Search Results

Search found 2755 results on 111 pages for 'blue gene'.

Page 84/111 | < Previous Page | 80 81 82 83 84 85 86 87 88 89 90 91  | Next Page >

  • "Windows failed to start" loop with 0xc0000225. No install discs, EasyRE/USB iso hasn't worked

    - by mvidaure
    I've been suffering from this "Windows failed to start" loop with 0xc0000225 for 3 days now and I still can't fix it. The major problem is that I don't have any sort of installation disc. However, I have tried EasyRE via both CD and USB but both result in the same problem.  I try to perform an 'Automated Repair' on my computer and I get in red text "The selected partition is corrupted and could not be accessed or repaired. Please select a different drive to continue." It is also labeled as NO under Active. Since I do not have a the installation discs, I made a USB with a Windows_7_Recovery_Disc  iso (as shown here http://www.sevenforums.com/tutorials/31541-windows-7-usb-dvd-download-tool.html) but it also doesn't work. I get a blue screen that says "RECOVERY You pc needs to be repaired. The application or operating system could not be uploaded because a required file is missing or contains errors... File:\WINDOWS\system32\winload.efi Error code: 0xc0000225 You'll need to use the recovery tools on your installation media. If you don't have any installation media, contact your system administrator or PC manufacturer." Thanks in advance! Miguel

    Read the article

  • Linux can dual display but windows can't?

    - by Mr_CryptoPrime
    I have two monitors, one that is hdmi-to-dvi and the other vga-to-dvi. I have an AMD HD Radeon 6900 series graphics card installed. I got Ubuntu to display dual monitors, but then I restarted for an update and then Ubuntu wouldn't even boot in recovery mode, it just kept cycling forever...displaying something about "timeout: killing [filepath] [hexadecimal]. So I tried booting into windows (7-professional) and it crashed and displayed this after rebooting: IRQL_NOT_LESS_OR_EQUAL, PAGE_FAULT-IN-NONPAGED-AREA. I went into Bios and reverted to the system defaults and ran system restore and it booted ok, but the dvi-to-dvi monitor would not display. I made sure my drivers were updated and catalyst was updated. Also through research discovered only one is for vga and the other is digital only, so I put the vga-to-dvi in the vga slot and so on. Neither windows or catalyst will detect the dvi-to-dvi montior. Any suggestions? Thanks. EDIT: Found out that booting into Ubuntu with only one monitor (using either monitor with either cable) worked perfectly fine. I could then add another monitor and it displays ok. However, it will, out of the blue, suddenly distort the display. At first I thought the computer crashed, but it is something with the video output from the GPU to the monitor because I pushed the power button and it would refresh every 5secs or so and I could see the "Ubuntu will power down in X seconds", even though it was horribly distorted. Any ideas what's causing this?

    Read the article

  • computer randomly restarting. both in game and out of game

    - by eric
    first my specs are. AMD Phenom II x4 955 processor 3.2ghz 20gb ddr3 ram 4Gb Nvidia Geforce GTX 770 850w Corsair tx850w psu Gigabyte ud3 mobo Windows 7 professional I recently uprgraded my vid card to gtx770 and upgraded my psu to the 850w thats in it now. i did a reformat with the installation of the new gpu and psu and started fresh and only have a couple programs installed (diablo3, nvidia control panel, wow, and steam). all drivers are up to date and everything is hooked up correctly. the problem is it will randomly shut down. no blue screen. just turns itself straight off and reboots after a couple seconds. occasionally i will have to unplug the power cable from the psu for a few minutes then reconnect and it will start up. it seems pretty random. sometimes it does it when my pc is just sitting there on the home screen. and sometimes it does it during games. and sometimes it doesnt do it for days at a time. i noticed the psu felt hot so i put an extra fan blowing straight onto both the psu and gpu and neither feel overly hot after it shuts down now. could it just be that it is a psu problem. the psu was taken from another machine but wasnt having this problem in that machine. i have seen a few articles online about gtx770 doing the same thing. but i havent found any answers or solutions. any help will be appreciated. im sure the 850w is enough to power my machine, im just stumped and ran out of ideas to fix it. i have even returned the video card for another thinking it might have been an issue with that particular card, but still gettin the same problem.

    Read the article

  • Some problems with GridView in webpart with multiple filters.

    - by NF_81
    Hello, I'm currently working on a highly configurable Database Viewer webpart for WSS 3.0 which we are going to need for several customized sharepoint sites. Sorry in advance for the large wall of text, but i fear it's necessary to recap the whole issue. As background information and to describe my problem as good as possible, I'll start by telling you what the webpart shall do: Basically the webpart contains an UpdatePanel, which contains a GridView and an SqlDataSource. The select-query the Datasource uses can be set via webbrowseable properties or received from a consumer method from another webpart. Now i wanted to add a filtering feature to the webpart, so i want a dropdownlist in the headerrow for each column that should be filterable. As the select-query is completely dynamic and i don't know at design time which columns shall be filterable, i decided to add a webbrowseable property to contain an xml-formed string with filter information. So i added the following into OnRowCreated of the gridview: void gridView_RowCreated(object sender, GridViewRowEventArgs e) { if (e.Row.RowType == DataControlRowType.Header) { for (int i = 0; i < e.Row.Cells.Count; i++) { if (e.Row.Cells[i].GetType() == typeof(DataControlFieldHeaderCell)) { string headerText = ((DataControlFieldHeaderCell)e.Row.Cells[i]).ContainingField.HeaderText; // add sorting functionality if (_allowSorting && !String.IsNullOrEmpty(headerText)) { Label l = new Label(); l.Text = headerText; l.ForeColor = Color.Blue; l.Font.Bold = true; l.ID = "Header" + i; l.Attributes["title"] = "Sort by " + headerText; l.Attributes["onmouseover"] = "this.style.cursor = 'pointer'; this.style.color = 'red'"; l.Attributes["onmouseout"] = "this.style.color = 'blue'"; l.Attributes["onclick"] = "__doPostBack('" + panel.UniqueID + "','SortBy$" + headerText + "');"; e.Row.Cells[i].Controls.Add(l); } // check if this column shall be filterable if (!String.IsNullOrEmpty(filterXmlData)) { XmlNode columnNode = GetColumnNode(headerText); if (columnNode != null) { string dataValueField = columnNode.Attributes["DataValueField"] == null ? "" : columnNode.Attributes["DataValueField"].Value; string filterQuery = columnNode.Attributes["FilterQuery"] == null ? "" : columnNode.Attributes["FilterQuery"].Value; if (!String.IsNullOrEmpty(dataValueField) && !String.IsNullOrEmpty(filterQuery)) { SqlDataSource ds = new SqlDataSource(_conStr, filterQuery); DropDownList cbx = new DropDownList(); cbx.ID = "FilterCbx" + i; cbx.Attributes["onchange"] = "__doPostBack('" + panel.UniqueID + "','SelectionChange$" + headerText + "$' + this.options[this.selectedIndex].value);"; cbx.Width = 150; cbx.DataValueField = dataValueField; cbx.DataSource = ds; cbx.DataBound += new EventHandler(cbx_DataBound); cbx.PreRender += new EventHandler(cbx_PreRender); cbx.DataBind(); e.Row.Cells[i].Controls.Add(cbx); } } } } } } } GetColumnNode() checks in the filter property, if there is a node for the current column, which contains information about the Field the DropDownList should bind to, and the query for filling in the items. In cbx_PreRender() i check ViewState and select an item in case of a postback. In cbx_DataBound() i just add tooltips to the list items as the dropdownlist has a fixed width. Previously, I used AutoPostback and SelectedIndexChanged of the DDL to filter the grid, but to my disappointment it was not always fired. Now i check __EVENTTARGET and __EVENTARGUMENT in OnLoad and call a function when the postback event was due to a selection change in a DDL: private void FilterSelectionChanged(string columnName, string selectedValue) { columnName = "[" + columnName + "]"; if (selectedValue.IndexOf("--") < 0 ) // "-- All --" selected { if (filter.ContainsKey(columnName)) filter[columnName] = "='" + selectedValue + "'"; else filter.Add(columnName, "='" + selectedValue + "'"); } else { filter.Remove(columnName); } gridView.PageIndex = 0; } "filter" is a HashTable which is stored in ViewState for persisting the filters (got this sample somewhere on the web, don't remember where). In OnPreRender of the webpart, i call a function which reads the ViewState and apply the filterExpression to the datasource if there is one. I assume i had to place it here, because if there is another postback (e.g. for sorting) the filters are not applied any more. private void ApplyGridFilter() { string args = " "; int i = 0; foreach (object key in filter.Keys) { if (i == 0) args = key.ToString() + filter[key].ToString(); else args += " AND " + key.ToString() + filter[key].ToString(); i++; } dataSource.FilterExpression = args; ViewState.Add("FilterArgs", filter); } protected override void OnPreRender(EventArgs e) { EnsureChildControls(); if (WebPartManager.DisplayMode.Name == "Edit") { errMsg = "Webpart in Edit mode..."; return; } if (useWebPartConnection == true) // get select-query from consumer webpart { if (provider != null) { dataSource.SelectCommand = provider.strQuery; } } try { int currentPageIndex = gridView.PageIndex; if (!String.IsNullOrEmpty(m_SortExpression)) { gridView.Sort("[" + m_SortExpression + "]", m_SortDirection); } gridView.PageIndex = currentPageIndex; // for some reason, the current pageindex resets after sorting ApplyGridFilter(); gridView.DataBind(); } catch (Exception ex) { Functions.ShowJavaScriptAlert(Page, ex.Message); } base.OnPreRender(e); } So i set the filterExpression and the call DataBind(). I don't know if this is ok on this late stage.. don't have a lot of asp.net experience after all. If anyone can suggest a better solution, please give me a hint. This all works great so far, except when i have two or more filters and set them to a combination that returns zero records. Bam ... gridview gone, completely - without a possiblity of changing the filters back. So i googled and found out that i have to subclass gridview in order to always show the headerrow. I found this solution and implemented it with some modifications. The headerrow get's displayed and i can change the filters even if the returned result contains no rows. But finally to my current problem: When i have two or more filters set which return zero rows, and i change back one filter to something that should return rows, the gridview remains empty (although the pager is rendered). I have to completly refresh the page to reset the filters. When debugging, i can see in the overridden CreateChildControls of the grid, that the base method indeed returns 0, but anyway... the gridView.RowCount remains 0 after databinding. Anyone have an idea what's going wrong here?

    Read the article

  • Would anyone tell me how to fetch the media:thumb element's attribute from a json feed?

    - by ash
    I made a yahoo pipe that pulls up the atoms as json format; however, I can fetch and display all the elements in my html page except for the element's attribute. Would anyone tell me how to fetch the media:thumb element's attribute from a json feed? I am pasting the html page's code with javascript. If you save the html page and then view it in browser, you will see that all the necessary elements get output at html page except for the media:thumb as I cannot display the attribute of media:thumb when the feed is formatted as json. I am also pasting the some portion of the json feed so that you can have an idea what i am talking about. Please tell me how to retrieve attribute from media:thumb element of a json feed by using plain javascript but no server side code or javascript library. Thank you. function getFeed(feed){ var newScript = document.createElement('script'); newScript.type = 'text/javascript'; newScript.src = 'http://pipes.yahoo.com/pipes/pipe.run?_id=40616620df99780bceb3fe923cecd216&_render=json&_callback=piper'; document.getElementsByTagName("head")[0].appendChild(newScript); } function piper(feed){ var tmp=''; for (var i=0; i'; tmp+=feed.value.items[i].title+''; tmp+=feed.value.items[i].author.name+''; tmp+=feed.value.items[i].published+''; if (feed.value.items[i].description) { tmp+=feed.value.items[i].description+''; } tmp+='<hr>'; } document.getElementById('rssLayer').innerHTML=tmp; } </script> bchnbc .............................................................. Some portion of the json feed that gets generated by yahoo pipe .............................................................. piper({"count":2,"value":{"title":"myPipe","description":"Pipes Output","link":"http:\/\/pipes.yahoo.com\/pipes\/pipe.info?_id=f7f4175d493cf1171aecbd3268fea5ee","pubDate":"Fri, 02 Apr 2010 17:59:22 -0700","generator":"http:\/\/pipes.yahoo.com\/pipes\/","callback":"piper", "items": [{ "rights":"Attribution - Noncommercial - No Derivative Works", "link":"http:\/\/vodo.net\/mixtape1", "y:id":{"value":null,"permalink":"true"}, "content":{"content":"We're proud to be releasing this first VODO MIXTAPE. Actual tape might be a thing of the past, but before P2P, mixtapes were the most popular way of sharing popular culture the world had known -- and once called the 'most widely practiced American art form'. We want to resuscitate the spirit of the mixtape for this VODO MIXTAPE series: compilations of our favourite shorts, the weird, the wild and the wonky, all brought together in a temporary and uncomfortable company.","type":"text"}, "author": {"name":"Various"}, "description":"We're proud to be releasing this first VODO MIXTAPE. Actual tape might be a thing of the past, but before P2P, mixtapes were the most popular way of sharing popular culture the world had known -- and once called the 'most widely practiced American art form'. We want to resuscitate the spirit of the mixtape for this VODO MIXTAPE series: compilations of our favourite shorts, the weird, the wild and the wonky, all brought together in a temporary and uncomfortable company.", "media:thumbnail": { "url":"http:\/\/vodo.net\/\/thumbnails\/Mixtape1.jpg" }, "published":"2010-03-08-09:20:20 PM", "format": { "audio_bitrate":null, "width":"608", "xmlns":"http:\/\/xmlns.transmission.cc\/FileFormat", "channels":"2", "samplerate":"44100.0", "duration":"3092.36", "height":"352", "size":"733925376.0", "framerate":"25.0", "audio_codec":"mp3", "video_bitrate":"1898.0", "video_codec":"XVID", "pixel_aspect_ratio":"16:9" }, "y:title":"Mixtape #1: VODO's favourite short films", "title":"Mixtape #1: VODO's favourite short films", "id":null, "pubDate":"2010-03-08-09:20:20 PM", "y:published":{"hour":"3","timezone":"UTC","second":"0","month":"4","minute":"10","utime":"1270264200","day":"3","day_of_week":"6","year":"2010" }}, {"rights":"Attribution - Noncommercial - No Derivative Works","link":"http:\/\/vodo.net\/gilbert","y:id":{"value":"cd6584e06ea4ce7fcd34172f4bbd919e295f8680","permalink":"true"},"content":{"content":"A documentary short about Gilbert, the Beacon Hill \"town crier.\" For the last 9 years, since losing his job and becoming homeless, Gilbert has delivered the weather, sports, and breaking headlines from his spot on the Boston Common. Music (used with permission) in this piece is called \"Blue Bicycle\" by Dusseldorf-based pianist \/ composer Volker Bertelmann also known as Hauschka. Artistic Statement: This is the first in a series of profiles of people who I think are interesting, and who I see on almost a daily basis. I don't want to limit the series to people who live \"on the fringe,\" but it would be appropriate to say that most of the people I interview are eclectic, eccentric, and just a little bit unique. The art is in the viewing - but I hope to turn my lens on individuals that don't always color in the lines, whether they can help it or not.","type":"text"},"author":{"name":"Nathaniel Hansen"},"description":"A documentary short about Gilbert, the Beacon Hill \"town crier.\" For the last 9 years, since losing his job and becoming homeless, Gilbert has delivered the weather, sports, and breaking headlines from his spot on the Boston Common. Music (used with permission) in this piece is called \"Blue Bicycle\" by Dusseldorf-based pianist \/ composer Volker Bertelmann also known as Hauschka. Artistic Statement: This is the first in a series of profiles of people who I think are interesting, and who I see on almost a daily basis. I don't want to limit the series to people who live \"on the fringe,\" but it would be appropriate to say that most of the people I interview are eclectic, eccentric, and just a little bit unique. The art is in the viewing - but I hope to turn my lens on individuals that don't always color in the lines, whether they can help it or not.","media:thumbnail":{"url":"http:\/\/vodo.net\/\/thumbnails\/gilbert.jpeg"},"published":"2010-03-03-10:37:05 AM","format":{"audio_bitrate":null,"width":"624","xmlns":"http:\/\/xmlns.transmission.cc\/FileFormat","channels":"2","samplerate":null,"duration":"373.673","height":"352","size":"123321266.0","framerate":null,"audio_codec":"mp3","video_bitrate":null,"video_codec":"XVID","pixel_aspect_ratio":"16:9"},"y:title":"Gilbert","title":"Gilbert","id":"cd6584e06ea4ce7fcd34172f4bbd919e295f8680","pubDate":"2010-03-03-10:37:05 AM","y:published":{"hour":"3","timezone":"UTC","second":"0","month":"4","minute":"10","utime":"1270264200","day":"3","day_of_week":"6","year":"2010" }} ] }})

    Read the article

  • scrolling lags in emacs 23.2 with GTK

    - by mefiX
    Hey there, I am using emacs 23.2 with the GTK toolkit. I built emacs from source using the following configure-params: ./configure --prefix=/usr --without-makeinfo --without-sound Which builds emacs with the following configuration: Where should the build process find the source code? /home/****/incoming/emacs-23.2 What operating system and machine description files should Emacs use? `s/gnu-linux.h' and `m/intel386.h' What compiler should emacs be built with? gcc -g -O2 -Wdeclaration-after-statement -Wno-pointer-sign Should Emacs use the GNU version of malloc? yes (Using Doug Lea's new malloc from the GNU C Library.) Should Emacs use a relocating allocator for buffers? yes Should Emacs use mmap(2) for buffer allocation? no What window system should Emacs use? x11 What toolkit should Emacs use? GTK Where do we find X Windows header files? Standard dirs Where do we find X Windows libraries? Standard dirs Does Emacs use -lXaw3d? no Does Emacs use -lXpm? yes Does Emacs use -ljpeg? yes Does Emacs use -ltiff? yes Does Emacs use a gif library? yes -lgif Does Emacs use -lpng? yes Does Emacs use -lrsvg-2? no Does Emacs use -lgpm? yes Does Emacs use -ldbus? yes Does Emacs use -lgconf? no Does Emacs use -lfreetype? yes Does Emacs use -lm17n-flt? no Does Emacs use -lotf? yes Does Emacs use -lxft? yes Does Emacs use toolkit scroll bars? yes When I'm scrolling within files of a common size (about 1000 lines) holding the up/down-keys, emacs almost hangs and produces about 50% CPU-load. I use the following plugins: ido linum tabbar auto-complete-config Starting emacs with -q fixes the problem, but then I don't have any plugins. I can't figure out, which part of my .emacs is responsible for this behaviour. Here's an excerpt of my .emacs-file: (require 'ido) (ido-mode 1) (require 'linum) (global-linum-mode 1) (require 'tabbar) (tabbar-mode 1) (tabbar-local-mode 0) (tabbar-mwheel-mode 0) (setq tabbar-buffer-groups-function (lambda () (list "All"))) (global-set-key [M-left] 'tabbar-backward) (global-set-key [M-right] 'tabbar-forward) ;; hide the toolbar (gtk etc.) (tool-bar-mode -1) ;; Mouse scrolling enhancements (setq mouse-wheel-progressive-speed nil) (setq mouse-wheel-scroll-amount '(5 ((shift) . 5) ((control) . nil))) ;; Smart-HOME (defun smart-beginning-of-line () "Forces the cursor to jump to the first none whitespace char of the current line when pressing HOME" (interactive) (let ((oldpos (point))) (back-to-indentation) (and (= oldpos (point)) (beginning-of-line)))) (put 'smart-beginning-of-line 'CUA 'move) (global-set-key [home] 'smart-beginning-of-line) (custom-set-variables ;; custom-set-variables was added by Custom. ;; If you edit it by hand, you could mess it up, so be careful. ;; Your init file should contain only one such instance. ;; If there is more than one, they won't work right. '(column-number-mode t) '(cua-mode t nil (cua-base)) '(custom-buffer-indent 4) '(delete-selection-mode nil) '(display-time-24hr-format t) '(display-time-day-and-date 1) '(display-time-mode t) '(global-font-lock-mode t nil (font-lock)) '(inhibit-startup-buffer-menu t) '(inhibit-startup-screen t) '(pc-select-meta-moves-sexps t) '(pc-select-selection-keys-only t) '(pc-selection-mode t nil (pc-select)) '(scroll-bar-mode (quote right)) '(show-paren-mode t) '(standard-indent 4) '(uniquify-buffer-name-style (quote forward) nil (uniquify))) (setq-default tab-width 4) (setq-default indent-tabs-mode t) (setq c-basic-offset 4) ;; Highlighting of the current line (global-hl-line-mode 1) (set-face-background 'hl-line "#E8F2FE") (defalias 'yes-or-no-p 'y-or-n-p) (display-time) (set-language-environment "Latin-1") ;; Change cursor color according to mode (setq djcb-read-only-color "gray") ;; valid values are t, nil, box, hollow, bar, (bar . WIDTH), hbar, ;; (hbar. HEIGHT); see the docs for set-cursor-type (setq djcb-read-only-cursor-type 'hbar) (setq djcb-overwrite-color "red") (setq djcb-overwrite-cursor-type 'box) (setq djcb-normal-color "black") (setq djcb-normal-cursor-type 'bar) (defun djcb-set-cursor-according-to-mode () "change cursor color and type according to some minor modes." (cond (buffer-read-only (set-cursor-color djcb-read-only-color) (setq cursor-type djcb-read-only-cursor-type)) (overwrite-mode (set-cursor-color djcb-overwrite-color) (setq cursor-type djcb-overwrite-cursor-type)) (t (set-cursor-color djcb-normal-color) (setq cursor-type djcb-normal-cursor-type)))) (add-hook 'post-command-hook 'djcb-set-cursor-according-to-mode) (define-key global-map '[C-right] 'forward-sexp) (define-key global-map '[C-left] 'backward-sexp) (define-key global-map '[s-left] 'windmove-left) (define-key global-map '[s-right] 'windmove-right) (define-key global-map '[s-up] 'windmove-up) (define-key global-map '[s-down] 'windmove-down) (define-key global-map '[S-down-mouse-1] 'mouse-stay-and-copy) (define-key global-map '[C-M-S-down-mouse-1] 'mouse-stay-and-swap) (define-key global-map '[S-mouse-2] 'mouse-yank-and-kill) (define-key global-map '[C-S-down-mouse-1] 'mouse-stay-and-kill) (define-key global-map "\C-a" 'mark-whole-buffer) (custom-set-faces ;; custom-set-faces was added by Custom. ;; If you edit it by hand, you could mess it up, so be careful. ;; Your init file should contain only one such instance. ;; If there is more than one, they won't work right. '(default ((t (:inherit nil :stipple nil :background "#f7f9fa" :foreground "#191919" :inverse-video nil :box nil :strike-through nil :overline nil :underline nil :slant normal :weight normal :height 98 :width normal :foundry "unknown" :family "DejaVu Sans Mono")))) '(font-lock-builtin-face ((((class color) (min-colors 88) (background light)) (:foreground "#642880" :weight bold)))) '(font-lock-comment-face ((((class color) (min-colors 88) (background light)) (:foreground "#3f7f5f")))) '(font-lock-constant-face ((((class color) (min-colors 88) (background light)) (:weight bold)))) '(font-lock-doc-face ((t (:inherit font-lock-string-face :foreground "#3f7f5f")))) '(font-lock-function-name-face ((((class color) (min-colors 88) (background light)) (:foreground "Black" :weight bold)))) '(font-lock-keyword-face ((((class color) (min-colors 88) (background light)) (:foreground "#7f0055" :weight bold)))) '(font-lock-preprocessor-face ((t (:inherit font-lock-builtin-face :foreground "#7f0055" :weight bold)))) '(font-lock-string-face ((((class color) (min-colors 88) (background light)) (:foreground "#0000c0")))) '(font-lock-type-face ((((class color) (min-colors 88) (background light)) (:foreground "#7f0055" :weight bold)))) '(font-lock-variable-name-face ((((class color) (min-colors 88) (background light)) (:foreground "Black")))) '(minibuffer-prompt ((t (:foreground "medium blue")))) '(mode-line ((t (:background "#222222" :foreground "White")))) '(tabbar-button ((t (:inherit tabbar-default :foreground "dark red")))) '(tabbar-button-highlight ((t (:inherit tabbar-default :background "white" :box (:line-width 2 :color "white"))))) '(tabbar-default ((t (:background "gray90" :foreground "gray50" :box (:line-width 3 :color "gray90") :height 100)))) '(tabbar-highlight ((t (:underline t)))) '(tabbar-selected ((t (:inherit tabbar-default :foreground "blue" :weight bold)))) '(tabbar-separator ((t nil))) '(tabbar-unselected ((t (:inherit tabbar-default))))) Any suggestions? Kind regards, mefiX

    Read the article

  • parseInt and viewflipper layout problems

    - by user1234167
    I have a problem with parseInt it throws the error: unable to parse 'null' as integer. My view flipper is also not working. Hopefully this is an easy enough question. Here is my activity: import javax.xml.parsers.SAXParser; import javax.xml.parsers.SAXParserFactory; import org.xml.sax.InputSource; import org.xml.sax.XMLReader; import android.app.Activity; import android.graphics.Color; import android.os.Bundle; import android.util.Log; import android.view.View; import android.view.View.OnClickListener; import android.widget.Button; import android.widget.LinearLayout; import android.widget.TextView; import android.widget.ViewFlipper; import xml.parser.dataset; public class XmlParserActivity extends Activity implements OnClickListener { private final String MY_DEBUG_TAG = "WeatherForcaster"; // private dataset myDataSet; private LinearLayout layout; private int temp= 0; /** Called when the activity is first created. */ //the ViewSwitcher private Button btn; private ViewFlipper flip; // private TextView tv; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); layout=(LinearLayout)findViewById(R.id.linearlayout1); btn=(Button)findViewById(R.id.btn); btn.setOnClickListener(this); flip=(ViewFlipper)findViewById(R.id.flip); //when a view is displayed flip.setInAnimation(this,android.R.anim.fade_in); //when a view disappears flip.setOutAnimation(this, android.R.anim.fade_out); // String postcode = null; // public String getPostcode { // return postcode; // } //URL newUrl = c; // myweather.setText(c.toString()); /* Create a new TextView to display the parsingresult later. */ TextView tv = new TextView(this); // run(0); //WeatherApplicationActivity postcode = new WeatherApplicationActivity(); try { /* Create a URL we want to load some xml-data from. */ URL url = new URL("http://new.myweather2.com/developer/forecast.ashx?uac=gcV3ynNdoV&output=xml&query=G41"); //String url = new String("http://new.myweather2.com/developer/forecast.ashx?uac=gcV3ynNdoV&output=xml&query="+WeatherApplicationActivity.postcode ); //URL url = new URL(url); //url.toString( ); //myString(url.toString() + WeatherApplicationActivity.getString(postcode)); // url + WeatherApplicationActivity.getString(postcode); /* Get a SAXParser from the SAXPArserFactory. */ SAXParserFactory spf = SAXParserFactory.newInstance(); SAXParser sp = spf.newSAXParser(); /* Get the XMLReader of the SAXParser we created. */ XMLReader xr = sp.getXMLReader(); /* Create a new ContentHandler and apply it to the XML-Reader*/ handler myHandler = new handler(); xr.setContentHandler(myHandler); /* Parse the xml-data from our URL. */ xr.parse(new InputSource(url.openStream())); /* Parsing has finished. */ /* Our ExampleHandler now provides the parsed data to us. */ dataset parsedDataSet = myHandler.getParsedData(); /* Set the result to be displayed in our GUI. */ tv.setText(parsedDataSet.toString()); } catch (Exception e) { /* Display any Error to the GUI. */ tv.setText("Error: " + e.getMessage()); Log.e(MY_DEBUG_TAG, "WeatherQueryError", e); } temp = Integer.parseInt(xml.parser.dataset.getTemp()); if(temp <0){ //layout.setBackgroundColor(Color.BLUE); //layout.setBackgroundColor(getResources().getColor(R.color.silver)); findViewById(R.id.flip).setBackgroundColor(Color.BLUE); } else if(temp > 0 && temp < 9) { //layout.setBackgroundColor(Color.GREEN); //layout.setBackgroundColor(getResources().getColor(R.color.silver)); findViewById(R.id.flip).setBackgroundColor(Color.GREEN); } else { //layout.setBackgroundColor(Color.YELLOW); //layout.setBackgroundColor(getResources().getColor(R.color.silver)); findViewById(R.id.flip).setBackgroundColor(Color.YELLOW); } /* Display the TextView. */ this.setContentView(tv); } @Override public void onClick(View arg0) { // TODO Auto-generated method stub onClick(View arg0) { // TODO Auto-generated method stub flip.showNext(); //specify flipping interval //flip.setFlipInterval(1000); //flip.startFlipping(); } } this is my dataset: package xml.parser; public class dataset { static String temp = null; // private int extractedInt = 0; public static String getTemp() { return temp; } public void setTemp(String temp) { this.temp = temp; } this is my handler: public void characters(char ch[], int start, int length) { if(this.in_temp){ String setTemp = new String(ch, start, length); // myParsedDataSet.setTempUnit(new String(ch, start, length)); // myParsedDataSet.setTemp; } the dataset and handler i only pasted the code that involves the temp as i no they r working when i take out the if statement. However even then my viewflipper wont work. This is my main xml: <?xml version="1.0" encoding="utf-8"?> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:orientation="vertical" android:layout_width="fill_parent" android:layout_height="fill_parent" android:id="@+id/linearlayout1" > <TextView android:layout_width="fill_parent" android:layout_height="wrap_content" android:textSize="25dip" android:text="Flip Example" /> <TextView android:layout_width="fill_parent" android:layout_height="wrap_content" android:textSize="25dip" android:id="@+id/tv" /> <Button android:layout_width="wrap_content" android:layout_height="wrap_content" android:textSize="25dip" android:text="Flip" android:id="@+id/btn" android:onClick="ClickHandler" /> <ViewFlipper android:layout_width="fill_parent" android:layout_height="fill_parent" android:id="@+id/flip"> <LinearLayout android:orientation="vertical" android:layout_width="fill_parent" android:layout_height="fill_parent" > <TextView android:layout_width="fill_parent" android:layout_height="wrap_content" android:textSize="25dip" android:text="Item1a" /> </LinearLayout> <TextView android:layout_width="fill_parent" android:layout_height="wrap_content" android:textSize="25dip" android:id="@+id/tv2" /> </ViewFlipper> </LinearLayout> this is my logcat: 04-01 18:02:24.744: E/AndroidRuntime(7331): FATAL EXCEPTION: main 04-01 18:02:24.744: E/AndroidRuntime(7331): java.lang.RuntimeException: Unable to start activity ComponentInfo{xml.parser/xml.parser.XmlParserActivity}: java.lang.NumberFormatException: unable to parse 'null' as integer 04-01 18:02:24.744: E/AndroidRuntime(7331): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1830) 04-01 18:02:24.744: E/AndroidRuntime(7331): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1851) 04-01 18:02:24.744: E/AndroidRuntime(7331): at android.app.ActivityThread.access$1500(ActivityThread.java:132) 04-01 18:02:24.744: E/AndroidRuntime(7331): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1038) 04-01 18:02:24.744: E/AndroidRuntime(7331): at android.os.Handler.dispatchMessage(Handler.java:99) 04-01 18:02:24.744: E/AndroidRuntime(7331): at android.os.Looper.loop(Looper.java:150) 04-01 18:02:24.744: E/AndroidRuntime(7331): at android.app.ActivityThread.main(ActivityThread.java:4293) 04-01 18:02:24.744: E/AndroidRuntime(7331): at java.lang.reflect.Method.invokeNative(Native Method) 04-01 18:02:24.744: E/AndroidRuntime(7331): at java.lang.reflect.Method.invoke(Method.java:507) 04-01 18:02:24.744: E/AndroidRuntime(7331): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:849) 04-01 18:02:24.744: E/AndroidRuntime(7331): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:607) 04-01 18:02:24.744: E/AndroidRuntime(7331): at dalvik.system.NativeStart.main(Native Method) 04-01 18:02:24.744: E/AndroidRuntime(7331): Caused by: java.lang.NumberFormatException: unable to parse 'null' as integer 04-01 18:02:24.744: E/AndroidRuntime(7331): at java.lang.Integer.parseInt(Integer.java:356) 04-01 18:02:24.744: E/AndroidRuntime(7331): at java.lang.Integer.parseInt(Integer.java:332) 04-01 18:02:24.744: E/AndroidRuntime(7331): at xml.parser.XmlParserActivity.onCreate(XmlParserActivity.java:118) 04-01 18:02:24.744: E/AndroidRuntime(7331): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1072) 04-01 18:02:24.744: E/AndroidRuntime(7331): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1794) I hope I have given enough information about my problems. I will be extremely grateful if anyone can help me out.

    Read the article

  • Grid overlayed on image using javascript, need help getting grid coordinates.

    - by Alos
    Hi I am fairly new to javascript and could use some help, I am trying to overlay a grid on top of an image and then be able to have the user click on the grid and get the grid coordinate from the box that the user clicked. I have been working with the code from the following stackoverflow question: Creating a grid overlay over image. link text Here is the code that I have so far: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> </script> <script type="text/javascript"> var SetGrid = function(el, sz, nr, nc){ //get number of rows/columns according to the 'grid' size //numcols = el.getSize().x/sz; //numrows = el.getSize().y/sz; numcols = 48; numrows = 32; //create table element for injecting cols/rows var gridTable = new Element('table', { 'id' : 'gridTable', 'styles' : { 'width' : el.getSize().x, 'height' : el.getSize().y, 'top' : el.getCoordinates().top, 'left' : el.getCoordinates().left } }); //inject rows/cols into gridTable for (row = 1; row<=numrows; row++){ thisRow = new Element('tr', { 'id' : row, 'class' : 'gridRow' }); for(col = 1; col<=numcols; col++){ thisCol = new Element('td', { 'id' : col, 'class' : 'gridCol0' }); //each cell gets down/up over event... down starts dragging|up stops|over draws area if down was fired thisCol.addEvents({ 'mousedown' : function(){ dragFlag = true; startRow = this.getParent().get('id'); startCol = this.get('id'); }, 'mouseup' : function(){ dragFlag = false; }, 'mouseover' : function(){ if (dragFlag==true){ this.set('class', 'gridCol'+$$('#lvlSelect .on').get('value')); } }, 'click' : function(){ //this.set('class', 'gridCol'+$$('#lvlSelect .on').get('id').substr(3, 1) ); str = $$('#lvlSelect .on').get('id'); alert(str.substr(2, 3)); } }); thisCol.inject(thisRow, 'bottom'); }; thisRow.inject(gridTable, 'bottom'); }; gridTable.inject(el.getParent()); } //sens level selector func var SetSensitivitySelector = function(el, sz, nr, nc){ $$('#lvlSelect ul li').each(function(el){ el.addEvents({ 'click' : function(){ $$('#lvlSelect ul li').set('class', ''); this.set('class', 'on'); }, 'mouseover' : function(){ el.setStyle('cursor','pointer'); }, 'mouseout' : function(){ el.setStyle('cursor',''); } }); }); } //execute window.addEvent('load', function(){ SetGrid($('imagetomap'), 32); SetSensitivitySelector(); }); var gridSize = { x: 48, y: 32 }; var img = document.getElementById('imagetomap'); img.onclick = function(e) { if (!e) e = window.event; alert(Math.floor(e.offsetX/ gridSize.x) + ', ' + Math.floor(e.offsetY / gridSize.y)); } </script> <style> #imagetomapdiv { float:left; display: block; } #gridTable { border:1px solid red; border-collapse:collapse; position:absolute; z-index:5; } #gridTable td { opacity:0.2; filter:alpha(opacity=20); } #gridTable .gridCol0 { border:1px solid gray; background-color: none; } #gridTable .gridCol1 { border:1px solid gray; background-color: green; } #gridTable .gridCol2 { border:1px solid gray; background-color: blue; } #gridTable .gridCol3 { border:1px solid gray; background-color: yellow; } #gridTable .gridCol4 { border:1px solid gray; background-color: orange; } #gridTable .gridCol5 { border:1px solid gray; background-color: red; } #lvlSelect ul {float: left; display:block; position:relative; margin-left: 20px; padding: 10px; } #lvlSelect ul li { width:40px; text-align:center; display:block; border:1px solid black; position:relative; padding: 10px; list-style:none; opacity:0.2; filter:alpha(opacity=20); } #lvlSelect ul li.on { opacity:1; filter:alpha(opacity=100); } #lvlSelect ul #li0 { background-color: none; } #lvlSelect ul #li1 { background-color: green; } #lvlSelect ul #li2 { background-color: blue; } #lvlSelect ul #li3 { background-color: yellow; } #lvlSelect ul #li4 { background-color: orange; } #lvlSelect ul #li5 { background-color: red; } </style> </div> <div id="lvlSelect"> <ul> <li value="0" id="li0">0</li> <li value="1" id="li1">1</li> <li value="2" id="li2">2</li> <li value="3" id="li3">3</li> <li value="4" id="li4">4</li> <li value="5" id="li5" class="on">5</li> </ul> </div> In this example the grid box changes color when the image is grid box is clicked, but I would like to be able to have the coordinates of the box. Any help would be great. Thank you

    Read the article

  • Creating a grid overlay over image.

    - by neteus
    Hi everybody, I made a script (using mootools library) that is supposed to overlay an image with a table grid and when each grid cell is clicked/dragged over its background color changes 'highlighting' the cell. Current code creates a table and positions it over the element (el, image in this case). Table was used since I am planning to add rectangle select tool later on, and it seemed easiest way to do it. <html> <head> <title></title> <script type="text/javascript" src="mootools.js"></script> <script type="text/javascript"> var SetGrid = function(el, sz, nr, nc){ //get number of rows/columns according to the 'grid' size numcols = el.getSize().x/sz; numrows = el.getSize().y/sz; //create table element for injecting cols/rows var gridTable = new Element('table', { 'id' : 'gridTable', 'styles' : { 'width' : el.getSize().x, 'height' : el.getSize().y, 'top' : el.getCoordinates().top, 'left' : el.getCoordinates().left } }); //inject rows/cols into gridTable for (row = 1; row<=numrows; row++){ thisRow = new Element('tr', { 'id' : row, 'class' : 'gridRow' }); for(col = 1; col<=numcols; col++){ thisCol = new Element('td', { 'id' : col, 'class' : 'gridCol0' }); //each cell gets down/up over event... down starts dragging|up stops|over draws area if down was fired thisCol.addEvents({ 'mousedown' : function(){ dragFlag = true; startRow = this.getParent().get('id'); startCol = this.get('id'); }, 'mouseup' : function(){ dragFlag = false; }, 'mouseover' : function(){ if (dragFlag==true){ this.set('class', 'gridCol'+$$('#lvlSelect .on').get('value')); } }, 'click' : function(){ //this.set('class', 'gridCol'+$$('#lvlSelect .on').get('id').substr(3, 1) ); str = $$('#lvlSelect .on').get('id'); alert(str.substr(2, 3)); } }); thisCol.inject(thisRow, 'bottom'); }; thisRow.inject(gridTable, 'bottom'); }; gridTable.inject(el.getParent()); } //sens level selector func var SetSensitivitySelector = function(el, sz, nr, nc){ $$('#lvlSelect ul li').each(function(el){ el.addEvents({ 'click' : function(){ $$('#lvlSelect ul li').set('class', ''); this.set('class', 'on'); }, 'mouseover' : function(){ el.setStyle('cursor','pointer'); }, 'mouseout' : function(){ el.setStyle('cursor',''); } }); }); } //execute window.addEvent('load', function(){ SetGrid($('imagetomap'), 32); SetSensitivitySelector(); }); </script> <style> #imagetomapdiv { float:left; display: block; } #gridTable { border:1px solid red; border-collapse:collapse; position:absolute; z-index:5; } #gridTable td { opacity:0.2; filter:alpha(opacity=20); } #gridTable .gridCol0 { border:1px solid gray; background-color: none; } #gridTable .gridCol1 { border:1px solid gray; background-color: green; } #gridTable .gridCol2 { border:1px solid gray; background-color: blue; } #gridTable .gridCol3 { border:1px solid gray; background-color: yellow; } #gridTable .gridCol4 { border:1px solid gray; background-color: orange; } #gridTable .gridCol5 { border:1px solid gray; background-color: red; } #lvlSelect ul {float: left; display:block; position:relative; margin-left: 20px; padding: 10px; } #lvlSelect ul li { width:40px; text-align:center; display:block; border:1px solid black; position:relative; padding: 10px; list-style:none; opacity:0.2; filter:alpha(opacity=20); } #lvlSelect ul li.on { opacity:1; filter:alpha(opacity=100); } #lvlSelect ul #li0 { background-color: none; } #lvlSelect ul #li1 { background-color: green; } #lvlSelect ul #li2 { background-color: blue; } #lvlSelect ul #li3 { background-color: yellow; } #lvlSelect ul #li4 { background-color: orange; } #lvlSelect ul #li5 { background-color: red; } </style> </head> <body> <div id="imagetomapdiv"> <img id="imagetomap" src="1.png"> </div> <div id="lvlSelect"> <ul> <li value="0" id="li0">0</li> <li value="1" id="li1">1</li> <li value="2" id="li2">2</li> <li value="3" id="li3">3</li> <li value="4" id="li4">4</li> <li value="5" id="li5" class="on">5</li> </ul> </div> </body> </html> A 'working' example: http://72.14.186.218/~alex/motion.php There are two problems: while it works just fine in FF, IE and Chrome do not create the table if the page is refreshed. If you go back to directory root and click on the link to the file the grid table is displayed, if you hit 'refresh' button -- the script runs but the table is not injected. Secondly, although the table HTML is injected in IE, it does not display it. I tried adding nbsp's to make sure its not ignored -- to no avail. Any suggestions on improving code or help with the issues is appreciated. Thanks!

    Read the article

  • Facebook like button not going back side on the fixed div

    - by Lahiru Chathuranga
    I added a Facebook like button to my website.My website has a fixed div on top of the page(blue color div in the image). The like button is below that(in a div which can scroll) My problem is when the page is scroll down the like button comes on top of the fixed div(blue color).I want to scroll it from the backside of the div.How can I do that? There are couple of screenshots I added Before Scroll After Scroll Here is my code of the fixed div <script type="text/javascript"> function got_to_signup(){ window.location.href = "view/policy"; } </script> <div id="fb-root"></div> <script>(function(d, s, id) { var js, fjs = d.getElementsByTagName(s)[0]; if (d.getElementById(id)) return; js = d.createElement(s); js.id = id; js.src = "//connect.facebook.net/en_GB/all.js#xfbml=1&appId=368003049941951"; fjs.parentNode.insertBefore(js, fjs); }(document, 'script', 'facebook-jssdk'));</script> <div style="width:100%;background-color:#0094d6;" > <div id="dd" style="background-color:#0094d6; width:100%; height:75px;position:fixed; " class="center "><div id="a" style="width:1010px; height:75px; background-color:#000000;background:url(xx.png); background-repeat:no-repeat; font-family:Arial, Helvetica, sans-serif; font-size:11px; color:#003; " class="inner div_border"> <table width="1010" border="0" > <tr > <td width="15%" rowspan="2"><a href="" style="cursor:pointer; cursor:hand;"><div style="width:200px; height:50px;background-color:none;"></div></a></td> <td width="22%" height="14">&nbsp;</td> <td width="5%">&nbsp;</td> <td width="5%">&nbsp;</td> <td width="28%">&nbsp;</td> <td width="2%">&nbsp;</td> <td width="23%">&nbsp;</td> </tr> <tr> <td colspan="4"> </td> <td colspan="2"><span style="float: right; " ><div style="background-color:#006d9e;border-radius:3px; width:250px; height:34px; display: table; vertical-align: middle; color:#FFF; "> <table width="100%" border="0" > <tr > <td width="43%" style="text-align:center"> Start to bump !</td> <td width="29%"><div id='basic-modal'><span style="float: right; " ><input name="login_btn" type="button" class="login_button basic" id="login_btn" value="Sign in" /></span></div></td> <td width="28%"><span style="float: right; " ><form id="form_reg" method="post"><input name="register_btn" type="button" class="register_button" id="register_btn" value="Sign up" onclick="got_to_signup()"/></form></span></td> </tr> </table> </div></span></td> </tr> <tr> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td style="color:#FFF; font:Arial, Helvetica, sans-serif; font-size:9px; text-align:right;"> Beta Version </td> </tr> </table> </div></div></div> here is my facebook like button code </script> <div id="fb-root"></div> <script>(function(d, s, id) { var js, fjs = d.getElementsByTagName(s)[0]; if (d.getElementById(id)) return; js = d.createElement(s); js.id = id; js.src = "//connect.facebook.net/en_GB/all.js#xfbml=1&appId=368003049941951"; fjs.parentNode.insertBefore(js, fjs); }(document, 'script', 'facebook-jssdk'));</script> <td height="21" colspan="2"> <table width="187" style="margin-left:3px;font-size:1px;background-image:url(share_back.png);background-repeat:no-repeat;border-radius:3px;" > <!--tweeter button--> <tr><td width="71"><a href="https://twitter.com/bump_lk" class="twitter-follow-button" data-show-count="false" style="float:right;">Follow @bump_lk</a> <script>!function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs");</script></td> <!--facebook like button--> <td width="48"><div class="fb-like" data-href="https://www.facebook.com/Bump.lk" data-send="false" data-layout="button_count" data-width="10" data-show-faces="false" style="position:relative;"></div> </td></tr></table></td> <td>&nbsp;</td> <td>&nbsp;</td> <td >

    Read the article

  • iOS bluetooth low energy not detecting peripherals

    - by user3712524
    My app won't detect peripherals. Im using light blue to simulate a bluetooth low energy peripheral and my app just won't sense it. I even installed light blue on two devices to make sure it was generating a peripheral signal properly and it is. Any suggestions? My labels are updating and the NSLog is showing that the scanning is starting. Thanks in advance. #import <UIKit/UIKit.h> #import <CoreBluetooth/CoreBluetooth.h> @interface ViewController : UIViewController @property (weak, nonatomic) IBOutlet UITextField *navDestination; @end #import "ViewController.h" @implementation ViewController - (IBAction)connect:(id)sender { } - (IBAction)navDestination:(id)sender { NSString *destinationText = self.navDestination.text; } - (void)viewDidLoad { } - (void)viewWillDisappear:(BOOL)animated { [super viewWillDisappear:animated]; } - (void)didReceiveMemoryWarning { [super didReceiveMemoryWarning]; // Dispose of any resources that can be recreated. } @end #import <UIKit/UIKit.h> #import "ViewController.h" @interface BlueToothViewController : UIViewController @property (strong, nonatomic) CBCentralManager *centralManager; @property (strong, nonatomic) CBPeripheral *discoveredPerepheral; @property (strong, nonatomic) NSMutableData *data; @property (strong, nonatomic) IBOutlet UITextView *textview; @property (weak, nonatomic) IBOutlet UILabel *charLabel; @property (weak, nonatomic) IBOutlet UILabel *isConnected; @property (weak, nonatomic) IBOutlet UILabel *myPeripherals; @property (weak, nonatomic) IBOutlet UILabel *aLabel; - (void)centralManagerDidUpdateState:(CBCentralManager *)central; - (void)centralManger:(CBCentralManager *)central didDiscoverPeripheral: (CBPeripheral *)peripheral advertisementData:(NSDictionary *)advertisementData RSSI:(NSNumber *)RSSI; -(void)centralManager:(CBCentralManager *)central didFailToConnectPeripheral:(CBPeripheral *)peripheral error:(NSError *)error; -(void)cleanup; -(void)centralManager:(CBCentralManager *)central didConnectPeripheral:(CBPeripheral *)peripheral; -(void)peripheral:(CBPeripheral *)peripheral didDiscoverServices:(NSError *)error; -(void)peripheral:(CBPeripheral *)peripheral didDiscoverCharacteristicsForService:(CBService *)service error:(NSError *)error; -(void)centralManager:(CBCentralManager *)central didDisconnectPeripheral:(CBPeripheral *)peripheral error:(NSError *)error; -(void)peripheral:(CBPeripheral *)peripheral didUpdateValueForCharacteristic:(CBCharacteristic *)characteristic error:(NSError *)error; -(void)peripheral:(CBPeripheral *)peripheral didUpdateNotificationStateForCharacteristic:(CBCharacteristic *)characteristic error:(NSError *)error; @end @interface BlueToothViewController () @end @implementation BlueToothViewController - (id)initWithNibName:(NSString *)nibNameOrNil bundle:(NSBundle *)nibBundleOrNil { self = [super initWithNibName:nibNameOrNil bundle:nibBundleOrNil]; if (self) { // Custom initialization } return self; } - (void)viewDidLoad { _centralManager = [[CBCentralManager alloc]initWithDelegate:self queue:nil options:nil]; _data = [[NSMutableData alloc]init]; } - (void)viewWillDisappear:(BOOL)animated { [super viewWillDisappear:animated]; [_centralManager stopScan]; } - (void)didReceiveMemoryWarning { [super didReceiveMemoryWarning]; // Dispose of any resources that can be recreated. } - (void)centralManagerDidUpdateState:(CBCentralManager *)central { //you should test all scenarios if (central.state == CBCentralManagerStateUnknown) { self.aLabel.text = @"I dont do anything because my state is unknown."; return; } if (central.state == CBCentralManagerStatePoweredOn) { //scan for devices [_centralManager scanForPeripheralsWithServices:nil options:@{ CBCentralManagerScanOptionAllowDuplicatesKey : @YES }]; NSLog(@"Scanning Started"); } if (central.state == CBCentralManagerStateResetting) { self.aLabel.text = @"I dont do anything because my state is resetting."; return; } if (central.state == CBCentralManagerStateUnsupported) { self.aLabel.text = @"I dont do anything because my state is unsupported."; return; } if (central.state == CBCentralManagerStateUnauthorized) { self.aLabel.text = @"I dont do anything because my state is unauthorized."; return; } if (central.state == CBCentralManagerStatePoweredOff) { self.aLabel.text = @"I dont do anything because my state is powered off."; return; } } - (void)centralManger:(CBCentralManager *)central didDiscoverPeripheral:(CBPeripheral *)peripheral advertisementData:(NSDictionary *)advertisementData RSSI:(NSNumber *)RSSI { NSLog(@"Discovered %@ at %@", peripheral.name, RSSI); self.myPeripherals.text = [NSString stringWithFormat:@"%@%@",peripheral.name, RSSI]; if (_discoveredPerepheral != peripheral) { //save a copy of the peripheral _discoveredPerepheral = peripheral; //and connect NSLog(@"Connecting to peripheral %@", peripheral); [_centralManager connectPeripheral:peripheral options:nil]; self.aLabel.text = [NSString stringWithFormat:@"%@", peripheral]; } } -(void)centralManager:(CBCentralManager *)central didFailToConnectPeripheral:(CBPeripheral *)peripheral error:(NSError *)error { NSLog(@"Failed to connect"); [self cleanup]; } -(void)cleanup { //see if we are subscribed to a characteristic on the peripheral if (_discoveredPerepheral.services != nil) { for (CBService *service in _discoveredPerepheral.services) { if (service.characteristics != nil) { for (CBCharacteristic *characteristic in service.characteristics) { if ([characteristic.UUID isEqual:[CBUUID UUIDWithString:@"508EFF8E-F541-57EF-BD82-B0B4EC504CA9"]]) { if (characteristic.isNotifying) { [_discoveredPerepheral setNotifyValue:NO forCharacteristic:characteristic]; return; } } } } } } [_centralManager cancelPeripheralConnection:_discoveredPerepheral]; } -(void)centralManager:(CBCentralManager *)central didConnectPeripheral:(CBPeripheral *)peripheral { NSLog(@"Connected"); [_centralManager stopScan]; NSLog(@"Scanning stopped"); self.isConnected.text = [NSString stringWithFormat:@"Connected"]; [_data setLength:0]; peripheral.delegate = self; [peripheral discoverServices:nil]; } -(void)peripheral:(CBPeripheral *)peripheral didDiscoverServices:(NSError *)error { if (error) { [self cleanup]; return; } for (CBService *service in peripheral.services) { [peripheral discoverCharacteristics:nil forService:service]; } //discover other characteristics } -(void)peripheral:(CBPeripheral *)peripheral didDiscoverCharacteristicsForService:(CBService *)service error:(NSError *)error { if (error) { [self cleanup]; return; } for (CBCharacteristic *characteristic in service.characteristics) { [peripheral setNotifyValue:YES forCharacteristic:characteristic]; } } -(void)peripheral:(CBPeripheral *)peripheral didUpdateValueForCharacteristic:(CBCharacteristic *)characteristic error:(NSError *)error { if (error) { NSLog(@"Error"); return; } NSString *stringFromData = [[NSString alloc]initWithData:characteristic.value encoding:NSUTF8StringEncoding]; self.charLabel.text = [NSString stringWithFormat:@"%@", stringFromData]; //Have we got everything we need? if ([stringFromData isEqualToString:@"EOM"]) { [_textview setText:[[NSString alloc]initWithData:self.data encoding:NSUTF8StringEncoding]]; [peripheral setNotifyValue:NO forCharacteristic:characteristic]; [_centralManager cancelPeripheralConnection:peripheral]; } } -(void)peripheral:(CBPeripheral *)peripheral didUpdateNotificationStateForCharacteristic:(CBCharacteristic *)characteristic error:(NSError *)error { if ([characteristic.UUID isEqual:nil]) { return; } if (characteristic.isNotifying) { NSLog(@"Notification began on %@", characteristic); } else { [_centralManager cancelPeripheralConnection:peripheral]; } } -(void)centralManager:(CBCentralManager *)central didDisconnectPeripheral:(CBPeripheral *)peripheral error:(NSError *)error { _discoveredPerepheral = nil; self.isConnected.text = [NSString stringWithFormat:@"Connecting..."]; [_centralManager scanForPeripheralsWithServices:nil options:@{ CBCentralManagerScanOptionAllowDuplicatesKey : @YES}]; } @end

    Read the article

  • Post data to MVC3 controller without pagerefresh

    - by Smooth
    I have this script that basically has 4 select boxes, what I want is that for the 2 top select boxes, he submits the optionvalue that is selected to an action (which can be found at "ProductKoppeling/ProductKoppelingPartial"), I want to let him submit this data when I click on an option but without page refresh. I tried JSON and I tried Ajax, but I didn't get it working.. How should i do this? <script language="javascript" type="text/javascript"> function delete_1() { var answer = confirm("U staat op het punt dit product te verwijderen, wilt u doorgaan?") if (answer) { document.getElementById('Actie_1').value = '5'; document.getElementById('hpg_submit').submit(); } } function delete_2() { var answer = confirm("U staat op het punt dit product te verwijderen, wilt u doorgaan?") if (answer) { document.getElementById('Actie_2').value = '6'; document.getElementById('pg_submit').submit(); } } function delete_3() { var answer = confirm("U staat op het punt dit product te verwijderen, wilt u doorgaan?") if (answer) { document.getElementById('Actie_3').value = '6'; document.getElementById('p_submit').submit(); } } </script> <div style="width: 500px; float: left;"> @using (Html.BeginForm("ProductKoppelingPartial", "ProductKoppeling", FormMethod.Post, new { id = "onload_submit" })) { @Html.DropDownList("Klant.Id", (ViewBag.Klant as SelectList), new { onchange = "document.getElementById('onload_submit').submit()" }) } <div style="clear: both"></div> <div style="float: left;"> <b>Hoofdgroepen</b><br /> @using (Html.BeginForm("ProductKoppelingPartial", "ProductKoppeling", FormMethod.Post, new { id = "hpg_submit" })) { if (ViewBag.SelectedKlant != null) { <input type="hidden" name="Klant.Id" value="@ViewBag.SelectedKlant.Id" /> } <select style="width: 200px;" size="6" id="HoofdProductGroep" name="HoofdProductGroep.Id" onchange="document.getElementById('hpg_submit').submit();"> @foreach (var hpg in ViewBag.HoofdProductGroep) { if (ViewBag.SelectedHPG != null) { if (hpg.Id == ViewBag.SelectedHPG.Id) { <option value="@hpg.Id" selected="selected">@hpg.Naam</option> } else { <option value="@hpg.Id">@hpg.Naam</option> } } else { <option value="@hpg.Id">@hpg.Naam</option> } } </select> <input type="hidden" name="Actie" id="Actie_1" value="0" /> <br /> <img src="../../Content/toevoegen.png" style="cursor: pointer; width: 30px;" onclick="document.getElementById('Actie_1').value='1';document.getElementById('hpg_submit').submit();" /> <img src="../../Content/bewerken.png" style="cursor: pointer; float: none; width: 30px;" onclick="document.getElementById('Actie_1').value='2';document.getElementById('hpg_submit').submit();" /> <img src="../../Content/verwijderen.png" style="cursor: pointer; float: none; width: 30px;" onclick="delete_1()" /> } </div> <div style="float: right;"> <b>Groepen</b><br /> @using (Html.BeginForm("ProductKoppelingPartial", "ProductKoppeling", FormMethod.Post, new { id = "pg_submit" })) { if (ViewBag.SelectedHPG != null) { <input type="hidden" name="HoofdProductGroep.Id" value="@ViewBag.SelectedHPG.Id" /> } if (ViewBag.SelectedKlant != null) { <input type="hidden" name="Klant.Id" value="@ViewBag.SelectedKlant.Id" /> } <select size="6" style="width: 200px;" id="ProductGroep_Id" name="ProductGroep.Id" onchange="document.getElementById('pg_submit').submit();"> @foreach (var pg in ViewBag.ProductGroep) { if (ViewBag.SelectedPG != null) { if (pg.Id == ViewBag.SelectedPG.Id) { <option value="@pg.Id" selected="selected">@pg.Naam</option> } else { <option value="@pg.Id">@pg.Naam</option> } } else { <option value="@pg.Id">@pg.Naam</option> } } </select> <input type="hidden" name="Actie" id="Actie_2" value="0" /> <br /> <img src="../../Content/toevoegen.png" style="cursor: pointer; width: 30px;" onclick="document.getElementById('Actie_2').value='3';document.getElementById('pg_submit').submit();" /> <img src="../../Content/bewerken.png" style="cursor: pointer; float: none; width: 30px;" onclick="document.getElementById('Actie_2').value='4';document.getElementById('pg_submit').submit();" /> <img src="../../Content/verwijderen.png" style="cursor: pointer; float: none; width: 30px;" onclick="delete_2()" /> } </div> <div style="clear: both; height: 25px;"></div> @using (Html.BeginForm("Save", "ProductKoppeling", FormMethod.Post, new { id = "p_submit" })) { <div style="float: left"> <b>Producten</b><br /> <select size="18" style="width: 200px;" name="Product.Id"> @foreach (var p in ViewBag.Product) { <option value="@p.Id">@p.Naam</option> } </select> @if (ViewBag.SelectedPG != null) { if (ViewBag.SelectedPG.Id != null) { <input type="hidden" name="ProductGroep.Id" value="@ViewBag.SelectedPG.Id" /> } } <input type="hidden" name="Actie" id="Actie_3" value="0" /> <br /> <img src="../../Content/toevoegen.png" style="cursor: pointer; width: 30px;" onclick="document.getElementById('Actie_3').value='1';document.getElementById('p_submit').submit();" /> <img src="../../Content/bewerken.png" style="cursor: pointer; float: none; width: 30px;" onclick="document.getElementById('Actie_3').value='2';document.getElementById('p_submit').submit();" /> <img src="../../Content/verwijderen.png" style="cursor: pointer; float: none; width: 30px;" onclick="delete_3()" /> <br /> </div> <div style="float: left; width: 100px;"> <center> <br /><br /><br /><br /> <a style="cursor: pointer; float: none; color: blue; font-size: 30px;" onclick="document.getElementById('p_submit').submit();">»</a> <br /><br /><br /><br /><br /><br /><br /><br /><br /> <a style="cursor: pointer; float: none; color: blue; font-size: 30px;" onclick="document.getElementById('pgp_submit').submit();">«</a> </center> </div> } <div style="float: right;"> <b>Producten in groepen</b><br /> @using (Html.BeginForm("Delete", "ProductKoppeling", FormMethod.Post, new { id = "pgp_submit" })) { <select size="18" style="width: 200px;" name="ProductGroepProduct.Id"> @foreach (var pgp in ViewBag.ProductGroepProduct) { if (pgp != null) { if (pgp.Product != null) { <option value="@pgp.Id">@pgp.Product.Naam</option> } } } </select> } </div>

    Read the article

  • Unknown Space between 2 Container Divs

    - by Paul
    Im trying to determine why there would be space between 2 Containing Divs as shown, and I would appreciate any insight as to why this is occurring: The unknown space occurs between the mid-feature div (olive) and bottom-wrap div (orange) I have no heights set anywhere. I would like to see the orange div up against the olive div just above it. I can post all of the CSS, or you can FireBug this: www.davincispainting.com Here is all of the CSS: *{ margin:0; padding:0 } body { /*background: url("/images/blueback5.jpg") repeat-x scroll 0 0 transparent;*/ background-color: #9EB0C8; font-family: Arial,Helvetica,sans-serif; font-size: 62.5%; } #top-wrap { height: 126px; width: 940px; /*background-color: Yellow;*/ margin: 5px 0 0 0; } #head-logo { background: url("/images/logo3.png") no-repeat scroll 0 0 transparent; /*background-color: Green;*/ height: 126px; width: 214px; margin: 0px 0 0 58px; position: absolute; z-index: 100; } #submenu1 { border: 0 solid #000000; color: #FFFFFF; /*background-color:Green;*/ font-family: Arial,Impact,Impact5,Charcoal6,sans-serif; font-size: 1.6em; height: 35px; width: 155px; /*padding: 10px 0 0;*/ margin: 7px 0 0 774px; position: absolute; } #submenu2 { /*border: 0 solid #000000;*/ color: #FFFFFF; /*background-color:Blue;*/ font-family: Arial,Impact,Impact5,Charcoal6,sans-serif; font-size: 1.8em; text-align: right; height: 20px; width: 114px; margin: 30px 0 0 818px; /*padding: 5px 0 0;*/ } a.contact { background-image: url("/images/RapidButton2.png"); /*border: 1px solid #CCCCCC;*/ /*clear: both;*/ /*color: #FFFFFF;*/ display: block; font-size: 11px; /*margin-bottom: 1px;*/ /*padding: 3px 5px;*/ text-align: center; width: 165px; height: 27px; } a.contact:hover { background-image: url("/images/RapidButtonHov2.png"); } #navigation-primary { margin: 12px 0 0 276px; position: absolute; } #global-wrap { margin: 0 auto; text-align: left; width: 880px; overflow: hidden; } #global-inner { background: url("/images/main_bg.gif") repeat-y scroll 0 0 #E4EAEF; font-family: Arial; font-size: 1.2em; margin: 15px 0 55px 0; overflow: hidden; text-align: left; width: 880px; } #global-inner .topleft { background: url("/images/main_left_top_corner2.jpg") no-repeat scroll left top transparent; float: left; height: 9px; width: 9px; } #global-inner .topright { background: url("/images/main_right_top_corner2.jpg") no-repeat scroll right top transparent; float: right; height: 9px; width: 9px; } #global-inner .bottomleft { background: url("/images/main_left_bottom_corner.jpg") no-repeat scroll left bottom transparent; float: left; height: 9px; margin-top: -8px; /*margin: 776px 0 0 0;*/ width: 9px; } #global-inner .bottomright { background: url("/images/main_right_bottom_corner.jpg") no-repeat scroll right bottom transparent; float: right; height: 9px; margin-top: -8px; /*margin: 776px 0 0 0;*/ width: 9px; } #top-feature { height:330px; width: 848px; margin: 12px 0 0 16px; background: #E4EAEF; /*background: orange;*/ /*padding: 10px 0 0 10px;*/ position: absolute; text-align: left; } .slideshow { height: 330px; width: 848px; margin: 0 0 0 0; /*background: blue;*/ position: absolute; } #mid-feature { margin:350px 0 0 16px; width:848px; height:318px; background-color:Olive; position:relative; overflow:hidden; } #mid-featureleft { height:318px; width:552px; /*background-color:Purple;*/ float:left; position:relative; } #mid-featureright { height:318px; width:296px; background-color:#B9C1CC; /*background-color: red;*/ float:left; position: relative; } #mid-featureleft h1 { color: #FF0000; font-family: Arial,Helvetica,sans-serif; font-size: 2.1em; } #mid-featureleft .contentbox { padding:7px 7px 7px 7px; } #mid-featureleft p { color: #0C2A55; margin:0px 0 11px 0px; /*font-style:normal;*/ /*width: 97%;*/ /*font-size: .5em;*/ font-size: 12px; } #bottom-wrap { height:60px; width: 868px; margin: auto 0 0 6px; background:orange; position: relative; } #copyright { float: left; /*background-color:Teal;*/ width: 260px; height: 60px; text-align: left; position: absolute; margin:0 0 0 6px; } #bottom-logos { height:60px; width:596px; margin:0 0 0 267px; background: url("/images/logos2.png") no-repeat scroll 0 0 transparent; /*background-color:red;*/ position:absolute; }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Edit Text in a Webpage with Internet Explorer 8

    - by Matthew Guay
    Internet Explorer is often decried as the worst browser for web developers, but IE8 actually offers a very nice set of developer tools.  Here we’ll look at a unique way to use them to edit the text on any webpage. How to edit text in a webpage IE8’s developer tools make it easy to make changes to a webpage and view them directly.  Simply browse to the webpage of your choice, and press the F12 key on your keyboard.  Alternately, you can click the Tools button, and select Developer tools from the list. This opens the developer tools.  To do our editing, we want to select the mouse button on the toolbar “Select Element by Click” tool. Now, click on any spot of the webpage in IE8 that you want to edit.  Here, let’s edit the footer of Google.com.  Notice it places a blue box around any element you hover over to make it easy to choose exactly what you want to edit. In the developer tools window, the element you selected before is now highlighted.  Click the plus button beside that entry if the text you want to edit is not visible.   Now, click the text you wish to change, and enter what you wish in the box.  For fun, we changed the copyright to say “©2010 Microsoft”. Go back to IE to see the changes on the page! You can also change a link on a page this way: Or you can even change the text on a button: Here’s our edited Google.com: This may be fun for playing a trick on someone or simply for a funny screenshot, but it can be very useful, too.  You could test how changes in fontsize would change how a website looks, or see how a button would look with a different label.  It can also be useful when taking screenshots.  For instance, if I want to show a friend how to do something in Gmail but don’t want to reveal my email address, I could edit the text on the top right before I took the screenshot.  Here I changed my Gmail address to [email protected]. Please note that the changes will disappear when you reload the page.  You can save your changes from the developer tools window, though, and reopen the page from your computer if you wish. We have found this trick very helpful at times, and it can be very fun too!  Enjoy it, and let us know how you used it to help you! Similar Articles Productive Geek Tips Edit Webpage Text Areas in Your Favorite Text EditorRemove Webpage Formatting or View the HTML Code When Copying in FirefoxChange the Default Editor From Nano on Ubuntu LinuxShare Text & Images the Easy Way with JustPaste.itEditPad Lite – All Purpose Tabbed Text Editor TouchFreeze Alternative in AutoHotkey The Icy Undertow Desktop Windows Home Server – Backup to LAN The Clear & Clean Desktop Use This Bookmarklet to Easily Get Albums Use AutoHotkey to Assign a Hotkey to a Specific Window Latest Software Reviews Tinyhacker Random Tips Revo Uninstaller Pro Registry Mechanic 9 for Windows PC Tools Internet Security Suite 2010 PCmover Professional Enable Check Box Selection in Windows 7 OnlineOCR – Free OCR Service Betting on the Blind Side, a Vanity Fair article 30 Minimal Logo Designs that Say More with Less LEGO Digital Designer – Free Create a Personal Website Quickly using Flavors.me

    Read the article

  • Edit Text in a Webpage with Internet Explorer 8

    - by Matthew Guay
    Internet Explorer is often decried as the worst browser for web developers, but IE8 actually offers a very nice set of developer tools.  Here we’ll look at a unique way to use them to edit the text on any webpage. How to edit text in a webpage IE8’s developer tools make it easy to make changes to a webpage and view them directly.  Simply browse to the webpage of your choice, and press the F12 key on your keyboard.  Alternately, you can click the Tools button, and select Developer tools from the list. This opens the developer tools.  To do our editing, we want to select the mouse button on the toolbar “Select Element by Click” tool. Now, click on any spot of the webpage in IE8 that you want to edit.  Here, let’s edit the footer of Google.com.  Notice it places a blue box around any element you hover over to make it easy to choose exactly what you want to edit. In the developer tools window, the element you selected before is now highlighted.  Click the plus button beside that entry if the text you want to edit is not visible.   Now, click the text you wish to change, and enter what you wish in the box.  For fun, we changed the copyright to say “©2010 Microsoft”. Go back to IE to see the changes on the page! You can also change a link on a page this way: Or you can even change the text on a button: Here’s our edited Google.com: This may be fun for playing a trick on someone or simply for a funny screenshot, but it can be very useful, too.  You could test how changes in fontsize would change how a website looks, or see how a button would look with a different label.  It can also be useful when taking screenshots.  For instance, if I want to show a friend how to do something in Gmail but don’t want to reveal my email address, I could edit the text on the top right before I took the screenshot.  Here I changed my Gmail address to [email protected]. Please note that the changes will disappear when you reload the page.  You can save your changes from the developer tools window, though, and reopen the page from your computer if you wish. We have found this trick very helpful at times, and it can be very fun too!  Enjoy it, and let us know how you used it to help you! Similar Articles Productive Geek Tips Edit Webpage Text Areas in Your Favorite Text EditorRemove Webpage Formatting or View the HTML Code When Copying in FirefoxChange the Default Editor From Nano on Ubuntu LinuxShare Text & Images the Easy Way with JustPaste.itEditPad Lite – All Purpose Tabbed Text Editor TouchFreeze Alternative in AutoHotkey The Icy Undertow Desktop Windows Home Server – Backup to LAN The Clear & Clean Desktop Use This Bookmarklet to Easily Get Albums Use AutoHotkey to Assign a Hotkey to a Specific Window Latest Software Reviews Tinyhacker Random Tips Revo Uninstaller Pro Registry Mechanic 9 for Windows PC Tools Internet Security Suite 2010 PCmover Professional Enable Check Box Selection in Windows 7 OnlineOCR – Free OCR Service Betting on the Blind Side, a Vanity Fair article 30 Minimal Logo Designs that Say More with Less LEGO Digital Designer – Free Create a Personal Website Quickly using Flavors.me

    Read the article

  • Inspire Geek Love with These Hilarious Geek Valentines

    - by Eric Z Goodnight
    Want to send some Geek Love to that special someone? Why not do it with these elementary school throwback valentines, and win their heart this upcoming Valentine’s day—the geek way! Read on to see the simple method to make your own custom Valentines, as well as download a set of eleven ready-made ones any geek guy or gal should be delighted get. It’s amore! How to Make Custom Valentines A size we’ve used for all of our Valentines is a 3” x 4” at 150 dpi. This is fairly low resolution for print, but makes a great graphic to email. With your new image open, Navigate to Edit > Fill and fill your background layer with a rich, red color (or whatever appeals to you.) By setting “Use” to “Foreground color as shown above, you’ll paint whatever foreground color you have in your color picker. Press to select the text tool. Set a few text objects, using whatever fonts appeal to you. Pixel fonts, like this one, are freely downloadable, and we’ve already shared a great list of Valentines fonts. Copy an image from the internet if you’re confident your sweetie won’t mind a bit of fair use of copyrighted imagery. If they do mind, find yourself some great Creative Commons images. to do a free transform on your image, sizing it to whatever dimensions work best for your design. Right click your newly added image layer in your panel and Choose “Blending Effects” to pick a Layer Style. “Stroke” with this setting adds a black line around your image. Also turning on “Outer Glow” with this setting puts a dark black shadow around the top and bottom (and sides, although they are hidden). Add some more text. Double entendre is recommended. Click and hold down on the “Rectangle Tool” to get the “Custom Shape Tool.” The custom shape tool has useful vector shapes built into it. Find the “Shape” dropdown in the menu to find the heart image. Click and drag to create a vector heart shape in your image. Your layers panel is where you can change the color, if it happens to use the wrong one at first. Click the color swatch in your panel, highlighted in blue above. will transform your vector heart. You can also use it to rotate, if you like. Add some details, like this Power or Standby symbol, which can be found in symbol fonts, taken from images online, or drawn by hand. Your Valentine is now ready to be saved as a JPG or PNG and sent to the object of your affection! Keep reading to see a list of 11 downloadable How-To Geek Valentines, including this one and the three from the header image. Download The HTG Set of Valentines Download the HTG Geek Valentines (ZIP) Download the HTG Geek Valentines (ZIP) When he’s not wooing ladies with Valentines cards, you can email the author at [email protected] with your Photoshop and Graphics questions. Your questions may be featured in a future How-To Geek article! Latest Features How-To Geek ETC Inspire Geek Love with These Hilarious Geek Valentines How to Integrate Dropbox with Pages, Keynote, and Numbers on iPad RGB? CMYK? Alpha? What Are Image Channels and What Do They Mean? How to Recover that Photo, Picture or File You Deleted Accidentally How To Colorize Black and White Vintage Photographs in Photoshop How To Get SSH Command-Line Access to Windows 7 Using Cygwin How to Kid Proof Your Computer’s Power and Reset Buttons Microsoft’s Windows Media Player Extension Adds H.264 Support Back to Google Chrome Android Notifier Pushes Android Notices to Your Desktop Dead Space 2 Theme for Chrome and Iron Carl Sagan and Halo Reach Mashup – We Humans are Capable of Greatness [Video] Battle the Necromorphs Once Again on Your Desktop with the Dead Space 2 Theme for Windows 7

    Read the article

  • Smart Help with UPK

    - by [email protected]
    A short lesson on how awesome Smart Help is. In Oracle UPK speak, there are targeted and non-targeted applications. Targeted applications are Oracle EBS, PeopleSoft, Siebel, JD Edwards, SAP and a few others. Non-targeted applications are either custom built or other third party off the shelf applications. For most targeted applications you'll see better object recognition (during recording) and also Help Integration for that application. Help integration means that someone technical modifies the help link in your application to call up the UPK content that has been created. If you have seen this presented before, this is usually where the term context sensitive help is mentioned and the Do It mode shows off. The fact that UPK builds context sensitive help for its targeted applications automatically is awesome enough, but there is a whole new world out there and it's called "custom and\or third party apps." For the purposes of Smart Help and this discussion, I'm talking about the browser based applications. How does UPK support these apps? It used to be that you had to have your vendor try to modify the Help link to point to UPK or if your company had control over the applications configuration menus, then you get someone on your team to modify this for you. But as you start to use UPK for more than one, two or three applications, the administration of this starts to become daunting. Multiple administrators, multiple player packages, multiple call points, multiple break points, help doesn't always work the same way for every application (picture the black white infomercial with an IT person trying to configure a bunch of wires or something funny like that). Introducing Smart Help! (in color of course, new IT person, probably wearing a blue shirt and smiling). Smart help eliminates the need to configure multiple browser help integration points, and adds a icon to the users browser itself. You're using your browser to read this now correct? Look up at the icons on your browser, you have the home link icon, print icon, maybe an RSS feed icon. Smart Help is icon that gets added to the users browser just like the others. When you click it, it first recognizes which application you're in and then finds the UPK created material for you and returns the best possible match, for (hold on to your seat now) both targeted and non-targeted applications (browser based applications). But wait, there's more. It does this automatically! You don't have to do anything! All you have to do is record content, UPK and Smart Help do the rest! This technology is not new. There are customers out there today that use this for as many as six applications! The real hero here is SMART MATCH. Smart match is the technology that's used to determine which application you're in and where you are when you click on Smart Help. We'll save that for a one-on-one conversation. Like most other awesome features of UPK, it ships with the product. All you have to do is turn it on. To learn more about Smart Help, Smart Match, Targeted and Non-Targeted applications, contact your UPK Sales Consultant or me directly at [email protected]

    Read the article

  • You should NOT be writing jQuery in SharePoint if&hellip;

    - by Mark Rackley
    Yes… another one of these posts. What can I say? I’m a pot stirrer.. a rabble rouser *rabble rabble* jQuery in SharePoint seems to be a fairly polarizing issue with one side thinking it is the most awesome thing since Princess Leia as the slave girl in Return of the Jedi and the other half thinking it is the worst idea since Mannequin 2: On the Move. The correct answer is OF COURSE “it depends”. But what are those deciding factors that make jQuery an awesome fit or leave a bad taste in your mouth? Let’s see if I can drive the discussion here with some polarizing comments of my own… I know some of you are getting ready to leave your comments even now before reading the rest of the blog, which is great! Iron sharpens iron… These discussions hopefully open us up to understanding the entire process better and think about things in a different way. You should not be writing jQuery in SharePoint if you are not a developer… Let’s start off with my most polarizing and rant filled portion of the blog post. If you don’t know what you are doing or you don’t have a background that helps you understand the implications of what you are writing then you should not be writing jQuery in SharePoint! I truly believe that one of the biggest reasons for the jQuery haters is because of all the bad jQuery out there. If you don’t know what you are doing you can do some NASTY things! One of the best stories I’ve heard about this is from my good friend John Ferringer (@ferringer). John tells this story during our Mythbusters session we do together. One of his clients was undergoing a Denial of Service attack and they couldn’t figure out what was going on! After much searching they found that some genius jQuery developer wrote some code for an image rotator, but did not take into account what happens when there are no images to load! The code just kept hitting the servers over and over and over again which prevented anything else from getting done! Now, I’m NOT saying that I have not done the same sort of thing in the past or am immune from such mistakes. My point is that if you don’t know what you are doing, there are very REAL consequences that can have a major impact on your organization AND they will be hard to track down.  Think how happy your boss will be after you copy and pasted some jQuery from a blog without understanding what it does, it brings down the farm, AND it takes them 3 days to track it back to you.  :/ Good times will not be had. Like it or not JavaScript/jQuery is a programming language. While you .NET people sit on your high horses because your code is compiled and “runs faster” (also debatable), the rest of us will be actually getting work done and delivering solutions while you are trying to figure out why your widget won’t deploy. I can pick at that scab because I write .NET code too and speak from experience. I can do both, and do both well. So, I am not speaking from ignorance here. In JavaScript/jQuery you have variables, loops, conditionals, functions, arrays, events, and built in methods. If you are not a developer you just aren’t going to take advantage of all of that and use it correctly. Ahhh.. but there is hope! There is a lot of jQuery resources out there to help you learn and learn well! There are many experts on the subject that will gladly tell you when you are smoking crack. I just this minute saw a tweet from @cquick with a link to: “jQuery Fundamentals”. I just glanced through it and this may be a great primer for you aspiring jQuery devs. Take advantage of all the resources and become a developer! Hey, it will look awesome on your resume right? You should not be writing jQuery in SharePoint if it depends too much on client resources for a good user experience I’ve said it once and I’ll say it over and over until you understand. jQuery is executed on the client’s computer. Got it? If you are looping through hundreds of rows of data, searching through an enormous DOM, or performing many calculations it is going to take some time! AND if your user happens to be sitting on some old PC somewhere that they picked up at a garage sale their experience will be that much worse! If you can’t give the user a good experience they will not use the site. So, if jQuery is causing the user to have a bad experience, don’t use it. I sometimes go as far to say that you should NOT go to jQuery as a first option for external facing web sites because you have ZERO control over what the end user’s computer will be. You just can’t guarantee an awesome user experience all of the time. Ahhh… but you have no choice? (where have I heard that before?). Well… if you really have no choice, here are some tips to help improve the experience: Avoid screen scraping This is not 1999 and SharePoint is not an old green screen from a mainframe… so why are you treating it like it is? Screen scraping is time consuming and client intensive. Take advantage of tools like SPServices to do your data retrieval when possible. Fine tune your DOM searches A lot of time can be eaten up just searching the DOM and ignoring table rows that you don’t need. Write better jQuery to only loop through tables rows that you need, or only access specific elements you need. Take advantage of Element ID’s to return the one element you are looking for instead of looping through all the DOM over and over again. Write better jQuery Remember this is development. Think about how you can write cleaner, faster jQuery. This directly relates to the previous point of improving your DOM searches, but also when using arrays, variables and loops. Do you REALLY need to loop through that array 3 times? How can you knock it down to 2 times or even 1? When you have lots of calculations and data that you are manipulating every operation adds up. Think about how you can streamline it. Back in the old days before RAM was abundant, Cores were plentiful and dinosaurs roamed the earth, us developers had to take performance into account in everything we did. It’s a lost art that really needs to be used here. You should not be writing jQuery in SharePoint if you are sending a lot of data over the wire… Developer:  “Awesome… you can easily call SharePoint’s web services to retrieve and write data using SPServices!” Administrator: “Crap! you can easily call SharePoint’s web services to retrieve and write data using SPServices!” SPServices may indeed be the best thing that happened to SharePoint since the invention of SharePoint Saturdays by Godfather Lotter… BUT you HAVE to use it wisely! (I REFUSE to make the Spiderman reference). If you do not know what you are doing your code will bring back EVERY field and EVERY row from a list and push that over the internet with all that lovely XML wrapped around it. That can be a HUGE amount of data and will GREATLY impact performance! Calling several web service methods at the same time can cause the same problem and can negatively impact your SharePoint servers. These problems, thankfully, are not difficult to rectify if you are careful: Limit list data retrieved Use CAML to reduce the number of rows returned and limit the fields returned using ViewFields.  You should definitely be doing this regardless. If you aren’t I hope your admin thumps you upside the head. Batch large list updates You may or may not have noticed that if you try to do large updates (hundreds of rows) that the performance is either completely abysmal or it fails over half the time. You can greatly improve performance and avoid timeouts by breaking up your updates into several smaller updates. I don’t know if there is a magic number for best performance, it really depends on how much data you are sending back more than the number of rows. However, I have found that 200 rows generally works well.  Play around and find the right number for your situation. Delay Web Service calls when possible One of the cool things about jQuery and SPServices is that you can delay queries to the server until they are actually needed instead of doing them all at once. This can lead to performance improvements over DataViewWebParts and even .NET code in the right situations. So, don’t load the data until it’s needed. In some instances you may not need to retrieve the data at all, so why retrieve it ALL the time? You should not be writing jQuery in SharePoint if there is a better solution… jQuery is NOT the silver bullet in SharePoint, it is not the answer to every question, it is just another tool in the developers toolkit. I urge all developers to know what options exist out there and choose the right one! Sometimes it will be jQuery, sometimes it will be .NET,  sometimes it will be XSL, and sometimes it will be some other choice… So, when is there a better solution to jQuery? When you can’t get away from performance problems Sometimes jQuery will just give you horrible performance regardless of what you do because of unavoidable obstacles. In these situations you are going to have to figure out an alternative. Can I do it with a DVWP or do I have to crack open Visual Studio? When you need to do something that jQuery can’t do There are lots of things you can’t do in jQuery like elevate privileges, event handlers, workflows, or interact with back end systems that have no web service interface. It just can’t do everything. When it can be done faster and more efficiently another way Why are you spending time to write jQuery to do a DataViewWebPart that would take 5 minutes? Or why are you trying to implement complicated logic that would be simple to do in .NET? If your answer is that you don’t have the option, okay. BUT if you do have the option don’t reinvent the wheel! Take advantage of the other tools. The answer is not always jQuery… sorry… the kool-aid tastes good, but sweet tea is pretty awesome too. You should not be using jQuery in SharePoint if you are a moron… Let’s finish up the blog on a high note… Yes.. it’s true, I sometimes type things just to get a reaction… guess this section title might be a good example, but it feels good sometimes just to type the words that a lot of us think… So.. don’t be that guy! Another good buddy of mine that works for Microsoft told me. “I loved jQuery in SharePoint…. until I had to support it.”. He went on to explain that some user was making several web service calls on a page using jQuery and then was calling Microsoft and COMPLAINING because the page took so long to load… DUH! What do you expect to happen when you are pushing that much data over the wire and are making that many web service calls at once!! It’s one thing to write that kind of code and accept it’s just going to take a while, it’s COMPLETELY another issue to do that and then complain when it’s not lightning fast!  Someone’s gene pool needs some chlorine. So, I think this is a nice summary of the blog… DON’T be that guy… don’t be a moron. How can you stop yourself from being a moron? Ah.. glad you asked, here are some tips: Think Is jQuery the right solution to my problem? Is there a better approach? What are the implications and pitfalls of using jQuery in this situation? Search What are others doing? Does someone have a better solution? Is there a third party library that does the same thing I need? Plan Write good jQuery. Limit calculations and data sent over the wire and don’t reinvent the wheel when possible. Test Okay, it works well on your machine. Try it on others ESPECIALLY if this is for an external site. Test with empty data. Test with hundreds of rows of data. Test as many scenarios as possible. Monitor those server resources to see the impact there as well. Ask the experts As smart as you are, there are people smarter than you. Even the experts talk to each other to make sure they aren't doing something stupid. And for the MOST part they are pretty nice guys. Marc Anderson and Christophe Humbert are two guys who regularly keep me in line. Make sure you aren’t doing something stupid. Repeat So, when you think you have the best solution possible, repeat the steps above just to be safe.  Conclusion jQuery is an awesome tool and has come in handy on many occasions. I’m even teaching a 1/2 day SharePoint & jQuery workshop at the upcoming SPTechCon in Boston if you want to berate me in person. However, it’s only as awesome as the developer behind the keyboard. It IS development and has its pitfalls. Knowledge and experience are invaluable to giving the user the best experience possible.  Let’s face it, in the end, no matter our opinions, prejudices, or ego providing our clients, customers, and users with the best solution possible is what counts. Period… end of sentence…

    Read the article

  • Make Your Mouse Pointers Left-hand Friendly

    - by Matthew Guay
    It’s a right-centric world, with everything from pencils to computer mice expecting you to be right-handed.  Here’s how you can train your mouse and cursors in Windows 7 and Vista to respect your left-handedness. Using your Left Hand the Right Way It’s easy to switch your mouse to left-handed mode.  Enter “mouse” in your Start menu search, and select the first entry. Check the “Switch primary and secondary buttons” box to make your mouse more left-hand friendly.  Now your primary select button is your right button, and the secondary button (commonly referred to as right-click) is the left button. But, it can still be awkward to select items on screen with your left hand using the default cursors.  MSDN has a free set of cursors designed for left-handed users, that can fix this problem for you.  These cursors are exactly like the default Aero cursors in Windows 7 and Vista, except they are reversed to make them better for left-handed use. The cursors are available in 3 sizes: normal, large, and extra large.  The normal ones are the same size as the default ones in Windows 7; feel free to choose the other sizes if you prefer them.  Click each link to download all 6 cursors for your size (link below). Click “I Agree” after selecting the cursors to accept the license agreement and download them. Once you have all 6 cursors downloaded, select the Pointers tab in the Mouse Properties dialog.  Click the cursor to change, and then click Browse to select the new cursor. Browse to the folder you downloaded your new cursors to, select the correct cursor, and click Open. Do this for each of the 6 cursors to be changed.  Strangely, the Busy cursor (the spinning blue orb) is a static cursor, so you may not wish to change it.  All the other ones look and act like their standard counterparts. Here’s the cursors to be changed, and their equivalents in the default cursors: Normal Select: aero_arrow_left.cur Help Select: aero_helpsel_left.cur Working in Background: aero_working_left.ani Busy: aero_busy_left.cur Handwriting: aero_pen_left.cur Link Select: aero_link_left.cur After changing all the cursors, click Save As… to save this mouse scheme so you can easily select it in the future.  Finally click Ok to close the Mouse Properties dialog and accept the changes. Now your pointers will be easier to use left-handed! Conclusion Whether you’re right-handed or left-handed, you can enjoy the Aero cursors in Windows 7 or Vista in the way that works best for you.  Unfortunately, many mice are still designed for right-handed people, but this trick will help you make the best out of your mouse. We included all of the 6 cursors for you in a zip file you can download Here. This will make it easier for you to get them all together without having to download them individually. Link Download Left-Handed Mouse Pointers from MSDN Similar Articles Productive Geek Tips Prevent Themes From Modifying Icons and Cursors in Windows 7How To Personalize Windows 7 StarterShow Two Time Zones in Your Outlook 2007 CalendarMake Mouse Navigation Faster in WindowsWhy Doesn’t Tab Work for Drop-down Controls in Firefox on OS X? TouchFreeze Alternative in AutoHotkey The Icy Undertow Desktop Windows Home Server – Backup to LAN The Clear & Clean Desktop Use This Bookmarklet to Easily Get Albums Use AutoHotkey to Assign a Hotkey to a Specific Window Latest Software Reviews Tinyhacker Random Tips DVDFab 6 Revo Uninstaller Pro Registry Mechanic 9 for Windows PC Tools Internet Security Suite 2010 Microsoft’s “How Do I ?” Videos Home Networks – How do they look like & the problems they cause Check Your IMAP Mail Offline In Thunderbird Follow Finder Finds You Twitter Users To Follow Combine MP3 Files Easily QuicklyCode Provides Cheatsheets & Other Programming Stuff

    Read the article

  • Best way to Draw a cube for 3D Picking

    - by Kenneth Bray
    Currently I am drawing a cube for a game that I am making and the cube draw method is below. My question is, what is the best way to draw a cube and to be able to easily find the face that the cursor is over? My draw method works just fine, but I am getting ready to start to add picking (this will be used to mold the cubes into other shaps), and would like to know the best way to find a face of the cube. public void Draw() { // center point posX, posY, posZ float radius = size / 2; //top glPushMatrix(); glBegin(GL_QUADS); { glColor3f(1.0f,0.0f,0.0f); // red glVertex3f(posX + radius, posY + radius, posZ - radius); glVertex3f(posX - radius, posY + radius, posZ - radius); glVertex3f(posX - radius, posY + radius, posZ + radius); glVertex3f(posX + radius, posY + radius, posZ + radius); } glEnd(); glPopMatrix(); //bottom glPushMatrix(); glBegin(GL_QUADS); { glColor3f(1.0f,1.0f,0.0f); // ?? color glVertex3f(posX + radius, posY - radius, posZ + radius); glVertex3f(posX - radius, posY - radius, posZ + radius); glVertex3f(posX - radius, posY - radius, posZ - radius); glVertex3f(posX + radius, posY - radius, posZ - radius); } glEnd(); glPopMatrix(); //right side glPushMatrix(); glBegin(GL_QUADS); { glColor3f(1.0f,0.0f,1.0f); // ?? color glVertex3f(posX + radius, posY + radius, posZ + radius); glVertex3f(posX + radius, posY - radius, posZ + radius); glVertex3f(posX + radius, posY - radius, posZ - radius); glVertex3f(posX + radius, posY + radius, posZ - radius); } glEnd(); glPopMatrix(); //left side glPushMatrix(); glBegin(GL_QUADS); { glColor3f(0.0f,1.0f,1.0f); // ?? color glVertex3f(posX - radius, posY + radius, posZ - radius); glVertex3f(posX - radius, posY - radius, posZ - radius); glVertex3f(posX - radius, posY - radius, posZ + radius); glVertex3f(posX - radius, posY + radius, posZ + radius); } glEnd(); glPopMatrix(); //front side glPushMatrix(); glBegin(GL_QUADS); { glColor3f(0.0f,0.0f,1.0f); // blue glVertex3f(posX + radius, posY + radius, posZ + radius); glVertex3f(posX - radius, posY + radius, posZ + radius); glVertex3f(posX - radius, posY - radius, posZ + radius); glVertex3f(posX + radius, posY - radius, posZ + radius); } glEnd(); glPopMatrix(); //back side glPushMatrix(); glBegin(GL_QUADS); { glColor3f(0.0f,1.0f,0.0f); // green glVertex3f(posX + radius, posY - radius, posZ - radius); glVertex3f(posX - radius, posY - radius, posZ - radius); glVertex3f(posX - radius, posY + radius, posZ - radius); glVertex3f(posX + radius, posY + radius, posZ - radius); } glEnd(); glPopMatrix(); }

    Read the article

  • Kanban Tools Review

    - by GeekAgilistMercenary
    The first two sessions on Sunday were Collaboration and why it is so hard and the following, which was a perfect following session was on Kanban.  While in that second session two online Saas Style Tools were mentioned; AgileZen and Leankit.  I decided right then and there that I would throw together some first impressions and setup some sample projects.  I did this by setting up an account and creating the projects. Agile Zen Account Creation Setting up the initial account required an e-mail verification, which is understandable.  Within a few seconds it was mailed out and I was logged in. Setting Up the Kanban Board The initial setup of the board was pretty easy.  I maybe clicked around an extra few times, but overall everything I needed to use the tool was immediately available.  The representation of everything was very similar to what one expects in a real Kanban Board too.  This is a HUGE plus, especially if a team is smart and places this tool in a centrally viewable area to allow for visibility. Each of the board items is just like a post it, being blue, grey, green, pink, or one of another few colors.  Dragging them onto each swim lane on the board was flawless, making changes through the work super easy and intuitive. The other thing I really liked about AgileZen is that the Kanban Board had the swim lanes setup immediately.  One can change them, but when you know you immediately need a Ready Lane, Working Lane, and a Complete Lane it is nice to just have them right in front of you in the interface.  In addition, the Backlog is simply a little tab on the left hand side.  This is perfect for the Backlog Queue.  Out of the way, with the focus on the primary items. Once  I got the items onto the board I was easily able to get back to the actual work at hand versus playing around with the tool.  The fact that it was so easy to use, fast and easy UX, and overall a great layout put me back to work on things I needed to do versus sitting a playing with the tool.  That, in the end is the key to using these tools. LeanKit Kanban Account Creation Setting up the account got me straight into the online tool.  This I thought was pretty cool. Setting Up the Kanban Board Setting up the Kanban Board within Leankit was a bit of trouble.  There were multiple UX issues in regard to process and intuitiveness.  The Leankit basically forces one to design the whole board first, making no assumptions about how the board should look.  The swim lanes in my humble opinion should be setup immediately without any manipulation with the most common lanes;  ready, working, and complete. The other UX hiccup that I had a problem with is that as soon as I managed to get the swim lanes into place, I wanted to remove the redundant Backlog Lane.  The Backlog Lane, or Backlog Bucket should be somewhere that I accidentally added as a lane.  Then on top of that I screwed up and added an item inside the lane, which then prevented me from deleting the lane.  I had to go back out of the lane manipulation, remove the item, and then remove the excess lane.  Summary Leankit wasn't a bad interface, it just wasn't as good as AgileZen.  The AgileZen interface was just better UX design overall.  AgileZen also presents a much better user interface graphical design all together.  It is much closer to what the Kanban Board would look like if it were a physical Kanban Board.  Since one of the HUGE reasons for Kanban is to increase visibility, the fact the design is similar to what a real Kanban Board is actually a pretty big deal. This is an image (click for larger) that shows the two Kanban Boards side by side.  The one on the left is AgileZen and the right is Leankit. Original Entry

    Read the article

  • Logging WebSocket Frames using Chrome Developer Tools, Net-internals and Wireshark (TOTD #184)

    - by arungupta
    TOTD #183 explained how to build a WebSocket-driven application using GlassFish 4. This Tip Of The Day (TOTD) will explain how do view/debug on-the-wire messages, or frames as they are called in WebSocket parlance, over this upgraded connection. This blog will use the application built in TOTD #183. First of all, make sure you are using a browser that supports WebSocket. If you recall from TOTD #183 then WebSocket is combination of Protocol and JavaScript API. A browser supporting WebSocket, or not, means they understand your web pages with the WebSocket JavaScript. caniuse.com/websockets provide a current status of WebSocket support in different browsers. Most of the major browsers such as Chrome, Firefox, Safari already support WebSocket for the past few versions. As of this writing, IE still does not support WebSocket however its planned for a future release. Viewing WebSocket farmes require special settings because all the communication happens over an upgraded HTTP connection over a single TCP connection. If you are building your application using Java, then there are two common ways to debug WebSocket messages today. Other language libraries provide different mechanisms to log the messages. Lets get started! Chrome Developer Tools provide information about the initial handshake only. This can be viewed in the Network tab and selecting the endpoint hosting the WebSocket endpoint. You can also click on "WebSockets" on the bottom-right to show only the WebSocket endpoints. Click on "Frames" in the right panel to view the actual frames being exchanged between the client and server. The frames are not refreshed when new messages are sent or received. You need to refresh the panel by clicking on the endpoint again. To see more detailed information about the WebSocket frames, you need to type "chrome://net-internals" in a new tab. Click on "Sockets" in the left navigation bar and then on "View live sockets" to see the page. Select the box with the address to your WebSocket endpoint and see some basic information about connection and bytes exchanged between the client and the endpoint. Clicking on the blue text "source dependency ..." shows more details about the handshake. If you are interested in viewing the exact payload of WebSocket messages then you need a network sniffer. These tools are used to snoop network traffic and provide a lot more details about the raw messages exchanged over the network. However because they provide lot more information so they need to be configured in order to view the relevant information. Wireshark (nee Ethereal) is a pretty standard tool for sniffing network traffic and will be used here. For this blog purpose, we'll assume that the WebSocket endpoint is hosted on the local machine. These tools do allow to sniff traffic across the network though. Wireshark is quite a comprehensive tool and we'll capture traffic on the loopback address. Start wireshark, select "loopback" and click on "Start". By default, all traffic information on the loopback address is displayed. That includes tons of TCP protocol messages, applications running on your local machines (like GlassFish or Dropbox on mine), and many others. Specify "http" as the filter in the top-left. Invoke the application built in TOTD #183 and click on "Say Hello" button once. The output in wireshark looks like Here is a description of the messages exchanged: Message #4: Initial HTTP request of the JSP page Message #6: Response returning the JSP page Message #16: HTTP Upgrade request Message #18: Upgrade request accepted Message #20: Request favicon Message #22: Responding with favicon not found Message #24: Browser making a WebSocket request to the endpoint Message #26: WebSocket endpoint responding back You can also use Fiddler to debug your WebSocket messages. How are you viewing your WebSocket messages ? Here are some references for you: JSR 356: Java API for WebSocket - Specification (Early Draft) and Implementation (already integrated in GlassFish 4 promoted builds) TOTD #183 - Getting Started with WebSocket in GlassFish Subsequent blogs will discuss the following topics (not necessary in that order) ... Binary data as payload Custom payloads using encoder/decoder Error handling Interface-driven WebSocket endpoint Java client API Client and Server configuration Security Subprotocols Extensions Other topics from the API

    Read the article

  • Friday Fun: Spell Blazer

    - by Asian Angel
    Are you ready for some fun and adventure after a long week back at work? This week’s game combines jewel-matching style game play with an RPG story for an awesome mix of fun and fiction. Your goal is to help a young wizard reach the magic academy in Raven as the forces of darkness are building. Spell Blazer The object of the game is to help young Kaven reach the Lightcaster Academy in Raven alive, but he will encounter many dangers along the way. Are you ready to begin the quest? As soon as you click Start Game the intro will automatically begin. If this is your first time playing the game the intro provides a nice background story for the game and what is happening in the game environment. Once you are past the intro, you will see a map of the region with your starting point in the Farmlands, various towns and the roads connecting them, along with your final destination of Raven. Notice that some of the roads are different colors…those colors indicate the “danger levels” for each part of your journey (green = good, yellow = some danger, etc.). To begin your journey click on the Town of Goose with your mouse. You will encounter your first monster part of the way towards Goose. This first round takes you through the game play process step-by-step. Once you have clicked Okay you will see the details about the monster you have just encountered. It is very important that you do not click on Fight! or Flee! until viewing and noting the types of spells that the monster is resistant to or has a weakness against. Choose your spells wisely based on the information provided about the monster. Keep in mind that the healing spell can be very useful depending on the monster you meet and your current health status. Note: Spells shown in order here are Healing, Fireball, Icebolt, & Lightning. Ready to fight! The first battle will also explain how to fight…click Okay to get started. Once the main window is in full view there are details that you need to look at. Beneath each of the combatants you will see the three attacks that each brings to the battle and at the bottom you will see their respective health points. We got lucky and had an Icebolt attack that we could utilize on the first play! Note: You can exchange two squares without making a match in order to try and line up an attack. While it happened too quickly to capture in our screenshot, there will be cool lightning bolt effects shoot out from matched up squares to the opposite combatant. You will also see the amount of damage inflicted from a particular attack on top of the avatars. Victory! Once you have won a round of combat a window will appear showing the amount of gold coins left behind by the monster. When you reach a town you will have the opportunity to stop over and rest or directly continue on with your journey. On to Halgard after a good rest! Play Spell Blazer Latest Features How-To Geek ETC How To Boot 10 Different Live CDs From 1 USB Flash Drive The 20 Best How-To Geek Linux Articles of 2010 The 50 Best How-To Geek Windows Articles of 2010 The 20 Best How-To Geek Explainer Topics for 2010 How to Disable Caps Lock Key in Windows 7 or Vista How to Use the Avira Rescue CD to Clean Your Infected PC The Deep – Awesome Use of Metal Objects as Deep Sea Creatures [Video] Convert or View Documents Online Easily with Zoho, No Account Required Build a Floor Scrubbing Robot out of Computer Fans and a Frisbee Serene Blue Windows Wallpaper for Your Desktop 2011 International Space Station Calendar Available for Download (Free) Ultimate Elimination – Lego Black Ops [Video]

    Read the article

  • Java Developer Days India Trip Report

    - by reza_rahman
    You are probably aware of Oracle's decision to discontinue the relatively resource intensive regional JavaOnes in favor of more Java Developer Days, virtual events and deeper involvement with independent conferences. In comparison to the regional JavaOnes, Java Developer Days are smaller, shorter (typically one full day), more focused (mostly Oracle speakers/topics) and more local (targeting cities). For those who have been around the Java ecosystem for a few years, they are basically the current incarnation of the highly popular and developer centric Sun Tech Days. October 21st through October 25th I spoke at Java Developer Days India. This was basically three separate but identical events in the cities of Pune (October 21st), Chennai (October 24th) and Bangalore (October 25th). For those with some familiarity with India, other than Hyderabad these cities are India's IT powerhouses. The events were basically focused on Java EE. I delivered five of the sessions (yes, you read that right), while my friend NetBeans Group Product Manager Ashwin Rao delivered three talks. Jagadish Ramu from the GlassFish team India helped me out in Bangalore by delivering two sessions. It was also a pleasure to introduce my co-contributor to the Cargo Tracker Java EE Blue Prints project Vijay Nair at Bangalore during the opening talk. I thought it was a great dynamic between Ashwin and I flipping between talking about the new features and demoing live code in NetBeans. The following were my sessions (source PDF and abstracts posted as usual on my SlideShare account): JavaEE.Next(): Java EE 7, 8, and Beyond Building Java HTML5/WebSocket Applications with JSR 356 What’s New in Java Message Service 2 JAX-RS 2: New and Noteworthy in the RESTful Web Services API Using NoSQL with JPA, EclipseLink and Java EE The event went well and was packed in all three cities. The Q&A was great and Indian developers were particularly generous with kind words :-). It seemed the event and our presence was appreciated in the truest sense which I must say is a rarity. The events were exhausting but very rewarding at the same time. As hectic as the three city trip was I tried to see at least some of the major sights (mostly at night) since this was my very first time to India. I think the slideshow below is a good representation of the riddle wrapped up in an enigma that is India (and the rest of the Indian sub-continent for that matter): Ironically enough what struck me the most during this trip is the woman pictured below - Shushma. My chauffeur, tour guide and friend for a day, she fluidly navigated the madness that is Mumbai traffic with skills that would make Evel Knievel blush while simultaneously pointing out sights and prompting me to take pictures (Mumbai was my stopover and gateway to/from India). In some ways she is probably the most potent symbol of the new India. When we parted ways I told her she should take solace in the fact she has won mostly without a fight a potentially hazardous battle her sisters across the Arabian sea are still fighting. I'm not sure she entirely understood the significance of what I told her. I hope that she did. I also had occasion to take a pretty cool local bus ride from Chennai to Bangalore instead of yet another boring flight. All in all I really enjoyed the trip to India and hope to return again soon. Jai Hind :-)!

    Read the article

< Previous Page | 80 81 82 83 84 85 86 87 88 89 90 91  | Next Page >