Search Results

Search found 60513 results on 2421 pages for 'parse com'.

Page 87/2421 | < Previous Page | 83 84 85 86 87 88 89 90 91 92 93 94  | Next Page >

  • Parse filename from full path using regular expressions in C#

    - by WindyCityEagle
    How do I pull out the filename from a full path using regular expressions in C#? Say I have the full path C:\CoolDirectory\CoolSubdirectory\CoolFile.txt. How do I get out CoolFile.txt using the .NET flavor of regular expressions? I'm not really good with regular expressions, and my RegEx buddy and me couldn't figure this one out. Also, in the course of trying to solve this problem, I realized that I can just use System.IO.Path.GetFileName, but the fact that I couldn't figure out the regular expression is just making me unhappy and it's going to bother me until I know what the answer is.

    Read the article

  • XamlReader.Parse throws exception on empty String

    - by sub-jp
    In our app, we need to save properties of objects to the same database table regardless of the type of object, in the form of propertyName, propertyValue, propertyType. We decided to use XamlWriter to save all of the given object's properties. We then use XamlReader to load up the XAML that was created, and turn it back into the value for the property. This works fine for the most part, except for empty strings. The XamlWriter will save an empty string as below. <String xmlns="clr-namespace:System;assembly=mscorlib" xml:space="preserve" /> The XamlReader sees this string and tries to create a string, but can't find an empty constructor in the String object to use, so it throws a ParserException. The only workaround that I can think of is to not actually save the property if it is an empty string. Then, as I load up the properties, I can check for which ones did not exist, which means they would have been empty strings. Is there some workaround for this, or is there even a better way of doing this?

    Read the article

  • jQuery: How to parse a multidemensional array?

    - by Allen G
    I'm not sure if the array is too deep or what, but I can't seem to get anything other than the keys and undefines. Help please! I'm using Codeigniter for development. Here is the PHP then the jQuery: $term = $this->input->post('search_term'); $this->db->like('book_title', $term); $search_query = $this->db->get('books'); $return = array(); $i = 0; if ($search_query->num_rows() > 1) { foreach($search_query->result() as $s) { $return['books']['book_id'] = $s->book_id; $return['books']['book_title'] = $s->book_title; $return['books']['book_price'] = $s->book_price; $i++; } } elseif ($search_query->num_rows() == 1) { echo 1; $i = 0; $return['book_id'] = $search_query->row('book_id'); $return['book_title'] = $search_query->row('book_title'); $return['book_price'] = $search_query->row('book_price'); } elseif ($search_query->num_rows() == 0) { echo 0; } echo json_encode($return); $("#search").change(function() { var searchTerm = $(this).val(); $.post("/contentcreator/search_by_term", { search_term: searchTerm }, function(data) { $("#book_scroller").empty(); var lengthHolder = data.books; for (var i = 0; i data.books.length; i++) { var row = '<li id="book_item_' + l + '">' + data.books['book_title'] +'</li>'; $("#book_scroller").append(row); }; i++; }, "json"); }); Thanks!

    Read the article

  • How could I parse this HTML file?

    - by Sergio Tapia
    <div id="main"> <style type="text/css"> </style> <script language="JavaScript"> </script> <p style="margin: 0pt 0pt 0.5em;"><b>Media from&nbsp;<a onclick="(new Image()).src='/rg/find-media-title/media_strip/images/b.gif?link=/title/tt0087538/';" href="/title/tt0087538/">The Karate Kid</a> (1984)</b></p> <style type="text/css"> </style> <table style="border-collapse: collapse;"> </table> </div> I need to somehow extract the href value of the (new Image()). How exactly would I accomplish this with HtmlAgilityPack? I'm new to it, and so far I haven't found a useful tutorial on how to effectively use it for parsing. Thanks for the help!

    Read the article

  • Jquery-ajax parse xml and set radiobutton

    - by haltman
    hi everybody, I've a form with some radio button like this: <input type="radio" name="leva" value="a"><input type="radio" name="leva" value="b"> with ajax post method I receive value of the radio. The question is how can I set correct radio value to checked? thanks in advance ciao h.

    Read the article

  • Angularjs: addition of integers even after I parse the variable as integer

    - by Shiv Kumar
    I really have a weird problem in adding two numbers. Here is my code, in the first controller everything is working fine, but in the second controller instead of 0 if I add 10, the output is completely weird Here is html code <div ng-app=""> <div ng-controller="Controller1"> <br/>**** Controller-1 <br/>Add 0 : {{update1(0)}} <br/>Add 10 : {{update1(10)}} <br/>Add 50 : {{update1(50)}} <br/>Add -60 : {{update1(-60)}}</div> <div ng-controller="Controller2"> <br/>**** Controller-2 <br/>Add 10 : {{update2(10)}} <br/>Add 10 : {{update2(10)}} <br/>Add 50 : {{update2(50)}} <br/>Add -60 : {{update2(-60)}}</div> </div> Here is my javascript function Controller1($scope) { var x = 0; $scope.update1 = function (smValue) { x += parseInt(smValue); return x; } } function Controller2($scope) { var y = 0; $scope.update2 = function (smValue) { y += parseInt(smValue); return y; } } and here is the output **** Controller-1 Add 0 : 0 Add 10 : 10 Add 50 : 60 Add -60 : 0 **** Controller-2 Add 0 : 110 Add 10 : 120 Add 50 : 170 Add -60 : 110 here is the link to try: http://jsfiddle.net/6VqqN/ can anyone please explain me why it is behaving like that. Even if I add a 3or4 digit number, output is completely different then what I expected.

    Read the article

  • Parse Nested XML tags with the same name

    - by footose
    Let's take a simple XML document: <x> <e> <e> <e>Whatever 1</e> </e> </e> <e> <e> <e>Whatever 2</e> </e> </e> <e> <e> <e>Whatever 3</e> </e> </e> </x> Using the standard org.w3c.dom, I can get the nodes in X by doing.. NodeList fullnodelist = doc.getElementsByTagName("x"); But if I want to return the next set of "e" I try to use something like .. Element element = (Element) fullnodelist.item(0); NodeList nodes = pelement.getElementsByTagName("e"); Expecting it to return "3" nodes (because there are 3 sets of "e"), but instead, it returns "9" - becuase it gets all entries with "e" apperently. This would be fine in the above case, because I could probably iterate through and find what I'm looking for. The problem I'm having is that when the XML file looks like the following: <x> <e> <pattern>whatever</pattern> <blanks> <e>Something Else</e> </blanks> </e> <e> <pattern>whatever</pattern> <blanks> <e>Something Else</e> </blanks> </e> </x> When I request the "e" value, it returns 4, instead of (what i expect) 2. Am I just not understanding how the DOM parsing works? Typically in the past I have used my own XML documents so I would never name the items like this, but unfortunately this is not my XML file and I have no choice to work like this. What I thought I would do is write a loop that "drills down" nodes so that I could group each node together... public static NodeList getNodeList(Element pelement, String find) { String[] nodesfind = Utilities.Split(find, "/"); NodeList nodeList = null; for (int i = 0 ; i <= nodesfind.length - 1; i++ ) { nodeList = pelement.getElementsByTagName( nodesfind[i] ); pelement = (Element)nodeList.item(i); } // value of the nod we are looking for return nodeList; } .. So that if you passed "s/e" into the function, it would return the 2 nodes that I'm looking for (or elements, maybe I'm using the terminology incorrect?). instead it returns all of the "e" nodes within that node. I'm using J2SE for this, so options are rather limited. I can't use any third party XML Parsers. Anyway, if anyone is still with me and has a suggestion, it would be appreciated.

    Read the article

  • org.hibernate.HibernateException: Error while accessing enum.values(): class com.mksoft.fbautomate.d

    - by Misha Koshelev
    This error is driving me nuts!!! Caused by: java.lang.NoSuchMethodException: com.mksoft.fbautomate.domain.Account$Type.values() The same exact class works fine in a separate Groovy file. Any ideas/help much appreciated. Most confusing... http://java.sun.com/j2se/1.5.0/docs/api/java/lang/Enum.html has no values() method! Here is my class: @Entity class Account { @Id @GeneratedValue(strategy=GenerationType.AUTO) public Long id enum Type {MYVALUE} @Enumerated(EnumType.STRING) public Type type public String email // @org.hibernate.annotations.Type(type="encryptedString") public String pass public String fullName String toString() { "type:\""+type+"\",email:\""+email+"\""+",fullName=\""+fullName+"\"" } } Thank you! Misha

    Read the article

  • Using NSXMLParser to parse Vimeo XML on iPhone.

    - by Sonny Fazio
    Hello, I'm working on an iPhone app that will use Vimeo Simple API to give me a listing our videos by a certain user, in a convenient TableView format. I'm new to Parsing XML and have tried TouchXML, TinyXML, and now NSXMLParser with no luck. Most tutorials on parsing XML are for a blog, and not for an API XML sheet. I've tried modifying the blog parsers to search for the specific tags, but it doesn't seem to work. Right now I'm working with NSXMLParser and it seems to correctly find the value of an XML tag, but when it goes to append it to a NSMutableString, it writes a whole bunch of nulls in between it. I'm using a tutorial from theappleblog and modifying it to work with Vimeo API - (void)parser:(NSXMLParser *)parser foundCharacters:(NSString *)string{ if ([currentElement isEqualToString:@"video_title"]) { NSLog(@"String: %@",string); [currentTitle appendString:string]; } else if ([currentElement isEqualToString:@"video_url"]) { [currentLink appendString:string]; } else if ([currentElement isEqualToString:@"video_description"]) { [currentSummary appendString:string]; } else if ([currentElement isEqualToString:@"date"]) { [currentDate appendString:string]; } Here is the nulls it writes: http://grab.by/grabs/92d9cfc2df4fac3fe6579493b1a8e89f.png Then when it finishes, it has to add the NSMutableStrings into a NSMutableDictionary - (void)parser:(NSXMLParser *)parser didStartElement:(NSString *)elementName namespaceURI:(NSString *)namespaceURI qualifiedName:(NSString *)qName attributes:(NSDictionary *)attributeDict{ //NSLog(@"found this element: %@", elementName); currentElement = [elementName copy]; if ([elementName isEqualToString:@"item"]) { // clear out our story item caches... item = [[NSMutableDictionary alloc] init]; currentTitle = [[NSMutableString alloc] init]; currentDate = [[NSMutableString alloc] init]; currentSummary = [[NSMutableString alloc] init]; currentLink = [[NSMutableString alloc] init]; } } - (void)parser:(NSXMLParser *)parser didEndElement:(NSString *)elementName namespaceURI:(NSString *)namespaceURI qualifiedName:(NSString *)qName{ NSLog(@"Title: %@",currentTitle); if ([elementName isEqualToString:@"item"]) {// save values to an item, then store that item into the array... [item setObject:currentTitle forKey:@"video_title"]; NSLog(@"Current Title%@", currentTitle); [item setObject:currentLink forKey:@"video_url"]; [item setObject:currentSummary forKey:@"video_description"]; [item setObject:currentDate forKey:@"date"]; [stories addObject:[item copy]]; NSLog(@"adding story: %@", currentTitle); } } I would really appreciate it if someone has any advance

    Read the article

  • How to intercept, parse and compile?

    - by epitka
    This is a problem I've been struggling to solve for a while. I need a way to either replace code in the method with a parsed code from the template at compile time (PostSharp comes to mind) or to create a dynamic proxy (Linfu or Castle). So given a source code like this [Template] private string GetSomething() { var template = [%=Customer.Name%] } I need it to be compiled into this private string GetSomething() { MemoryStream mStream = new MemoryStream(); StreamWriter writer = new StreamWriter(mStream,System.Text.Encoding.UTF8); writer.Write(@"" ); writer.Write(Customer.Name); StreamReader sr = new StreamReader(mStream); writer.Flush(); mStream.Position = 0; return sr.ReadToEnd(); } It is not important what technology is used. I tried with PostSharp's ImplementMethodAspect but got nowhere (due to lack of experience with it). I also looked into Linfu framework. Can somebody suggest some other approach or way to do this, I would really appreciate. My whole project depends on this.

    Read the article

  • Find/parse server-side <?abc?>-like tags in html document

    - by Iggyhopper
    I guess I need some regex help. I want to find all tags like <?abc?> so that I can replace it with whatever the results are for the code ran inside. I just need help regexing the tag/code string, not parsing the code inside :p. <b><?abc print 'test' ?></b> would result in <b>test</b> Edit: Not specifically but in general, matching (<?[chars] (code group) ?>)

    Read the article

  • java.lang.NoClassDefFoundError: com/google/appengine/tools/enhancer/Enhance

    - by user1204337
    I am new to GAE, I follow the instructions on http://code.google.com/eclipse/docs/install-eclipse-3.7.html. I got the installation and registration done pretty fast. But when I tried to build the helloWorld project in Eclipse, before I can do anything, Eclipse gives me an error says "java.lang.NoClassDefFoundError: com/google/appengine/tools/enhancer/Enhance" and it is very weird. Because when you expand the app engine sdk, you can easily find the Enhance class under related jar file. I also tried Enhance e = null; and it is working. It seems that my eclipse just cannot find it. I don't know why it is not working, I am using JDK1.6, I reinstall my eclipse and the google plugins, I even disabled my firewall. Please help!!!

    Read the article

  • Scala parser combinators: how to parse "if(x)" if x can contain a ")"

    - by Germán
    I'm trying to get this to work: def emptyCond: Parser[Cond] = ("if" ~ "(") ~> regularStr <~ ")" ^^ { case s => Cond("",Nil,Nil) } where regularStr is defined to accept a number of things, including ")". Of course, I want this to be an acceptable input: if(foo()). But for any if(x) it is taking the ")" as part of the regularStr and so this parser never succeeds. What am I missing?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Killing COM object from C#

    - by Pradeep
    I have a COM object that we are calling from C#. This works great, and I have my own pool of objects that I can use whenever I want. Now I need to kill the object. I've tried releasing the COM object explicitly and then garbage collecting from another thread, but that does nothing. Does anyone have any other ideas to kill this object? Thanks for the help. I've tried System.Runtime.InteropServices.Marshal.ReleaseComObject(myApp); GC.Collect(); GC.WaitForPendingFinalizers (); myApp = null; and I create it by myApplication.ApplicationClass myApp = new myApplication.ApplicationClass(); Thanks, Pradeep

    Read the article

  • Salon LesJeudis.com : plus de 500 postes IT à pourvoir à Lyon le 22 novembre, à l'Espace Tête d'Or

    Salon LesJeudis.com Lyon : plus de 500 postes IT à pourvoir Le jeudi 22 novembre à l'Espace Tête d'Or LesJeudis.com organise un nouveau salon de recrutement ce jeudi 22 novembre à l'Espace Tête d'Or de 10h à 18h. Pour les développeurs qui recherchent un emploi ou un nouveau poste, plus de 500 postes seront à pourvoir. Parmi les nombreuses entreprises qui seront à la recherche de candidats, citons l'habituel Steria mais aussi Michelin, OVH ou Homsys (spécialiste du conseil en Business Intelligence). Chaque candidat aura également la possibilité de soumettre son profil à un consultant en ressources humaines pour affiner sa stratégie d'attaque.

    Read the article

  • How to parse text as JavaScript?

    - by Danjah
    This question of mine (currently unanswered), drove me toward finding a better solution to what I'm attempting. My requirements: chunks of code which can be arbitrarily added into a document, without an identifier: [div class="thing"] [elements... /] [/div] the objects are scanned for and found by an external script: var things = yd.getElementsBy(function(el){ return yd.hasClass('thing'); },null,document ); the objects must be individually configurable, what I have currently is identifier-based: [div class="thing" id="thing0"] [elements... /] [script type="text/javascript"] new Thing().init({ id:'thing0'; }); [/script] [/div] So I need to ditch the identifier (id="thing0") so there are no duplicates when more than one chunk of the same code is added to a page I still need to be able to config these objects individually, without an identifier SO! All of that said, I wondered about creating a dynamic global variable within the script block of each added chunk of code, within its script tag. As each 'thing' is found, I figure it would be legit to grab the innerHTML of the script tag and somehow convert that text into a useable JS object. Discuss. Ok, don't discuss if you like, but if you get the drift then feel free to correct my wayward thinking or provide a better solution - please! d

    Read the article

  • jQuery Autocomplete fetch and parse data source with custom function, except not

    - by Ben Dauphinee
    So, I am working with the jQuery Autocomplete function, and am trying to write a custom data parser. Not sure what I am doing incorrectly, but it throws an error on trying to call the autocompleteSourceParse function, saying that req is not set. setURL("ajax/clients/ac"); function autocompleteSourceParse(req, add){ var suggestions = []; $.getJSON(getURL()+"/"+req, function(data){ $.each(data, function(i, val){ suggestions.push(val.name); }); add(suggestions); }); return(suggestions); } $("#company").autocomplete({ source: autocompleteSourceParse(req, add), minLength: 2 });

    Read the article

  • Salon LesJeudis.com Paris : plus de 2.000 postes IT à pourvoir ce jeudi 27 septembre, Rennes et Lyon suivront

    Salon LesJeudis.com Paris : plus de 2.000 postes IT à pourvoir cette semaine Le jeudi 27 septembre, Rennes et Lyon suivront LesJeudis.com organise un nouveau salon de recrutement ce jeudi 27 septembre au CNIT de la Défense de 11h à 21h. Pour les développeurs qui recherchent un emploi ou un nouveau poste, plus de 2.000 postes seront à pourvoir. Parmi les nombreuses entreprises qui seront à la recherche de candidats, citons les habituels Sogeti, ou Steria mais aussi dans un éventail assez large des entreprises comme Parrot, Michelin, OVH ou le PMU. Chaque candidat aura également la possibilité de soumettre son profil à un consultant en ressources humain...

    Read the article

  • When does a Tumbling Window Start in StreamInsight

    Whilst getting some courseware ready I was playing around writing some code and I decided to very simply show when a window starts and ends based on you asking for a TumblingWindow of n time units in StreamInsight.  I thought this was going to be a two second thing but what I found was something I haven’t yet found documented anywhere until now.   All this code is written in C# and will slot straight into my favourite quick-win dev tool LinqPad   Let’s first create a sample dataset   var EnumerableCollection = new [] { new {id = 1, StartTime = DateTime.Parse("2010-10-01 12:00:00 PM").ToLocalTime()}, new {id = 2, StartTime = DateTime.Parse("2010-10-01 12:20:00 PM").ToLocalTime()}, new {id = 3, StartTime = DateTime.Parse("2010-10-01 12:30:00 PM").ToLocalTime()}, new {id = 4, StartTime = DateTime.Parse("2010-10-01 12:40:00 PM").ToLocalTime()}, new {id = 5, StartTime = DateTime.Parse("2010-10-01 12:50:00 PM").ToLocalTime()}, new {id = 6, StartTime = DateTime.Parse("2010-10-01 01:00:00 PM").ToLocalTime()}, new {id = 7, StartTime = DateTime.Parse("2010-10-01 01:10:00 PM").ToLocalTime()}, new {id = 8, StartTime = DateTime.Parse("2010-10-01 02:00:00 PM").ToLocalTime()}, new {id = 9, StartTime = DateTime.Parse("2010-10-01 03:20:00 PM").ToLocalTime()}, new {id = 10, StartTime = DateTime.Parse("2010-10-01 03:30:00 PM").ToLocalTime()}, new {id = 11, StartTime = DateTime.Parse("2010-10-01 04:40:00 PM").ToLocalTime()}, new {id = 12, StartTime = DateTime.Parse("2010-10-01 04:50:00 PM").ToLocalTime()}, new {id = 13, StartTime = DateTime.Parse("2010-10-01 05:00:00 PM").ToLocalTime()}, new {id = 14, StartTime = DateTime.Parse("2010-10-01 05:10:00 PM").ToLocalTime()} };   Now let’s create a stream of point events   var inputStream = EnumerableCollection .ToPointStream(Application,evt=> PointEvent .CreateInsert(evt.StartTime,evt),AdvanceTimeSettings.StrictlyIncreasingStartTime);   Now we can create our windows over the stream.  The first window we will create is a one hour tumbling window.  We’'ll count the events in the window but what we do here is not the point, the point is our window edges.   var windowedStream = from win in inputStream.TumblingWindow(TimeSpan.FromHours(1),HoppingWindowOutputPolicy.ClipToWindowEnd) select new {CountOfEntries = win.Count()};   Now we can have a look at what we get.  I am only going to show the first non Cti event as that is enough to demonstrate what is going on   windowedStream.ToIntervalEnumerable().First(e=> e.EventKind == EventKind.Insert).Dump("First Row from Windowed Stream");   The results are below   EventKind Insert   StartTime 01/10/2010 12:00   EndTime 01/10/2010 13:00     { CountOfEntries = 5 }   Payload CountOfEntries 5   Now this makes sense and is quite often the width of window specified in examples.  So what happens if I change the windowing code now to var windowedStream = from win in inputStream.TumblingWindow(TimeSpan.FromHours(5),HoppingWindowOutputPolicy.ClipToWindowEnd) select new {CountOfEntries = win.Count()}; Now where does your window start?  What about   var windowedStream = from win in inputStream.TumblingWindow(TimeSpan.FromMinutes(13),HoppingWindowOutputPolicy.ClipToWindowEnd) select new {CountOfEntries = win.Count()};   Well for the first example your window will start at 01/10/2010 10:00:00 , and for the second example it will start at  01/10/2010 11:55:00 Surprised?   Here is the reason why and thanks to the StreamInsight team for listening.   Windows start at TimeSpan.MinValue. Windows are then created from that point onwards of the size you specified in your code.  If a window contains no events they are not produced by the engine to the output.  This is why window start times can be before the first event is created.

    Read the article

< Previous Page | 83 84 85 86 87 88 89 90 91 92 93 94  | Next Page >