult. What I need is a class that I can call using the OnPaint event, but I've never sat down and written all of the Pen and Brush commands until now. Painting to the screen and painting to a printer both use the Graphics object, so I want to build a class that I'd pass in the Graphics object, my window bounds (a Rectangle), and some data (in the form of an instance of my class) that I'd use to paint a form or a sheet of paper. That sounds like a great concept! Surely, someone has done something like this before. Does anyone know of a book, a website tutorial, or video that goes into this? If someone wants to write all that out for me here, more power to you - but I'd think that would be too much work.

    Read the article

  • QT clicked signal dosnt work on QStandardItemModel with tree view

    - by user63898
    Hello i have this code in QT and all i want to to catch the clicked event when some one clicking in one of the treeview rows without success here is my code: (parant is the qMmainwindow) m_model = new QStandardItemModel(0, 5, parent); // then later in the code i have proxyModel = new QSortFilterProxyModel; proxyModel->setDynamicSortFilter(true); setSourceModel(createMailModel(parent)); ui.treeView->setModel(proxyModel); ui.treeView->setSortingEnabled(true); ui.treeView->sortByColumn(4, Qt::DescendingOrder); // and my signal/slot looks like this but its not working //and im not getting eny clicked event fired connect(ui.treeView,SIGNAL(Clicked(const QModelIndex& ) ), this,SLOT( treeViewSelectedRow(const QModelIndex& ) ) ); also how can i debug QT signal/slots so i can see some debug massages printing when something is wrong ?

    Read the article

< Previous Page | 79 80 81 82 83 84 85 86 87 88 89 90  | Next Page >